Diaphorina citri psyllid: psy3877


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MMAIRLMQLFSDTKSDFTTLAGILGLYFQVRDDYCNLCSKEYSENKSFCEDLTEGKFSFPIIHAIQSRPDDRQVIQILRQRTRDVEVKKYCISLLDRFGSFEHTREVLKELDVSARTEVARLGGNPLLEAILDELLTWDTPDSPK
cHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccccccHcccccHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccc
MMAIRLMQLFSDTKSDFTTLAGILGLYFQVRDDYCNLCSKEYSENKSFCEDLTEGKFSFPIIHAIQSRPDDRQVIQILRQRTRDVEVKKYCISLLDRFGSFEHTREVLKELDVSARTEVARLGGNPLLEAILDELLTW*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMAIRLMQLFSDTKSDFTTLAGILGLYFQVRDDYCNLCSKEYSENKSFCEDLTEGKFSFPIIHAIQSRPDDRQVIQILRQRTRDVEVKKYCISLLDRFGSFEHTREVLKELDVSARTEVARLGGNPLLEAILDELLTWDTPDSPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Geranylgeranyl pyrophosphate synthase Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins.confidentP56966
Geranylgeranyl pyrophosphate synthase Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins.confidentQ6F596
Geranylgeranyl pyrophosphate synthase Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins.confidentQ9WTN0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004311 [MF]farnesyltranstransferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0004659, GO:0003824
GO:0004337 [MF]geranyltranstransferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0004659, GO:0003824
GO:0016117 [BP]carotenoid biosynthetic processprobableGO:0044249, GO:1901576, GO:0044710, GO:0042440, GO:0016109, GO:0016108, GO:0071704, GO:0006629, GO:0006721, GO:0006720, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0044255, GO:0046148, GO:0008610, GO:0044238, GO:0044237, GO:0008299, GO:0016116, GO:0016114

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Q80, chain A
Confidence level:very confident
Coverage over the Query: 2-140
View the alignment between query and template
View the model in PyMOL