Diaphorina citri psyllid: psy3870


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MVKNVLDGNMESNSYEDTLRELFGIHAYIAFTLDKIVSNAVRQLQHLVSDETCIECYETFLKESKKGATGGLCETAHQRVHLEQGYQKKSEVAMTDENCFKIIIFKKDCKLTIELLDTESSDNEGEDNDNDNDEDKDDNEHDPDQSTQDSEKWSPYEEEPFPERNTAPANEETLVEPKVESEPPEQSTTDSQETDQDQDVPEQ
ccHHHcccccccHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MVKNVLDGNMESNSYEDTLRELFGIHAYIAFTLDKIVSNAVRQLQHLVSDETCIECYETFLKESKKG**********QRVHLEQGYQKKSEVAMTDENCFKIIIFKKDCKLTIELLDTE*************DEDKDDNEH**************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKNVLDGNMESNSYEDTLRELFGIHAYIAFTLDKIVSNAVRQLQHLVSDETCIECYETFLKESKKGATGGLCETAHQRVHLEQGYQKKSEVAMTDENCFKIIIFKKDCKLTIELLDTESSDNEGEDNDNDNDEDKDDNEHDPDQSTQDSEKWSPYEEEPFPERNTAPANEETLVEPKVESEPPEQSTTDSQETDQDQDVPEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0002682 [BP]regulation of immune system processprobableGO:0008150, GO:0065007, GO:0050789
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0010243 [BP]response to organic nitrogenprobableGO:0009719, GO:0050896, GO:1901698, GO:0008150, GO:0042221, GO:0010033
GO:0043619 [BP]regulation of transcription from RNA polymerase II promoter in response to oxidative stressprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0070887, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0043618, GO:0019219, GO:0006357, GO:0065007, GO:0010468, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0008150, GO:0051171, GO:2001141, GO:0042221, GO:0034599, GO:0006979, GO:0043620, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0033554, GO:0044763
GO:0070822 [CC]Sin3-type complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044454, GO:0044451, GO:0005694, GO:0000118, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0017053 [CC]transcriptional repressor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0007568 [BP]agingprobableGO:0044767, GO:0032502, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted