Query         psy3878
Match_columns 299
No_of_seqs    66 out of 68
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 19:42:14 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3878.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3878hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10699 HAP2-GCS1:  Male gamet  27.3      18 0.00039   26.6  -0.3    7   30-36     13-19  (49)
  2 PF07744 SPOC:  SPOC domain;  I  25.7      64  0.0014   25.4   2.5   26  265-290    87-119 (119)
  3 COG3088 CcmH Uncharacterized p  23.6      40 0.00087   30.4   1.1   20  264-285    80-99  (153)
  4 PF08861 DUF1828:  Domain of un  22.6      47   0.001   26.0   1.2   19  260-278    43-61  (90)
  5 TIGR03147 cyt_nit_nrfF cytochr  22.0      47   0.001   28.9   1.2   19  265-285    77-95  (126)
  6 PF03918 CcmH:  Cytochrome C bi  21.6      43 0.00093   29.3   0.9   14  266-279    78-91  (148)
  7 PRK10144 formate-dependent nit  20.6      52  0.0011   28.6   1.2   19  265-285    77-95  (126)
  8 PF10783 DUF2599:  Protein of u  15.7      95  0.0021   25.6   1.6   19   15-33     72-91  (93)
  9 TIGR01340 aconitase_mito aconi  14.6 1.1E+02  0.0024   33.5   2.2   42  257-298   106-160 (745)
 10 cd01584 AcnA_Mitochondrial Aco  12.4 1.5E+02  0.0032   30.3   2.2   40  258-298    50-103 (412)

No 1  
>PF10699 HAP2-GCS1:  Male gamete fusion factor;  InterPro: IPR018928  The gene encoding Arabidopsis HAP2 is allelic with GCS1 (Generative cell-specific protein 1). HAP2 is expressed only in the haploid sperm and is required for efficient guidance of the pollen tube to the ovules. In Arabidopsis the protein is a predicted membrane protein with an N-terminal secretion signal, a single transmembrane domain and a C-terminal histidine-rich domain []. HAP2-GCS1 is found from plants to lower eukaryotes and is necessary for the fusion of the gametes in fertilisation. It is involved in a novel mechanism for gamete fusion where a first species-specific protein binds male and female gamete membranes together after which a second, broadly conserved protein, either directly or indirectly, causes fusion of the two membranes together. The broadly conserved protein is represented by this HAP2-GCS1 domain, conserved from plants to lower eukaryotes []. In Plasmodium berghei the protein is expressed only in male gametocytes and gametes, having a male-specific function during the interaction with female gametes, and being indispensable for parasite fertilisation. The gene in plants and eukaryotes might well have originated from acquisition of plastids from red algae []. 
Probab=27.26  E-value=18  Score=26.59  Aligned_cols=7  Identities=43%  Similarity=1.056  Sum_probs=6.0

Q ss_pred             HHHhccc
Q psy3878          30 AQCNKLS   36 (299)
Q Consensus        30 AtCNKIg   36 (299)
                      .+|||||
T Consensus        13 ~eCnKIG   19 (49)
T PF10699_consen   13 LECNKIG   19 (49)
T ss_pred             CccCcce
Confidence            3899998


No 2  
>PF07744 SPOC:  SPOC domain;  InterPro: IPR012921 Spen (split end) proteins regulate the expression of key transcriptional effectors in diverse signalling pathways. They are large proteins characterised by N-terminal RNA-binding motifs and a highly conserved C-terminal SPOC (Spen paralog and ortholog C-terminal) domain. The function of the SPOC domain is unknown, but the SPOC domain of the SHARP Spen protein has been implicated in the interaction of SHARP with the SMRT/NcoR corepressor, where SHARP plays an essential role in the repressor complex []. The SPOC domain is folded into a single compact domain consisting of a beta-barrel with seven strands framed by six alpha helices. A number of deep grooves and clefts in the surface, plus two nonpolar loops, render the SPOC domain well suited to protein-protein interactions; most of the conserved residues occur on the protein surface rather than in the core. Other proteins containing a SPOC domain include drosophila Split ends, which promotes sclerite development in the head and restricts it in the thorax, and mouse MINT (homologue of SHARP), which is involved in skeletal and neuronal development via its repression of Msx2.; PDB: 1OW1_A.
Probab=25.65  E-value=64  Score=25.45  Aligned_cols=26  Identities=42%  Similarity=0.697  Sum_probs=16.8

Q ss_pred             hHhHHHhhh--hcceeEEEe-----eeeeeeec
Q psy3878         265 MKLINYFVS--RYGVYSMTL-----YKTSFVFP  290 (299)
Q Consensus       265 ~~~~~~~~~--~~~~~~~~~-----~~~~~~~~  290 (299)
                      -+||+||.+  |+||-...-     -|.-++||
T Consensus        87 ~~l~~Yl~~k~r~GVv~~~~~~~~~~~dlYl~P  119 (119)
T PF07744_consen   87 QKLVDYLKSKQRAGVVSVGNSPSGQVKDLYLFP  119 (119)
T ss_dssp             HHTHHHHHHHTEEEEEEE--TT--S-EEEEEE-
T ss_pred             HHHHHHHhhCCEEEEEecCCCCCCceeEEEEcC
Confidence            469999986  689977664     46666666


No 3  
>COG3088 CcmH Uncharacterized protein involved in biosynthesis of c-type cytochromes [Posttranslational modification, protein turnover, chaperones]
Probab=23.55  E-value=40  Score=30.36  Aligned_cols=20  Identities=45%  Similarity=0.966  Sum_probs=15.6

Q ss_pred             hhHhHHHhhhhcceeEEEeeee
Q psy3878         264 YMKLINYFVSRYGVYSMTLYKT  285 (299)
Q Consensus       264 R~~~~~~~~~~~~~~~~~~~~~  285 (299)
                      ...+|+|+|.|||-+  .+||-
T Consensus        80 ~~qIid~mVaRYG~F--Vly~P   99 (153)
T COG3088          80 DQQIIDYMVARYGEF--VLYKP   99 (153)
T ss_pred             HHHHHHHHHHhhcce--eeecC
Confidence            456899999999975  46664


No 4  
>PF08861 DUF1828:  Domain of unknown function DUF1828;  InterPro: IPR014960 These proteins are functionally uncharacterised. 
Probab=22.56  E-value=47  Score=26.03  Aligned_cols=19  Identities=26%  Similarity=0.516  Sum_probs=16.8

Q ss_pred             cccchhHhHHHhhhhccee
Q psy3878         260 RTRLYMKLINYFVSRYGVY  278 (299)
Q Consensus       260 RS~rR~~~~~~~~~~~~~~  278 (299)
                      |+.+|.++|+-.+..|||-
T Consensus        43 ~s~~R~~~l~~il~~~gv~   61 (90)
T PF08861_consen   43 RSKKRKKILNSILNGFGVE   61 (90)
T ss_pred             cchHHHHHHHHHHHHcCcc
Confidence            6679999999999999974


No 5  
>TIGR03147 cyt_nit_nrfF cytochrome c nitrite reductase, accessory protein NrfF.
Probab=22.04  E-value=47  Score=28.86  Aligned_cols=19  Identities=26%  Similarity=0.835  Sum_probs=14.3

Q ss_pred             hHhHHHhhhhcceeEEEeeee
Q psy3878         265 MKLINYFVSRYGVYSMTLYKT  285 (299)
Q Consensus       265 ~~~~~~~~~~~~~~~~~~~~~  285 (299)
                      -.++.|||.|||-|-  ||+.
T Consensus        77 ~eI~~~~v~RYG~~V--ly~P   95 (126)
T TIGR03147        77 QQIIDFMTARFGDFV--LYNP   95 (126)
T ss_pred             HHHHHHHHHhcCCeE--EecC
Confidence            357899999999764  5553


No 6  
>PF03918 CcmH:  Cytochrome C biogenesis protein;  InterPro: IPR005616 Members of this family include NrfF, CcmH, CycL, Ccl2.; PDB: 2KW0_A 2HL7_A.
Probab=21.60  E-value=43  Score=29.30  Aligned_cols=14  Identities=50%  Similarity=1.186  Sum_probs=11.4

Q ss_pred             HhHHHhhhhcceeE
Q psy3878         266 KLINYFVSRYGVYS  279 (299)
Q Consensus       266 ~~~~~~~~~~~~~~  279 (299)
                      .+++|||.|||-+-
T Consensus        78 eI~~~~v~rYG~~V   91 (148)
T PF03918_consen   78 EIIDYFVERYGEFV   91 (148)
T ss_dssp             HHHHHHHHHHTTT-
T ss_pred             HHHHHHHHhcCcce
Confidence            47899999999764


No 7  
>PRK10144 formate-dependent nitrite reductase complex subunit NrfF; Provisional
Probab=20.57  E-value=52  Score=28.60  Aligned_cols=19  Identities=26%  Similarity=0.749  Sum_probs=14.3

Q ss_pred             hHhHHHhhhhcceeEEEeeee
Q psy3878         265 MKLINYFVSRYGVYSMTLYKT  285 (299)
Q Consensus       265 ~~~~~~~~~~~~~~~~~~~~~  285 (299)
                      -.++.|||.|||-|-  ||+.
T Consensus        77 ~eI~~~~v~RYG~~V--l~~P   95 (126)
T PRK10144         77 VEIIGWMTERYGDFV--RYNP   95 (126)
T ss_pred             HHHHHHHHHhcCCeE--EecC
Confidence            357899999999764  5553


No 8  
>PF10783 DUF2599:  Protein of unknown function (DUF2599);  InterPro: IPR019719 The function of the bacterial proteins in this entry is not known. 
Probab=15.71  E-value=95  Score=25.58  Aligned_cols=19  Identities=32%  Similarity=0.345  Sum_probs=16.3

Q ss_pred             cCCC-CCCCCHHHHHHHHHh
Q psy3878          15 TEHP-GLRGTPLAMLAAQCN   33 (299)
Q Consensus        15 ~EeP-rlgsTPLAMLAAtCN   33 (299)
                      ..|| |---.-..|+||-||
T Consensus        72 NLEP~RP~V~~~~~~a~~CN   91 (93)
T PF10783_consen   72 NLEPWRPDVSYEEMVAAGCN   91 (93)
T ss_pred             cCCCCCCCCCHHHHHHhcCC
Confidence            4577 777889999999999


No 9  
>TIGR01340 aconitase_mito aconitate hydratase, mitochondrial. This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase.
Probab=14.58  E-value=1.1e+02  Score=33.45  Aligned_cols=42  Identities=21%  Similarity=0.377  Sum_probs=30.5

Q ss_pred             CCCcccchhHhHHHhhhhcceeEEE--------eeeeeeeecCC-----CCCCcC
Q psy3878         257 PTPRTRLYMKLINYFVSRYGVYSMT--------LYKTSFVFPGR-----DSKTCN  298 (299)
Q Consensus       257 pspRS~rR~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~-----~~~~~~  298 (299)
                      ...|+..|++.+..|..+||+.-.-        +---.|++||.     ||.||+
T Consensus       106 a~~~N~e~~~~lr~~a~~~gi~~~~~g~GI~Hqv~~E~~a~PG~~ivGtDSHT~t  160 (745)
T TIGR01340       106 AIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN  160 (745)
T ss_pred             HhHhHHHHHHHHHHHHHHCCCEEECCCCCeeceEchhhccCCCCeEEccCCCccc
Confidence            4468889999999999999984211        00112888875     999996


No 10 
>cd01584 AcnA_Mitochondrial Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.
Probab=12.40  E-value=1.5e+02  Score=30.30  Aligned_cols=40  Identities=23%  Similarity=0.350  Sum_probs=28.9

Q ss_pred             CCcccchhHhHHHhhhhcceeEEEe---------eeeeeeecCC-----CCCCcC
Q psy3878         258 TPRTRLYMKLINYFVSRYGVYSMTL---------YKTSFVFPGR-----DSKTCN  298 (299)
Q Consensus       258 spRS~rR~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~-----~~~~~~  298 (299)
                      -.|+..|++.|..|..+||++-...         .. .|++||.     ||.||.
T Consensus        50 ~~~n~~~~~~~r~~a~~~gi~~~~~g~GI~Hqv~~E-~~~~PG~~ivG~DSHT~t  103 (412)
T cd01584          50 KDINKEVYDFLASAGAKYGIGFWKPGSGIIHQIVLE-NYAFPGLLMIGTDSHTPN  103 (412)
T ss_pred             hhhhHHHHHHHHHHHHHcCCeEECCCCCeeceEchh-hccCCCCeEEeccCCCCC
Confidence            3556679999999999999852211         11 2888875     999995


Done!