Query         psy388
Match_columns 94
No_of_seqs    125 out of 1027
Neff          7.1 
Searched_HMMs 46136
Date          Fri Aug 16 19:44:30 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy388.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/388hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00201 UDPGT:  UDP-glucoronos  99.9 7.5E-26 1.6E-30  173.3  -0.1   81    1-81    416-496 (500)
  2 PHA03392 egt ecdysteroid UDP-g  99.7 6.2E-18 1.3E-22  132.0   7.0   58    1-58    439-497 (507)
  3 KOG1192|consensus               99.1 2.8E-10   6E-15   87.1   6.5   53    1-55    429-481 (496)
  4 PF05478 Prominin:  Prominin;    85.5     1.4   3E-05   36.9   4.3   43   43-85     85-127 (806)
  5 PF07856 Orai-1:  Mediator of C  79.3     2.6 5.6E-05   29.3   3.1   76    8-83     91-172 (175)
  6 PF07069 PRRSV_2b:  Porcine rep  73.8      16 0.00034   21.5   5.1   34   49-82     26-61  (73)
  7 PF15013 CCSMST1:  CCSMST1 fami  69.4     3.8 8.3E-05   24.9   1.8   19   35-53     21-39  (77)
  8 PF07219 HemY_N:  HemY protein   65.9      26 0.00057   21.9   5.2   24   53-76     19-42  (108)
  9 PF15050 SCIMP:  SCIMP protein   64.6      20 0.00044   23.7   4.5   10   70-79     26-35  (133)
 10 PF11628 TCR_zetazeta:  T-cell   62.7      18  0.0004   18.4   3.2   19   47-65      5-23  (33)
 11 PF01102 Glycophorin_A:  Glycop  59.9      24 0.00052   23.1   4.3   21   54-74     68-88  (122)
 12 PF02038 ATP1G1_PLM_MAT8:  ATP1  55.9      25 0.00053   19.6   3.3   25   44-68      8-32  (50)
 13 PF15050 SCIMP:  SCIMP protein   54.7      35 0.00077   22.6   4.4   37   42-78      1-38  (133)
 14 PRK14471 F0F1 ATP synthase sub  53.4      38 0.00083   22.5   4.6   25   67-91     22-46  (164)
 15 PRK07353 F0F1 ATP synthase sub  48.7      43 0.00094   21.5   4.2   27   65-91     17-43  (140)
 16 PRK14475 F0F1 ATP synthase sub  47.3      35 0.00077   22.9   3.7   19   72-90     29-47  (167)
 17 KOG4331|consensus               47.1      29 0.00062   29.8   3.7   43   42-84     97-139 (865)
 18 PRK04125 murein hydrolase regu  46.7      87  0.0019   21.0   5.5   13   64-76    106-118 (141)
 19 PRK05759 F0F1 ATP synthase sub  46.5      60  0.0013   21.2   4.7   22   70-91     21-42  (156)
 20 PF02060 ISK_Channel:  Slow vol  44.6      93   0.002   20.7   5.2   18   18-35     13-30  (129)
 21 PRK09174 F0F1 ATP synthase sub  44.2      58  0.0013   22.9   4.5   22   70-91     70-91  (204)
 22 PRK13453 F0F1 ATP synthase sub  42.7      92   0.002   21.0   5.2   23   69-91     34-56  (173)
 23 COG2011 AbcD ABC-type metal io  42.1      49  0.0011   24.0   3.8   34   45-78    186-219 (222)
 24 PF06643 DUF1158:  Protein of u  42.1      78  0.0017   19.1   5.2   16   65-80     64-79  (82)
 25 PRK13460 F0F1 ATP synthase sub  41.8      55  0.0012   22.1   4.0   21   70-90     33-53  (173)
 26 PF10661 EssA:  WXG100 protein   41.7      54  0.0012   22.0   3.8   16   60-75    129-144 (145)
 27 PF10577 UPF0560:  Uncharacteri  41.3      41 0.00089   28.7   3.8   17   41-59    266-282 (807)
 28 COG0711 AtpF F0F1-type ATP syn  40.9      80  0.0017   21.2   4.7   27   66-92     19-45  (161)
 29 PF15086 UPF0542:  Uncharacteri  40.9      81  0.0018   19.0   8.1   15   17-31      6-20  (74)
 30 PRK13454 F0F1 ATP synthase sub  40.6      90   0.002   21.3   5.0   22   70-91     48-69  (181)
 31 PTZ00046 rifin; Provisional     40.2      79  0.0017   24.5   4.9    8   85-92    342-349 (358)
 32 PF05186 Dpy-30:  Dpy-30 motif;  39.6      36 0.00079   18.0   2.3   20    3-22     17-36  (42)
 33 PRK11024 colicin uptake protei  39.3      27 0.00058   22.8   2.1   14   49-62     20-33  (141)
 34 PRK14473 F0F1 ATP synthase sub  39.3 1.1E+02  0.0025   20.2   5.3   27   66-92     21-47  (164)
 35 TIGR01477 RIFIN variant surfac  38.9      84  0.0018   24.3   4.9    7   86-92    338-344 (353)
 36 PF00558 Vpu:  Vpu protein;  In  38.0      59  0.0013   19.9   3.3   19   49-67      3-21  (81)
 37 PF00430 ATP-synt_B:  ATP synth  36.9      72  0.0016   19.9   3.8   22   69-90     15-36  (132)
 38 PRK06569 F0F1 ATP synthase sub  36.0 1.3E+02  0.0028   20.5   5.0   22   69-90     26-47  (155)
 39 TIGR02804 ExbD_2 TonB system t  35.2      54  0.0012   20.8   3.0   14   49-62      9-22  (121)
 40 TIGR02801 tolR TolR protein. T  35.0      39 0.00085   21.5   2.3   14   49-62     10-23  (129)
 41 cd07912 Tweety_N N-terminal do  34.6 1.9E+02  0.0041   22.8   6.4   14   19-32      4-17  (418)
 42 PF00201 UDPGT:  UDP-glucoronos  33.9      14  0.0003   28.5   0.0   23   65-87    476-498 (500)
 43 PF11057 Cortexin:  Cortexin of  33.8      75  0.0016   19.3   3.2   14   62-75     40-53  (81)
 44 PRK11267 biopolymer transport   33.5      40 0.00088   22.0   2.2   14   49-62     23-36  (141)
 45 PF04659 Arch_fla_DE:  Archaeal  33.5      34 0.00073   21.6   1.8   19   16-34     18-36  (99)
 46 PRK13461 F0F1 ATP synthase sub  33.4 1.4E+02  0.0031   19.6   5.2   22   70-91     22-43  (159)
 47 PF14756 Pdase_C33_assoc:  Pept  33.3      22 0.00047   23.6   0.9   25   10-34     42-66  (147)
 48 PRK14474 F0F1 ATP synthase sub  32.8 1.5E+02  0.0032   21.4   5.3   31   62-92     14-44  (250)
 49 TIGR00540 hemY_coli hemY prote  32.5 1.3E+02  0.0029   22.7   5.2   45   26-76     21-67  (409)
 50 smart00394 RIIa RIIalpha, Regu  32.4      74  0.0016   16.0   3.3   24    4-27     11-34  (38)
 51 PF06667 PspB:  Phage shock pro  31.7 1.2E+02  0.0026   18.2   4.1   26   51-76      4-29  (75)
 52 TIGR02803 ExbD_1 TonB system t  30.6      52  0.0011   20.8   2.3   14   49-62      9-22  (122)
 53 PF05478 Prominin:  Prominin;    30.4      24 0.00051   29.7   0.9   29   53-82     99-127 (806)
 54 PRK14472 F0F1 ATP synthase sub  29.4 1.8E+02  0.0039   19.5   5.2   21   70-90     35-55  (175)
 55 PF11395 DUF2873:  Protein of u  29.1      97  0.0021   16.3   4.3    9   42-50      4-12  (43)
 56 PRK08476 F0F1 ATP synthase sub  29.0 1.7E+02  0.0037   19.1   5.2   26   66-91     20-45  (141)
 57 PF05944 Phage_term_smal:  Phag  29.0      50  0.0011   21.8   2.1   15   16-30     64-78  (132)
 58 PRK10747 putative protoheme IX  28.4 1.8E+02  0.0039   22.0   5.3   24   53-76     44-67  (398)
 59 COG3534 AbfA Alpha-L-arabinofu  28.4      43 0.00094   27.0   1.9   30   14-44    130-163 (501)
 60 COG0848 ExbD Biopolymer transp  27.6      62  0.0013   21.4   2.4   15   49-63     21-35  (137)
 61 CHL00118 atpG ATP synthase CF0  27.6 1.6E+02  0.0035   19.4   4.4   24   68-91     37-60  (156)
 62 PF02197 RIIa:  Regulatory subu  27.5      96  0.0021   15.8   2.6   23    4-26     11-33  (38)
 63 PF03929 PepSY_TM:  PepSY-assoc  26.4      88  0.0019   15.0   3.4   17   47-63      6-22  (27)
 64 PF05568 ASFV_J13L:  African sw  26.4 1.8E+02  0.0039   20.0   4.4   10   43-52     25-34  (189)
 65 PF09919 DUF2149:  Uncharacteri  25.6 1.1E+02  0.0024   19.0   3.1   19   48-66      6-24  (92)
 66 TIGR02976 phageshock_pspB phag  25.4 1.6E+02  0.0034   17.6   4.2   24   52-75      5-28  (75)
 67 PF14770 TMEM18:  Transmembrane  24.9 1.1E+02  0.0023   20.0   3.0   20   19-39     51-70  (123)
 68 PF06709 DUF1196:  Protein of u  24.7 1.1E+02  0.0023   16.9   2.5   18   74-91     19-36  (51)
 69 TIGR03321 alt_F1F0_F0_B altern  24.3 2.5E+02  0.0055   20.0   5.2   25   67-91     19-43  (246)
 70 PF11346 DUF3149:  Protein of u  24.0 1.3E+02  0.0028   16.0   4.6   12   44-55      3-14  (42)
 71 PF14043 WVELL:  WVELL protein   23.7      82  0.0018   19.0   2.1   20    7-26     11-30  (75)
 72 COG5102 SFT2 Membrane protein   23.3 2.3E+02  0.0051   20.0   4.6   29   30-58     50-78  (201)
 73 TIGR02384 RelB_DinJ addiction   23.3 1.8E+02  0.0038   17.5   3.6   31    4-34     17-47  (83)
 74 COG5547 Small integral membran  23.2 1.6E+02  0.0035   17.0   4.3   20   43-62      2-21  (62)
 75 KOG3814|consensus               23.2      62  0.0013   25.8   1.9   27    7-33    418-444 (531)
 76 PHA02688 ORF059 IMV protein VP  23.0 1.8E+02  0.0039   22.3   4.3   61   16-80    256-316 (323)
 77 PF03908 Sec20:  Sec20;  InterP  22.7 1.2E+02  0.0026   18.2   2.9   14   50-63     68-81  (92)
 78 KOG4433|consensus               22.6 3.6E+02  0.0079   22.0   6.1   63   15-82      4-74  (526)
 79 PF14979 TMEM52:  Transmembrane  22.5 1.8E+02  0.0039   19.9   3.8    7   66-72     37-43  (154)
 80 PF08390 TRAM1:  TRAM1-like pro  22.4 1.7E+02  0.0036   16.7   4.3   21   41-61     18-38  (65)
 81 PF04689 S1FA:  DNA binding pro  22.1      68  0.0015   18.9   1.5   19   67-85     30-48  (69)
 82 PF04906 Tweety:  Tweety;  Inte  22.1   3E+02  0.0064   21.4   5.5   17   65-81     33-49  (406)
 83 PF06837 Fijivirus_P9-2:  Fijiv  22.0   3E+02  0.0065   19.7   5.0   65   10-80     43-109 (214)
 84 PHA02851 EEV glycoprotein; Pro  21.9 1.2E+02  0.0025   21.2   2.9   12   74-85     22-33  (223)
 85 PF08418 Pol_alpha_B_N:  DNA po  21.7      71  0.0015   22.7   1.9   45    3-48     14-58  (253)
 86 PF15179 Myc_target_1:  Myc tar  21.3 2.6E+02  0.0057   19.8   4.6   42   42-83     10-55  (197)
 87 PF00957 Synaptobrevin:  Synapt  21.0 1.7E+02  0.0038   17.2   3.3   11   44-54     62-72  (89)
 88 PF04221 RelB:  RelB antitoxin;  20.8 1.7E+02  0.0038   17.2   3.3   32    3-34     15-46  (83)
 89 PF04276 DUF443:  Protein of un  20.6   2E+02  0.0044   19.9   4.0    9   44-52     79-87  (199)
 90 PF05568 ASFV_J13L:  African sw  20.1   3E+02  0.0065   19.0   4.5   14   46-59     25-38  (189)

No 1  
>PF00201 UDPGT:  UDP-glucoronosyl and UDP-glucosyl transferase;  InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule. This family currently consist of:  Mammalian UDP-glucuronosyl transferases (2.4.1.17 from EC) (UDPGT) []. A large family of membrane-bound microsomal enzymes which catalyze the transfer of glucuronic acid to a wide variety of exogenous and endogenous lipophilic substrates. These enzymes are of major importance in the detoxification and subsequent elimination of xenobiotics such as drugs and carcinogens. A large number of putative UDPGT from Caenorhabditis elegans. Mammalian 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [] (2.4.1.45 from EC) (also known as UDP-galactose-ceramide galactosyltransferase). This enzyme catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Plants flavonol O(3)-glucosyltransferase (2.4.1.91 from EC). An enzyme [] that catalyzes the transfer of glucose from UDP-glucose to a flavanol. This reaction is essential and one of the last steps in anthocyanin pigment biosynthesis. Baculoviruses ecdysteroid UDP-glucosyltransferase (2.4.1 from EC) [] (egt). This enzyme catalyzes the transfer of glucose from UDP-glucose to ectysteroids which are insect molting hormones. The expression of egt in the insect host interferes with the normal insect development by blocking the molting process. Prokaryotic zeaxanthin glucosyltransferase (2.4.1 from EC) (gene crtX), an enzyme involved in carotenoid biosynthesis and that catalyses the glycosylation reaction which converts zeaxanthin to zeaxanthin-beta-diglucoside. Streptomyces macrolide glycosyltransferases (2.4.1 from EC) []. These enzymes specifically inactivates macrolide anitibiotics via 2'-O-glycosylation using UDP-glucose.  These enzymes share a conserved domain of about 50 amino acid residues located in their C-terminal section.; GO: 0016758 transferase activity, transferring hexosyl groups, 0008152 metabolic process; PDB: 3HBJ_A 3HBF_A 2PQ6_A 3IA7_B 3RSC_A 3IAA_B 2IYA_A 2IYF_B 2O6L_A 2VCH_A ....
Probab=99.91  E-value=7.5e-26  Score=173.29  Aligned_cols=81  Identities=47%  Similarity=0.840  Sum_probs=8.1

Q ss_pred             ChhhhHHhhcCCCCHHHHHHHHHHHHHhcCCCccccccccCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy388            1 MQYYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNV   80 (94)
Q Consensus         1 a~~ls~~~~drP~~P~d~av~wiE~vir~~g~~~l~~~~~~l~~~qy~~lDv~~~l~~~~~~~~~~~~~~~~~~~~~~~~   80 (94)
                      |+++|++++|||++|.|+|+||||||+||||++||++++.++||+|||+|||+++++++++++++++++++++++|++++
T Consensus       416 a~~ls~~~~~~p~~p~~~~~~~ie~v~~~~~~~~l~~~~~~l~~~~~~~lDv~~~~~~~~~~~~~~~~~~~~~~~~~~~~  495 (500)
T PF00201_consen  416 AKRLSSLFRDRPISPLERAVWWIEYVARHGGAPHLRSPARDLSFYQYYLLDVIAFLLLIILLIIYIIFKICRFVCRKCVK  495 (500)
T ss_dssp             HHHHHHTTT-----------------------------------------------------------------------
T ss_pred             HHHHHHHHhcCCCCHHHHHHHHHHHHHhcCCCcccCChhhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            57899999999999999999999999999999999999999999999999999998888888888888888888888876


Q ss_pred             h
Q psy388           81 I   81 (94)
Q Consensus        81 ~   81 (94)
                      .
T Consensus       496 ~  496 (500)
T PF00201_consen  496 K  496 (500)
T ss_dssp             -
T ss_pred             c
Confidence            5


No 2  
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional
Probab=99.73  E-value=6.2e-18  Score=131.97  Aligned_cols=58  Identities=33%  Similarity=0.703  Sum_probs=54.3

Q ss_pred             ChhhhHHhhcCCCCHHHHHHHHHHHHHhcC-CCccccccccCccHHHHHHHHHHHHHHH
Q psy388            1 MQYYSLLSKDTPMSPIEKSIWWIEYVLRHK-GVAHLHSAAADLSYVQYYLLDVIAFIIT   58 (94)
Q Consensus         1 a~~ls~~~~drP~~P~d~av~wiE~vir~~-g~~~l~~~~~~l~~~qy~~lDv~~~l~~   58 (94)
                      |+++|+.++|+|++|.|+|+||||||+||+ |++|||+++.++||+|||++||++++++
T Consensus       439 a~~ls~~~~~~p~~~~~~av~~iE~v~r~~~g~~~lr~~~~~l~~~qy~~lDv~~~~~~  497 (507)
T PHA03392        439 LKELRHLIRHQPMTPLHKAIWYTEHVIRNKHGNTSLKTKAANVSYSDYFMSYILVPLVT  497 (507)
T ss_pred             HHHHHHHHHhCCCCHHHHHHHHHHHHHhCCCCcccccccccCCCHHHHHHHHHHHHHHH
Confidence            578999999999999999999999999999 9999999999999999999999866543


No 3  
>KOG1192|consensus
Probab=99.08  E-value=2.8e-10  Score=87.08  Aligned_cols=53  Identities=47%  Similarity=0.830  Sum_probs=50.5

Q ss_pred             ChhhhHHhhcCCCCHHHHHHHHHHHHHhcCCCccccccccCccHHHHHHHHHHHH
Q psy388            1 MQYYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAF   55 (94)
Q Consensus         1 a~~ls~~~~drP~~P~d~av~wiE~vir~~g~~~l~~~~~~l~~~qy~~lDv~~~   55 (94)
                      |++++.+++|||++| |.+++|+||+.|+++++++++. .+++|++|+++|++.+
T Consensus       429 ~~~l~~~~~~~p~~~-~~~~~~~e~~~~~~~~~~l~~~-~~~~~~~~~~~d~~~~  481 (496)
T KOG1192|consen  429 AKRLSEILRDQPISP-ELAVKWVEFVARHGGAKHLKEA-AHLSFIEYGSLDVIAF  481 (496)
T ss_pred             HHHHHHHHHcCCCCH-HHHHHHHHHHHhcCCCcccCcc-ccCChhhhhhhHHHHH
Confidence            478999999999999 9999999999999999999999 9999999999999976


No 4  
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=85.53  E-value=1.4  Score=36.90  Aligned_cols=43  Identities=14%  Similarity=0.099  Sum_probs=18.2

Q ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhh
Q psy388           43 SYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNVIRLES   85 (94)
Q Consensus        43 ~~~qy~~lDv~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   85 (94)
                      .+..|+--=++...+.++++++.-+.-++.|+||||-+...+.
T Consensus        85 ~~l~~~~g~~v~~~i~ll~~il~P~vg~~fCcCRCc~~CGg~~  127 (806)
T PF05478_consen   85 ELLAYEWGFLVCAVIGLLFIILMPLVGLCFCCCRCCGNCGGRM  127 (806)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccCCCcCCcc
Confidence            4455554444333333333333333334444556554433443


No 5  
>PF07856 Orai-1:  Mediator of CRAC channel activity;  InterPro: IPR012446 This entry includes Drosophila Orai and human Orai1, Orai2 and Orai3. ORAI-1 GFP reporters are co-expressed with STIM-1 (ER CA(2+) sensors) in the gonad and intestine. The protein has four predicted transmembrane domains with a highly conserved region between TM2 ad TM3. This conserved domain is thought to function in channel regulation. ORAI1-related proteins are required for the production of the calcium channel, CRAC, along with STIM1-related proteins [].
Probab=79.25  E-value=2.6  Score=29.25  Aligned_cols=76  Identities=21%  Similarity=0.305  Sum_probs=46.9

Q ss_pred             hhcCCCCHHHHHHHHHHHHHhc--C-CCccccccccCccHHHHHHH--HHHHHHHHHHHHHHHHHHH-HHHHHHHHhhhh
Q psy388            8 SKDTPMSPIEKSIWWIEYVLRH--K-GVAHLHSAAADLSYVQYYLL--DVIAFIITILLVLLLALYL-ATVRVLRKLNVI   81 (94)
Q Consensus         8 ~~drP~~P~d~av~wiE~vir~--~-g~~~l~~~~~~l~~~qy~~l--Dv~~~l~~~~~~~~~~~~~-~~~~~~~~~~~~   81 (94)
                      ++..|.+|.++.-.|+|-.=++  . |..-+-.+-.-++|++++..  ..-+....++++...+++. .....+|.....
T Consensus        91 ~~~~~~sP~~~f~~~cE~~W~~s~~lGi~lFL~~l~l~~WIKF~~~~~~~aa~~~t~i~~~~~li~~~~~~~~wr~l~~~  170 (175)
T PF07856_consen   91 YSPVPPSPHRRFHRYCELAWRFSTVLGIPLFLAELALLGWIKFWDSPSPAAAIAITAILVPVLLIFVVFIQHFWRSLVSH  170 (175)
T ss_pred             cCCCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHheeehhccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            3457889999999999832222  1 55544555567889999988  6665555555544444444 344556666554


Q ss_pred             hh
Q psy388           82 RL   83 (94)
Q Consensus        82 ~~   83 (94)
                      +.
T Consensus       171 ~~  172 (175)
T PF07856_consen  171 KY  172 (175)
T ss_pred             cc
Confidence            33


No 6  
>PF07069 PRRSV_2b:  Porcine reproductive and respiratory syndrome virus 2b ;  InterPro: IPR009775 This family consists of several Porcine reproductive and respiratory syndrome virus (PRRSV) ORF2b proteins. The function of this family is unknown however it is known that large amounts of 2b protein are present in the virion and it is thought that this protein may be an integral component of the virion [].
Probab=73.79  E-value=16  Score=21.47  Aligned_cols=34  Identities=15%  Similarity=0.211  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHH--HHHHHHHHHHHHHHHHhhhhh
Q psy388           49 LLDVIAFIITILL--VLLLALYLATVRVLRKLNVIR   82 (94)
Q Consensus        49 ~lDv~~~l~~~~~--~~~~~~~~~~~~~~~~~~~~~   82 (94)
                      .+|++.++...+-  +..++...++|.+|.-+.+.+
T Consensus        26 ivdiiiflailfgftiagwlvvfcirlv~sailr~r   61 (73)
T PF07069_consen   26 IVDIIIFLAILFGFTIAGWLVVFCIRLVCSAILRAR   61 (73)
T ss_pred             HHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHhcc
Confidence            4577655543322  223444455555555544443


No 7  
>PF15013 CCSMST1:  CCSMST1 family
Probab=69.39  E-value=3.8  Score=24.88  Aligned_cols=19  Identities=11%  Similarity=0.218  Sum_probs=13.0

Q ss_pred             ccccccCccHHHHHHHHHH
Q psy388           35 LHSAAADLSYVQYYLLDVI   53 (94)
Q Consensus        35 l~~~~~~l~~~qy~~lDv~   53 (94)
                      +.+...++||+|.+.+-+-
T Consensus        21 ~~~~~~~~PWyq~~~is~s   39 (77)
T PF15013_consen   21 RGGKQQRMPWYQVYPISLS   39 (77)
T ss_pred             cCCCCCCCcceeeehhHHH
Confidence            5555566899998765444


No 8  
>PF07219 HemY_N:  HemY protein N-terminus;  InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins. These are membrane protein involved in a late step of protoheme IX synthesis [].
Probab=65.86  E-value=26  Score=21.85  Aligned_cols=24  Identities=25%  Similarity=0.386  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy388           53 IAFIITILLVLLLALYLATVRVLR   76 (94)
Q Consensus        53 ~~~l~~~~~~~~~~~~~~~~~~~~   76 (94)
                      .++++++.++++++++.+++.+++
T Consensus        19 ~~~~l~~~~~~l~ll~~ll~~~~~   42 (108)
T PF07219_consen   19 ALILLLLLFVVLYLLLRLLRRLLS   42 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHh
Confidence            444444555555666666666654


No 9  
>PF15050 SCIMP:  SCIMP protein
Probab=64.63  E-value=20  Score=23.71  Aligned_cols=10  Identities=20%  Similarity=-0.227  Sum_probs=4.6

Q ss_pred             HHHHHHHHhh
Q psy388           70 ATVRVLRKLN   79 (94)
Q Consensus        70 ~~~~~~~~~~   79 (94)
                      ++.|+||+..
T Consensus        26 IlyCvcR~~l   35 (133)
T PF15050_consen   26 ILYCVCRWQL   35 (133)
T ss_pred             HHHHHHHHHH
Confidence            3444555443


No 10 
>PF11628 TCR_zetazeta:  T-cell surface glycoprotein CD3 zeta chain;  InterPro: IPR021663 The TCR complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer co-expressed at the cell surface with the invariant subunits of CD3 labelled gamma, delta, epsilon, zeta, and eta []. The zeta subunit forms either homodimers or heterodimers with eta [], but eta homodimers have not been observed. The structure of the zetazeta transmembrane dimer consists of a left-handed coiled coil with polar contacts. Two aspartic acids are critical for zetazeta dimerisation and assembly with TCR [].  The high affinity immunoglobulin epsilon receptor (IgE Fc receptor) subunit gamma associates with a variety of FcR alpha chains to form a functional signaling complex. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface and regulates several aspects of the immune response []. This family includes both CD3 zeta subunits and IgE Fc receptor gamma subunits. The gamma chain of the high affinity Fc receptor for IgE has significant structural homology to CD3 zeta and the related CD3 eta subunit and can facilitate T cell receptor expression and signaling in the absence of CD3 zeta and CD3 eta [].; PDB: 2HAC_B.
Probab=62.70  E-value=18  Score=18.45  Aligned_cols=19  Identities=42%  Similarity=0.700  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q psy388           47 YYLLDVIAFIITILLVLLL   65 (94)
Q Consensus        47 y~~lDv~~~l~~~~~~~~~   65 (94)
                      .|.||.++++-.++++.++
T Consensus         5 CYiLDgiL~iYgiiiT~L~   23 (33)
T PF11628_consen    5 CYILDGILFIYGIIITALY   23 (33)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             eeeHHHHHHHHHHHHHHHH
Confidence            4788988777666555443


No 11 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=59.91  E-value=24  Score=23.14  Aligned_cols=21  Identities=10%  Similarity=0.216  Sum_probs=8.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q psy388           54 AFIITILLVLLLALYLATVRV   74 (94)
Q Consensus        54 ~~l~~~~~~~~~~~~~~~~~~   74 (94)
                      ++++.+.+.++.+++.+..++
T Consensus        68 ~Ii~gv~aGvIg~Illi~y~i   88 (122)
T PF01102_consen   68 GIIFGVMAGVIGIILLISYCI   88 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             ehhHHHHHHHHHHHHHHHHHH
Confidence            333333333344443333333


No 12 
>PF02038 ATP1G1_PLM_MAT8:  ATP1G1/PLM/MAT8 family;  InterPro: IPR000272  The FXYD protein family contains at least seven members in mammals []. Two other family members that are not obvious orthologs of any identified mammalian FXYD protein exist in zebrafish. All these proteins share a signature sequence of six conserved amino acids comprising the FXYD motif in the NH2-terminus, and two glycines and one serine residue in the transmembrane domain. FXYD proteins are widely distributed in mammalian tissues with prominent expression in tissues that perform fluid and solute transport or that are electrically excitable.   Initial functional characterisation suggested that FXYD proteins act as channels or as modulators of ion channels however studies have revealed that most FXYD proteins have another specific function and act as tissue-specific regulatory subunits of the Na,K-ATPase. Each of these auxiliary subunits produces a distinct functional effect on the transport characteristics of the Na,K-ATPase that is adjusted to the specific functional demands of the tissue in which the FXYD protein is expressed. FXYD proteins appear to preferentially associate with Na,K-ATPase alpha1-beta isozymes, and affect their function in a way that render them operationally complementary or supplementary to coexisting isozymes.; GO: 0005216 ion channel activity, 0006811 ion transport, 0016020 membrane; PDB: 2JO1_A 2JP3_A 2ZXE_G 3A3Y_G 3N23_E 3B8E_H 3KDP_G 3N2F_E.
Probab=55.88  E-value=25  Score=19.64  Aligned_cols=25  Identities=28%  Similarity=0.376  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q psy388           44 YVQYYLLDVIAFIITILLVLLLALY   68 (94)
Q Consensus        44 ~~qy~~lDv~~~l~~~~~~~~~~~~   68 (94)
                      +|.|..|-+-+++++.+++++.++.
T Consensus         8 ~YDy~tLrigGLi~A~vlfi~Gi~i   32 (50)
T PF02038_consen    8 YYDYETLRIGGLIFAGVLFILGILI   32 (50)
T ss_dssp             GGCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccchhHhhccchHHHHHHHHHHHHH
Confidence            4778899888877776666555443


No 13 
>PF15050 SCIMP:  SCIMP protein
Probab=54.73  E-value=35  Score=22.59  Aligned_cols=37  Identities=27%  Similarity=0.286  Sum_probs=15.5

Q ss_pred             ccHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHh
Q psy388           42 LSYVQYYLLDVIAFIITI-LLVLLLALYLATVRVLRKL   78 (94)
Q Consensus        42 l~~~qy~~lDv~~~l~~~-~~~~~~~~~~~~~~~~~~~   78 (94)
                      |+|+.-+.+=++++-+++ .+++..+++.++|..+|.=
T Consensus         1 M~WWr~nFWiiLAVaII~vS~~lglIlyCvcR~~lRqG   38 (133)
T PF15050_consen    1 MSWWRDNFWIILAVAIILVSVVLGLILYCVCRWQLRQG   38 (133)
T ss_pred             CchHHhchHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
Confidence            455554444444332222 2222333444455555543


No 14 
>PRK14471 F0F1 ATP synthase subunit B; Provisional
Probab=53.38  E-value=38  Score=22.54  Aligned_cols=25  Identities=24%  Similarity=0.157  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHhhhhhhhhhhhhhh
Q psy388           67 LYLATVRVLRKLNVIRLESEKDIKK   91 (94)
Q Consensus        67 ~~~~~~~~~~~~~~~~~~~~~~~~~   91 (94)
                      .+.+-+++++.+.+..-+++..+.+
T Consensus        22 ~~ll~~~l~~pi~~~l~~R~~~I~~   46 (164)
T PRK14471         22 LLLLAKFAWKPILGAVKEREDSIKN   46 (164)
T ss_pred             HHHHHHHhHHHHHHHHHHHHHHHHH
Confidence            3444566677776666666655544


No 15 
>PRK07353 F0F1 ATP synthase subunit B'; Validated
Probab=48.73  E-value=43  Score=21.50  Aligned_cols=27  Identities=15%  Similarity=0.237  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHhhhhhhhhhhhhhh
Q psy388           65 LALYLATVRVLRKLNVIRLESEKDIKK   91 (94)
Q Consensus        65 ~~~~~~~~~~~~~~~~~~~~~~~~~~~   91 (94)
                      .+.+.+-+++++.+.+..-.++.++..
T Consensus        17 il~~ll~~~l~~pi~~~l~~R~~~I~~   43 (140)
T PRK07353         17 LLTFILNALFYKPVGKVVEEREDYIRT   43 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344445556666666665555555443


No 16 
>PRK14475 F0F1 ATP synthase subunit B; Provisional
Probab=47.33  E-value=35  Score=22.92  Aligned_cols=19  Identities=11%  Similarity=-0.081  Sum_probs=9.2

Q ss_pred             HHHHHHhhhhhhhhhhhhh
Q psy388           72 VRVLRKLNVIRLESEKDIK   90 (94)
Q Consensus        72 ~~~~~~~~~~~~~~~~~~~   90 (94)
                      +++++.+.+..-.++..+.
T Consensus        29 k~l~~pi~~~le~R~~~I~   47 (167)
T PRK14475         29 KVLPKALAGALDAYAAKIQ   47 (167)
T ss_pred             HHhHHHHHHHHHHHHHHHH
Confidence            4455555555444444443


No 17 
>KOG4331|consensus
Probab=47.09  E-value=29  Score=29.80  Aligned_cols=43  Identities=14%  Similarity=-0.004  Sum_probs=20.4

Q ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhh
Q psy388           42 LSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNVIRLE   84 (94)
Q Consensus        42 l~~~qy~~lDv~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~   84 (94)
                      .-|..|+-.=+...++++.++++.....++.++++||+++..+
T Consensus        97 ~~lv~~~~g~lv~sV~~v~~iil~p~~~~~yccc~C~~rc~~r  139 (865)
T KOG4331|consen   97 ILLVIYEAGMLVCSVILVLYIILKPSEGLCYCCCRCCRRCGGR  139 (865)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhheeeeHhhhcCC
Confidence            3455554444444444444444444445555555555554333


No 18 
>PRK04125 murein hydrolase regulator LrgA; Provisional
Probab=46.74  E-value=87  Score=21.00  Aligned_cols=13  Identities=23%  Similarity=0.069  Sum_probs=5.3

Q ss_pred             HHHHHHHHHHHHH
Q psy388           64 LLALYLATVRVLR   76 (94)
Q Consensus        64 ~~~~~~~~~~~~~   76 (94)
                      +.++-.+..++.|
T Consensus       106 l~vtg~v~~~l~r  118 (141)
T PRK04125        106 LACTGLFSQFILG  118 (141)
T ss_pred             HHHHHHHHHHHHH
Confidence            3333344444444


No 19 
>PRK05759 F0F1 ATP synthase subunit B; Validated
Probab=46.54  E-value=60  Score=21.19  Aligned_cols=22  Identities=18%  Similarity=0.016  Sum_probs=12.0

Q ss_pred             HHHHHHHHhhhhhhhhhhhhhh
Q psy388           70 ATVRVLRKLNVIRLESEKDIKK   91 (94)
Q Consensus        70 ~~~~~~~~~~~~~~~~~~~~~~   91 (94)
                      +-+++++.+.+..-+++..+.+
T Consensus        21 l~~~~~~pi~~~l~~R~~~I~~   42 (156)
T PRK05759         21 IMKFVWPPIMKALEERQKKIAD   42 (156)
T ss_pred             HHHHhHHHHHHHHHHHHHHHHH
Confidence            4455566666655555555544


No 20 
>PF02060 ISK_Channel:  Slow voltage-gated potassium channel;  InterPro: IPR000369 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. Two types of beta subunit (KCNE and KCNAB) are presently known to associate with voltage-gated alpha subunits (Kv, KCNQ and eag-like). However, not all combinations of alpha and beta subunits are possible. The KCNE family of K+ channel subunits are membrane glycoproteins that possess a single transmembrane (TM) domain. They share no structural relationship with the alpha subunit proteins, which possess pore forming domains. The subunits appear to have a regulatory function, modulating the kinetics and voltage dependence of the alpha subunits of voltage-dependent K+ channels. KCNE subunits are formed from short polypeptides of ~130 amino acids, and are divided into five subfamilies: KCNE1 (MinK/IsK), KCNE2 (MiRP1), KCNE3 (MiRP2), KCNE4 (MiRP3) and KCNE1L (AMMECR2). ; GO: 0005249 voltage-gated potassium channel activity, 0006811 ion transport, 0016020 membrane; PDB: 2K21_A.
Probab=44.62  E-value=93  Score=20.70  Aligned_cols=18  Identities=28%  Similarity=0.333  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHhcCCCccc
Q psy388           18 KSIWWIEYVLRHKGVAHL   35 (94)
Q Consensus        18 ~av~wiE~vir~~g~~~l   35 (94)
                      ..-.|-|++-+.+.+.-+
T Consensus        13 L~~l~q~~~~~~~nsS~l   30 (129)
T PF02060_consen   13 LSKLWQETVQQSSNSSPL   30 (129)
T ss_dssp             HHHHHHHHHHT--TTSSG
T ss_pred             HHHHHHHHhcCCCCCCcc
Confidence            456788999888766555


No 21 
>PRK09174 F0F1 ATP synthase subunit B'; Validated
Probab=44.19  E-value=58  Score=22.92  Aligned_cols=22  Identities=14%  Similarity=0.151  Sum_probs=11.6

Q ss_pred             HHHHHHHHhhhhhhhhhhhhhh
Q psy388           70 ATVRVLRKLNVIRLESEKDIKK   91 (94)
Q Consensus        70 ~~~~~~~~~~~~~~~~~~~~~~   91 (94)
                      +.++++..+.+..-+++.++.+
T Consensus        70 L~k~~~~pI~~vLe~R~~~I~~   91 (204)
T PRK09174         70 MSRVILPRIGGIIETRRDRIAQ   91 (204)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3455566665555555555443


No 22 
>PRK13453 F0F1 ATP synthase subunit B; Provisional
Probab=42.70  E-value=92  Score=21.03  Aligned_cols=23  Identities=22%  Similarity=0.213  Sum_probs=12.0

Q ss_pred             HHHHHHHHHhhhhhhhhhhhhhh
Q psy388           69 LATVRVLRKLNVIRLESEKDIKK   91 (94)
Q Consensus        69 ~~~~~~~~~~~~~~~~~~~~~~~   91 (94)
                      .+.+++++.+.+..-+++..+.+
T Consensus        34 lL~~~l~~pi~~~l~~R~~~I~~   56 (173)
T PRK13453         34 LLKKFAWGPLKDVMDKRERDINR   56 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            33445556665555555555443


No 23 
>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism]
Probab=42.13  E-value=49  Score=23.97  Aligned_cols=34  Identities=29%  Similarity=0.445  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy388           45 VQYYLLDVIAFIITILLVLLLALYLATVRVLRKL   78 (94)
Q Consensus        45 ~qy~~lDv~~~l~~~~~~~~~~~~~~~~~~~~~~   78 (94)
                      ||+|.-||.....+++++++.++=.+-.++.|+.
T Consensus       186 Y~Rf~~~Vm~~~viillilVq~iQ~~Gd~l~~r~  219 (222)
T COG2011         186 YQRFNTDVMVVAVVILLILVQLIQSLGDRLVRRL  219 (222)
T ss_pred             HHhcCCchhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            6899999987766665555555444444554444


No 24 
>PF06643 DUF1158:  Protein of unknown function (DUF1158);  InterPro: IPR010590 This family consists of several enterobacterial YbdJ proteins. The function of this family is unknown
Probab=42.09  E-value=78  Score=19.14  Aligned_cols=16  Identities=13%  Similarity=0.092  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHhhh
Q psy388           65 LALYLATVRVLRKLNV   80 (94)
Q Consensus        65 ~~~~~~~~~~~~~~~~   80 (94)
                      .+=+.++|+++|+..+
T Consensus        64 aiEy~viRfiwrRwfs   79 (82)
T PF06643_consen   64 AIEYFVIRFIWRRWFS   79 (82)
T ss_pred             HHHHHHHHHHHHHHhh
Confidence            3447888999988754


No 25 
>PRK13460 F0F1 ATP synthase subunit B; Provisional
Probab=41.77  E-value=55  Score=22.09  Aligned_cols=21  Identities=5%  Similarity=-0.145  Sum_probs=10.4

Q ss_pred             HHHHHHHHhhhhhhhhhhhhh
Q psy388           70 ATVRVLRKLNVIRLESEKDIK   90 (94)
Q Consensus        70 ~~~~~~~~~~~~~~~~~~~~~   90 (94)
                      +.+++++.+.+..-+++..+.
T Consensus        33 L~~~~~kpi~~~l~~R~~~I~   53 (173)
T PRK13460         33 LKKFAWDVILKALDERASGVQ   53 (173)
T ss_pred             HHHHhHHHHHHHHHHHHHHHH
Confidence            334555555555455544444


No 26 
>PF10661 EssA:  WXG100 protein secretion system (Wss), protein EssA;  InterPro: IPR018920  The Wss (WXG100 protein secretion system) in Staphylococcus aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system) []. This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria [].   Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This highly divergent protein family consists largely of a central region of highly polar low-complexity sequence containing occasional LF motifs in weak repeats about 17 residues in length, flanked by hydrophobic N- and C-terminal regions. 
Probab=41.72  E-value=54  Score=22.00  Aligned_cols=16  Identities=25%  Similarity=0.420  Sum_probs=7.2

Q ss_pred             HHHHHHHHHHHHHHHH
Q psy388           60 LLVLLLALYLATVRVL   75 (94)
Q Consensus        60 ~~~~~~~~~~~~~~~~   75 (94)
                      +++++..++.++|.+|
T Consensus       129 ll~i~~giy~~~r~~~  144 (145)
T PF10661_consen  129 LLAICGGIYVVLRKVW  144 (145)
T ss_pred             HHHHHHHHHHHHHHhh
Confidence            3344444455555443


No 27 
>PF10577 UPF0560:  Uncharacterised protein family UPF0560;  InterPro: IPR018890  This family of proteins has no known function. 
Probab=41.26  E-value=41  Score=28.74  Aligned_cols=17  Identities=18%  Similarity=0.262  Sum_probs=7.3

Q ss_pred             CccHHHHHHHHHHHHHHHH
Q psy388           41 DLSYVQYYLLDVIAFIITI   59 (94)
Q Consensus        41 ~l~~~qy~~lDv~~~l~~~   59 (94)
                      ++..  |+-+-..++|...
T Consensus       266 Di~~--YHT~fLl~ILG~~  282 (807)
T PF10577_consen  266 DITT--YHTVFLLAILGGT  282 (807)
T ss_pred             Cchh--HHHHHHHHHHHHH
Confidence            4444  4444444444433


No 28 
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion]
Probab=40.95  E-value=80  Score=21.19  Aligned_cols=27  Identities=19%  Similarity=0.133  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHhhhhhhhhhhhhhhh
Q psy388           66 ALYLATVRVLRKLNVIRLESEKDIKKK   92 (94)
Q Consensus        66 ~~~~~~~~~~~~~~~~~~~~~~~~~~~   92 (94)
                      +.+.+.++++..+.+..-.++.++...
T Consensus        19 ll~ll~~~~~~pi~~~l~~R~~~I~~~   45 (161)
T COG0711          19 LLWLLKKFVWKPILKALDERQAKIADD   45 (161)
T ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHH
Confidence            344455666777777767776666654


No 29 
>PF15086 UPF0542:  Uncharacterised protein family UPF0542
Probab=40.94  E-value=81  Score=18.97  Aligned_cols=15  Identities=13%  Similarity=0.215  Sum_probs=8.5

Q ss_pred             HHHHHHHHHHHhcCC
Q psy388           17 EKSIWWIEYVLRHKG   31 (94)
Q Consensus        17 d~av~wiE~vir~~g   31 (94)
                      +-+.+-+|||++.|+
T Consensus         6 ~w~~~~v~~vAkdP~   20 (74)
T PF15086_consen    6 AWASYIVEWVAKDPY   20 (74)
T ss_pred             HHHHHHHHHHHcChH
Confidence            344555667766644


No 30 
>PRK13454 F0F1 ATP synthase subunit B'; Provisional
Probab=40.61  E-value=90  Score=21.34  Aligned_cols=22  Identities=18%  Similarity=0.231  Sum_probs=12.9

Q ss_pred             HHHHHHHHhhhhhhhhhhhhhh
Q psy388           70 ATVRVLRKLNVIRLESEKDIKK   91 (94)
Q Consensus        70 ~~~~~~~~~~~~~~~~~~~~~~   91 (94)
                      +.+++++.+.+..-+++..+.+
T Consensus        48 l~k~l~~PI~~~l~~R~~~I~~   69 (181)
T PRK13454         48 LTRVALPRIGAVLAERQGTITN   69 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            3455666666666666655544


No 31 
>PTZ00046 rifin; Provisional
Probab=40.23  E-value=79  Score=24.52  Aligned_cols=8  Identities=50%  Similarity=0.700  Sum_probs=3.1

Q ss_pred             hhhhhhhh
Q psy388           85 SEKDIKKK   92 (94)
Q Consensus        85 ~~~~~~~~   92 (94)
                      ++||-|||
T Consensus       342 RKKKMkKK  349 (358)
T PTZ00046        342 RKKKMKKK  349 (358)
T ss_pred             hcchhHHH
Confidence            33344443


No 32 
>PF05186 Dpy-30:  Dpy-30 motif;  InterPro: IPR007858 This motif is about 40 residues long and is probably formed of two alpha-helices. It is found in the Dpy-30 proteins, hence the motifs name. Dpy-30 from Caenorhabditis elegans is an essential component of dosage compensation machinery and loss of dpy-30 activity results in XX-specific lethality; in XO animals, Dpy-30 is required for developmental processes other than dosage compensation []. In yeast, the homologue of DPY-30, Saf19p, functions as part of the Set1 complex that is necessary for the methylation of histone H3 at lysine residue 4; Set1 is a key part of epigenetic developmental control []. There is also a human homologue of Dpy-30 []. This Dpy-30 region may be a dimerisation motif analogous that found in the cAMP-dependent protein kinase regulator, type II PKA, R subunit IPR003117 from INTERPRO.; PDB: 3G36_D.
Probab=39.61  E-value=36  Score=17.98  Aligned_cols=20  Identities=30%  Similarity=0.335  Sum_probs=13.1

Q ss_pred             hhhHHhhcCCCCHHHHHHHH
Q psy388            3 YYSLLSKDTPMSPIEKSIWW   22 (94)
Q Consensus         3 ~ls~~~~drP~~P~d~av~w   22 (94)
                      -+..+.+.||.+|.+-...|
T Consensus        17 gL~~l~~~rP~DPi~~La~~   36 (42)
T PF05186_consen   17 GLAELAKERPEDPIEFLAEY   36 (42)
T ss_dssp             HHHHHHHH--SSHHHHHHHH
T ss_pred             HHHHHHHHCCCChHHHHHHH
Confidence            46778899999999854444


No 33 
>PRK11024 colicin uptake protein TolR; Provisional
Probab=39.32  E-value=27  Score=22.85  Aligned_cols=14  Identities=36%  Similarity=0.738  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHHH
Q psy388           49 LLDVIAFIITILLV   62 (94)
Q Consensus        49 ~lDv~~~l~~~~~~   62 (94)
                      ++||++++++++++
T Consensus        20 lIDVvfvLLiFFmv   33 (141)
T PRK11024         20 LLDVLLVLLLIFMA   33 (141)
T ss_pred             HHHHHHHHHHHHHh
Confidence            78999777766544


No 34 
>PRK14473 F0F1 ATP synthase subunit B; Provisional
Probab=39.26  E-value=1.1e+02  Score=20.21  Aligned_cols=27  Identities=15%  Similarity=0.229  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHhhhhhhhhhhhhhhh
Q psy388           66 ALYLATVRVLRKLNVIRLESEKDIKKK   92 (94)
Q Consensus        66 ~~~~~~~~~~~~~~~~~~~~~~~~~~~   92 (94)
                      +.+.+-+++++.+.+..-.++..+.+.
T Consensus        21 l~~lL~~fl~kpi~~~l~~R~~~I~~~   47 (164)
T PRK14473         21 LIFLLRTFLYRPVLNLLNERTRRIEES   47 (164)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            334445566666666666666555543


No 35 
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=38.91  E-value=84  Score=24.34  Aligned_cols=7  Identities=57%  Similarity=0.809  Sum_probs=2.7

Q ss_pred             hhhhhhh
Q psy388           86 EKDIKKK   92 (94)
Q Consensus        86 ~~~~~~~   92 (94)
                      +||-|||
T Consensus       338 KKKMkKK  344 (353)
T TIGR01477       338 KKKMKKK  344 (353)
T ss_pred             cchhHHH
Confidence            3333443


No 36 
>PF00558 Vpu:  Vpu protein;  InterPro: IPR008187 The Human immunodeficiency virus 1 (HIV-1) Vpu protein acts in the degradation of CD4 in the endoplasmic reticulum and in the enhancement of virion release from the plasma membrane of infected cells [].; GO: 0019076 release of virus from host; PDB: 2JPX_A 1PI8_A 2GOH_A 2GOF_A 1PI7_A 1PJE_A 1VPU_A 2K7Y_A.
Probab=37.96  E-value=59  Score=19.90  Aligned_cols=19  Identities=21%  Similarity=0.485  Sum_probs=6.8

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q psy388           49 LLDVIAFIITILLVLLLAL   67 (94)
Q Consensus        49 ~lDv~~~l~~~~~~~~~~~   67 (94)
                      .+|+++++.+++.+++.++
T Consensus         3 ~l~i~~iialiv~~iiaIv   21 (81)
T PF00558_consen    3 SLEILAIIALIVALIIAIV   21 (81)
T ss_dssp             -----HHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            4566665555544444333


No 37 
>PF00430 ATP-synt_B:  ATP synthase B/B' CF(0);  InterPro: IPR002146 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunits B and B' from the F0 complex in F-ATPases found in chloroplasts and in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial and chloroplast F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B in bacteria, or one copy each of subunits B and B' in chloroplasts and photosynthetic bacteria []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o); PDB: 1L2P_A 2KHK_A 1B9U_A.
Probab=36.91  E-value=72  Score=19.91  Aligned_cols=22  Identities=14%  Similarity=0.141  Sum_probs=9.4

Q ss_pred             HHHHHHHHHhhhhhhhhhhhhh
Q psy388           69 LATVRVLRKLNVIRLESEKDIK   90 (94)
Q Consensus        69 ~~~~~~~~~~~~~~~~~~~~~~   90 (94)
                      .+.+++++.+.+..-.++.++.
T Consensus        15 ~l~~~~~~pi~~~l~~R~~~I~   36 (132)
T PF00430_consen   15 LLNKFLYKPIKKFLDERKAKIQ   36 (132)
T ss_dssp             HHHHHTHHHHHHHCS--S-HHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3344455555555444444443


No 38 
>PRK06569 F0F1 ATP synthase subunit B'; Validated
Probab=35.98  E-value=1.3e+02  Score=20.50  Aligned_cols=22  Identities=14%  Similarity=0.081  Sum_probs=11.6

Q ss_pred             HHHHHHHHHhhhhhhhhhhhhh
Q psy388           69 LATVRVLRKLNVIRLESEKDIK   90 (94)
Q Consensus        69 ~~~~~~~~~~~~~~~~~~~~~~   90 (94)
                      .+.++++..+.+..-+++..+.
T Consensus        26 ll~kf~~ppI~~iLe~R~~~I~   47 (155)
T PRK06569         26 FVYKFITPKAEEIFNNRQTNIQ   47 (155)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHH
Confidence            3345556666665555554443


No 39 
>TIGR02804 ExbD_2 TonB system transport protein ExbD, group 2. Members of this family are Gram-negative bacterial inner membrane proteins, generally designated ExbD, related to the TolR family modeled by TIGRFAMs TIGR02801. Members always are encoded next to a protein designated ExbB (TIGR02797), related to the TolQ family modeled by TIGRFAMs TIGR02796. ExbD and ExbB together form a proton channel through which they can harness the proton-motive force to energize TonB, which in turn energizes TonB-dependent receptors in the outer membrane. TonB-dependent receptors with known specificity tend to import siderophores or vitamin B12. A TonB system and Tol-Pal system often will co-exist in a single bacterial genome.
Probab=35.23  E-value=54  Score=20.77  Aligned_cols=14  Identities=21%  Similarity=0.788  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHHH
Q psy388           49 LLDVIAFIITILLV   62 (94)
Q Consensus        49 ~lDv~~~l~~~~~~   62 (94)
                      ++||++++++++++
T Consensus         9 lIDVvflLLiFFmv   22 (121)
T TIGR02804         9 FIDIMLVLLAIVLI   22 (121)
T ss_pred             HHHHHHHHHHHHHH
Confidence            68998776655443


No 40 
>TIGR02801 tolR TolR protein. The model describes the inner membrane protein TolR, part of the TolR/TolQ complex that transduces energy from the proton-motive force, through TolA, to an outer membrane complex made up of TolB and Pal (peptidoglycan-associated lipoprotein). The complex is required to maintain outer membrane integrity, and defects may cause a defect in the import of some organic compounds in addition to the resulting morphologic. While several gene pairs homologous to talR and tolQ may be found in a single genome, but the scope of this model is set to favor finding only bone fide TolR, supported by operon structure as well as by score.
Probab=34.98  E-value=39  Score=21.48  Aligned_cols=14  Identities=29%  Similarity=0.679  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHH
Q psy388           49 LLDVIAFIITILLV   62 (94)
Q Consensus        49 ~lDv~~~l~~~~~~   62 (94)
                      ++||++++++++++
T Consensus        10 lIDVvFlLLiFFmv   23 (129)
T TIGR02801        10 YVDVMLVLLIIFMV   23 (129)
T ss_pred             HHHHHHHHHHHHHh
Confidence            68998776655543


No 41 
>cd07912 Tweety_N N-terminal domain of the protein encoded by the Drosophila tweety gene and related proteins, a family of chloride ion channels. The protein product of the Drosophila tweety (tty) gene is thought to form a trans-membrane protein with five membrane-spanning regions and a cytoplasmic C-terminus. This N-terminal domain contains the putative transmembrane spanning regions. Tweety has been suggested as a candidate for a large conductance chloride channel, both in vertebrate and insect cells. Three human homologs have been identified and designated TTYH1-3. TTYH2 has been associated with the progression of cancer, and Drosophila melanogaster tweety has been assumed to play a role in development. TTYH2, and TTYH3 bind to and are ubiquinated by Nedd4-2, a HECT type E3 ubiquitin ligase, which most likely plays a role in controlling the cellular levels of tweety family proteins.
Probab=34.62  E-value=1.9e+02  Score=22.81  Aligned_cols=14  Identities=7%  Similarity=0.332  Sum_probs=9.2

Q ss_pred             HHHHHHHHHhcCCC
Q psy388           19 SIWWIEYVLRHKGV   32 (94)
Q Consensus        19 av~wiE~vir~~g~   32 (94)
                      +=||+++.-+.|-.
T Consensus         4 ~~~~~~~~h~lPh~   17 (418)
T cd07912           4 APWLVKLLHSLPHL   17 (418)
T ss_pred             chHHHHHHHhCCCC
Confidence            34788877666643


No 42 
>PF00201 UDPGT:  UDP-glucoronosyl and UDP-glucosyl transferase;  InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule. This family currently consist of:  Mammalian UDP-glucuronosyl transferases (2.4.1.17 from EC) (UDPGT) []. A large family of membrane-bound microsomal enzymes which catalyze the transfer of glucuronic acid to a wide variety of exogenous and endogenous lipophilic substrates. These enzymes are of major importance in the detoxification and subsequent elimination of xenobiotics such as drugs and carcinogens. A large number of putative UDPGT from Caenorhabditis elegans. Mammalian 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [] (2.4.1.45 from EC) (also known as UDP-galactose-ceramide galactosyltransferase). This enzyme catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Plants flavonol O(3)-glucosyltransferase (2.4.1.91 from EC). An enzyme [] that catalyzes the transfer of glucose from UDP-glucose to a flavanol. This reaction is essential and one of the last steps in anthocyanin pigment biosynthesis. Baculoviruses ecdysteroid UDP-glucosyltransferase (2.4.1 from EC) [] (egt). This enzyme catalyzes the transfer of glucose from UDP-glucose to ectysteroids which are insect molting hormones. The expression of egt in the insect host interferes with the normal insect development by blocking the molting process. Prokaryotic zeaxanthin glucosyltransferase (2.4.1 from EC) (gene crtX), an enzyme involved in carotenoid biosynthesis and that catalyses the glycosylation reaction which converts zeaxanthin to zeaxanthin-beta-diglucoside. Streptomyces macrolide glycosyltransferases (2.4.1 from EC) []. These enzymes specifically inactivates macrolide anitibiotics via 2'-O-glycosylation using UDP-glucose.  These enzymes share a conserved domain of about 50 amino acid residues located in their C-terminal section.; GO: 0016758 transferase activity, transferring hexosyl groups, 0008152 metabolic process; PDB: 3HBJ_A 3HBF_A 2PQ6_A 3IA7_B 3RSC_A 3IAA_B 2IYA_A 2IYF_B 2O6L_A 2VCH_A ....
Probab=33.86  E-value=14  Score=28.55  Aligned_cols=23  Identities=13%  Similarity=0.154  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHhhhhhhhhhh
Q psy388           65 LALYLATVRVLRKLNVIRLESEK   87 (94)
Q Consensus        65 ~~~~~~~~~~~~~~~~~~~~~~~   87 (94)
                      .++..++..+++++++...+++|
T Consensus       476 ~~~~~~~~~~~~~~~~~~~~~~~  498 (500)
T PF00201_consen  476 LLIIYIIFKICRFVCRKCVKKKK  498 (500)
T ss_dssp             -----------------------
T ss_pred             HHHHHHHHHHHHHHHHHHhcccC
Confidence            33344444556666555444443


No 43 
>PF11057 Cortexin:  Cortexin of kidney;  InterPro: IPR020066 Cortexin is a neuron-specific, 82-residue membrane protein which is found especially in vertebrate brain cortex tissue. It may mediate extracellular or intracellular signalling of cortical neurons during forebrain development. Cortexin is present at significant levels in the foetal brain, suggesting that it may be important to neurons of both the developing and adult cerebral cortex. Cortexin has a conserved single membrane-spanning region in the middle of each sequence []. In humans, there is selective expression of Cortexin 3 (CTXN3) in the kidney as well as the brain []. This entry contains Cortexins 1, 2 and 3.; GO: 0031224 intrinsic to membrane
Probab=33.77  E-value=75  Score=19.33  Aligned_cols=14  Identities=21%  Similarity=0.043  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHHHH
Q psy388           62 VLLLALYLATVRVL   75 (94)
Q Consensus        62 ~~~~~~~~~~~~~~   75 (94)
                      .+..++.+|.|.++
T Consensus        40 fL~~liVRCfrIll   53 (81)
T PF11057_consen   40 FLGLLIVRCFRILL   53 (81)
T ss_pred             HHHHHHHHHHHHHc
Confidence            33344445555443


No 44 
>PRK11267 biopolymer transport protein ExbD; Provisional
Probab=33.55  E-value=40  Score=22.01  Aligned_cols=14  Identities=29%  Similarity=0.750  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHHH
Q psy388           49 LLDVIAFIITILLV   62 (94)
Q Consensus        49 ~lDv~~~l~~~~~~   62 (94)
                      ++||++++++++++
T Consensus        23 lIDVvf~LLiFFmv   36 (141)
T PRK11267         23 FIDVMLVLLIIFMV   36 (141)
T ss_pred             HHHHHHHHHHHHHh
Confidence            78998777666544


No 45 
>PF04659 Arch_fla_DE:  Archaeal flagella protein ;  InterPro: IPR006752  Archaeal flagella are unique motility structures, and the absence of bacterial structural motility genes in the complete genome sequences of flagellated archaeal species has always suggested that archaeal flagellar biogenesis is likely mediated by novel components. FlaD and FlaE, are present in the cell as membrane-associated proteins but are not major components of isolated flagellar filaments. Interestingly, flaD was found to encode two proteins, each translated from a separate ribosome binding site. This group of sequences contain the archaeal flaD and flaE proteins. The conserved region that defines these sequences is found in the N-teminal region of flaE but towards the C-terminal region of flaD [].; GO: 0001539 ciliary or flagellar motility
Probab=33.52  E-value=34  Score=21.60  Aligned_cols=19  Identities=16%  Similarity=0.400  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHhcCCCcc
Q psy388           16 IEKSIWWIEYVLRHKGVAH   34 (94)
Q Consensus        16 ~d~av~wiE~vir~~g~~~   34 (94)
                      .-.+..|+||.+...|...
T Consensus        18 ~~~~~eWLefLve~~G~~~   36 (99)
T PF04659_consen   18 EIVVFEWLEFLVERVGHNN   36 (99)
T ss_pred             HHHHHHHHHHHHHHccccc
Confidence            4467899999999988765


No 46 
>PRK13461 F0F1 ATP synthase subunit B; Provisional
Probab=33.44  E-value=1.4e+02  Score=19.62  Aligned_cols=22  Identities=9%  Similarity=0.137  Sum_probs=11.5

Q ss_pred             HHHHHHHHhhhhhhhhhhhhhh
Q psy388           70 ATVRVLRKLNVIRLESEKDIKK   91 (94)
Q Consensus        70 ~~~~~~~~~~~~~~~~~~~~~~   91 (94)
                      +.+++++.+.+..-+++..+.+
T Consensus        22 L~~f~~kpi~~~l~~R~~~I~~   43 (159)
T PRK13461         22 LKHFFFDKIKAVIDSRQSEIDN   43 (159)
T ss_pred             HHHHhHHHHHHHHHHHHHHHHH
Confidence            4455555565555555554443


No 47 
>PF14756 Pdase_C33_assoc:  Peptidase_C33-associated domain
Probab=33.33  E-value=22  Score=23.59  Aligned_cols=25  Identities=28%  Similarity=0.528  Sum_probs=18.0

Q ss_pred             cCCCCHHHHHHHHHHHHHhcCCCcc
Q psy388           10 DTPMSPIEKSIWWIEYVLRHKGVAH   34 (94)
Q Consensus        10 drP~~P~d~av~wiE~vir~~g~~~   34 (94)
                      |||.+|....-.--.|-+||.|..|
T Consensus        42 ~rp~sp~ttvwtvsqf~arh~gg~h   66 (147)
T PF14756_consen   42 NRPASPVTTVWTVSQFFARHRGGEH   66 (147)
T ss_pred             CCCCCcccceeeHHHHHHHhcCCCC
Confidence            7888988754333458889988766


No 48 
>PRK14474 F0F1 ATP synthase subunit B; Provisional
Probab=32.83  E-value=1.5e+02  Score=21.44  Aligned_cols=31  Identities=13%  Similarity=0.271  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHHhhhhhhhhhhhhhhh
Q psy388           62 VLLLALYLATVRVLRKLNVIRLESEKDIKKK   92 (94)
Q Consensus        62 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   92 (94)
                      -++.+++.+.+++++-+.+..-+++.++.+.
T Consensus        14 nFlILv~lL~~fl~kPi~~~l~eR~~~I~~~   44 (250)
T PRK14474         14 NFLILVYLLRRFLYKPIIQVMKKRQQRIANR   44 (250)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3344455566677777777766666666543


No 49 
>TIGR00540 hemY_coli hemY protein. This is an uncharacterized protein encoded next to a heme-biosynthetic enzyme in two gamma division proteobacteria (E. coli and H. influenzae). It is known in no other species. The gene symbol hemY is unfortunate in that an unrelated protein, protoporphyrinogen oxidase, is designated as HemG in E. coli but as HemY in Bacillus subtilis.
Probab=32.53  E-value=1.3e+02  Score=22.70  Aligned_cols=45  Identities=20%  Similarity=0.346  Sum_probs=19.9

Q ss_pred             HHhcCCCcc--ccccccCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy388           26 VLRHKGVAH--LHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLR   76 (94)
Q Consensus        26 vir~~g~~~--l~~~~~~l~~~qy~~lDv~~~l~~~~~~~~~~~~~~~~~~~~   76 (94)
                      +..++|-=.  ..+...++|..-      .+++++++++.+++++++++.+++
T Consensus        21 ~~~~~Gyv~i~~~~~~ie~s~~~------~~~~~~~~~~~~~~~~~l~~~~~~   67 (409)
T TIGR00540        21 IAGHQGYVLIETANRIIEMSITG------LAIFFIIALAIIFAFEWGLRRFFR   67 (409)
T ss_pred             HcCCCCeEEEEECCEEEEeeHHH------HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            444555221  234445655543      333333333444445555555543


No 50 
>smart00394 RIIa RIIalpha, Regulatory subunit portion of type II PKA R-subunit. RIIalpha, Regulatory subunit portion of type II PKA R-subunit. Contains dimerisation interface and binding site for A-kinase-anchoring proteins (AKAPs).
Probab=32.41  E-value=74  Score=16.01  Aligned_cols=24  Identities=8%  Similarity=0.044  Sum_probs=18.5

Q ss_pred             hhHHhhcCCCCHHHHHHHHHHHHH
Q psy388            4 YSLLSKDTPMSPIEKSIWWIEYVL   27 (94)
Q Consensus         4 ls~~~~drP~~P~d~av~wiE~vi   27 (94)
                      ...+.+++|-+|.+-+..|.+=..
T Consensus        11 ~~~vl~~qP~d~~~f~~~yF~kL~   34 (38)
T smart00394       11 TVEVLRAQPSDLVQFAADYFEKLE   34 (38)
T ss_pred             HHHHHHHCCCcHHHHHHHHHHHHH
Confidence            456788999999998888876443


No 51 
>PF06667 PspB:  Phage shock protein B;  InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages []. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one [].; GO: 0006355 regulation of transcription, DNA-dependent, 0009271 phage shock
Probab=31.73  E-value=1.2e+02  Score=18.18  Aligned_cols=26  Identities=4%  Similarity=0.264  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy388           51 DVIAFIITILLVLLLALYLATVRVLR   76 (94)
Q Consensus        51 Dv~~~l~~~~~~~~~~~~~~~~~~~~   76 (94)
                      +++++.++++++++..++.++-+..+
T Consensus         4 ~fl~~plivf~ifVap~WL~lHY~sk   29 (75)
T PF06667_consen    4 EFLFVPLIVFMIFVAPIWLILHYRSK   29 (75)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            44555555555555555655554433


No 52 
>TIGR02803 ExbD_1 TonB system transport protein ExbD, group 1. Members of this family are Gram-negative bacterial inner membrane proteins, generally designated ExbD, related to the TolR family modeled by TIGRFAMs TIGR02801. Members always are encoded next to a protein designated ExbB (TIGR02797), related to the TolQ family modeled by TIGRFAMs TIGR02796. ExbD and ExbB together form a proton channel through which they can harness the proton-motive force to energize TonB, which in turn energizes TonB-dependent receptors in the outer membrane. TonB-dependent receptors with known specificity tend to import siderophores or vitamin B12. A TonB system and Tol-Pal system often will co-exist in a single bacterial genome.
Probab=30.63  E-value=52  Score=20.81  Aligned_cols=14  Identities=29%  Similarity=0.750  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHHHH
Q psy388           49 LLDVIAFIITILLV   62 (94)
Q Consensus        49 ~lDv~~~l~~~~~~   62 (94)
                      ++||++++++++++
T Consensus         9 lIDVvflLLiFFmv   22 (122)
T TIGR02803         9 FIDVMLVLLIIFMV   22 (122)
T ss_pred             HHHHHHHHHHHHHH
Confidence            67998777666554


No 53 
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=30.43  E-value=24  Score=29.75  Aligned_cols=29  Identities=14%  Similarity=0.103  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q psy388           53 IAFIITILLVLLLALYLATVRVLRKLNVIR   82 (94)
Q Consensus        53 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (94)
                      +++++++++-++.+++.++| ++++|-+.+
T Consensus        99 i~ll~~il~P~vg~~fCcCR-Cc~~CGg~~  127 (806)
T PF05478_consen   99 IGLLFIILMPLVGLCFCCCR-CCGNCGGRM  127 (806)
T ss_pred             HHHHHHHHHHHHHHHHhccc-cCCCcCCcc
Confidence            33333333333333333333 355554444


No 54 
>PRK14472 F0F1 ATP synthase subunit B; Provisional
Probab=29.37  E-value=1.8e+02  Score=19.52  Aligned_cols=21  Identities=19%  Similarity=0.025  Sum_probs=10.5

Q ss_pred             HHHHHHHHhhhhhhhhhhhhh
Q psy388           70 ATVRVLRKLNVIRLESEKDIK   90 (94)
Q Consensus        70 ~~~~~~~~~~~~~~~~~~~~~   90 (94)
                      +.+++++.+.+..-+++..+.
T Consensus        35 L~~~l~kpi~~~l~~R~~~I~   55 (175)
T PRK14472         35 LKKIAWGPILSALEEREKGIQ   55 (175)
T ss_pred             HHHHhHHHHHHHHHHHHHHHH
Confidence            344555555555444444443


No 55 
>PF11395 DUF2873:  Protein of unknown function (DUF2873);  InterPro: IPR021532 This entry is represented by the human SARS coronavirus, Orf7b; it is a family of uncharacterised viral proteins.
Probab=29.06  E-value=97  Score=16.32  Aligned_cols=9  Identities=33%  Similarity=0.811  Sum_probs=4.1

Q ss_pred             ccHHHHHHH
Q psy388           42 LSYVQYYLL   50 (94)
Q Consensus        42 l~~~qy~~l   50 (94)
                      +..+.+|..
T Consensus         4 ltl~dfylc   12 (43)
T PF11395_consen    4 LTLFDFYLC   12 (43)
T ss_pred             eehhHHHHH
Confidence            444555443


No 56 
>PRK08476 F0F1 ATP synthase subunit B'; Validated
Probab=28.98  E-value=1.7e+02  Score=19.10  Aligned_cols=26  Identities=12%  Similarity=0.107  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHhhhhhhhhhhhhhh
Q psy388           66 ALYLATVRVLRKLNVIRLESEKDIKK   91 (94)
Q Consensus        66 ~~~~~~~~~~~~~~~~~~~~~~~~~~   91 (94)
                      +.+.+-+++++.+.+..-.++..+..
T Consensus        20 l~~~l~kfl~kPi~~~l~~R~~~I~~   45 (141)
T PRK08476         20 LIVILNSWLYKPLLKFMDNRNASIKN   45 (141)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33444466677776665555555443


No 57 
>PF05944 Phage_term_smal:  Phage small terminase subunit;  InterPro: IPR010270 This entry is represented by Bacteriophage P2, GpM. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several phage small terminase subunit proteins as well as some related bacterial sequences []. M protein is probably an endonuclease which directs cos cleavage. The Q, P and M proteins are needed to package DNA into proheads and for the conversion of proheads to capsids.; GO: 0003677 DNA binding, 0004519 endonuclease activity, 0019069 viral capsid assembly
Probab=28.96  E-value=50  Score=21.82  Aligned_cols=15  Identities=20%  Similarity=0.408  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHhcC
Q psy388           16 IEKSIWWIEYVLRHK   30 (94)
Q Consensus        16 ~d~av~wiE~vir~~   30 (94)
                      .+.|..|.+|+++||
T Consensus        64 ~~~AL~~a~yAi~~~   78 (132)
T PF05944_consen   64 FDGALDIAEYAIEHG   78 (132)
T ss_pred             HHHHHHHHHHHHHcC
Confidence            578999999999996


No 58 
>PRK10747 putative protoheme IX biogenesis protein; Provisional
Probab=28.39  E-value=1.8e+02  Score=22.00  Aligned_cols=24  Identities=29%  Similarity=0.553  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy388           53 IAFIITILLVLLLALYLATVRVLR   76 (94)
Q Consensus        53 ~~~l~~~~~~~~~~~~~~~~~~~~   76 (94)
                      .+++++++++.+++++++++.+++
T Consensus        44 ~~~~~~~~~~~~~~~~~~~~~~~~   67 (398)
T PRK10747         44 LAIILILAMVVLFAIEWLLRRIFR   67 (398)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHh
Confidence            333333334444455566655554


No 59 
>COG3534 AbfA Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism]
Probab=28.39  E-value=43  Score=26.96  Aligned_cols=30  Identities=20%  Similarity=0.503  Sum_probs=20.3

Q ss_pred             CHHHHHHHHHHHHHhcCCCcc---c-cccccCccH
Q psy388           14 SPIEKSIWWIEYVLRHKGVAH---L-HSAAADLSY   44 (94)
Q Consensus        14 ~P~d~av~wiE~vir~~g~~~---l-~~~~~~l~~   44 (94)
                      ..+|.|..|+||+ .|+|...   + +.++.+-||
T Consensus       130 rgvd~ar~~vEY~-n~pggtywsdlR~~~G~~~P~  163 (501)
T COG3534         130 RGVDEARNWVEYC-NHPGGTYWSDLRRENGREEPW  163 (501)
T ss_pred             ccHHHHHHHHHHc-cCCCCChhHHHHHhcCCCCCc
Confidence            4578999999998 5665543   3 455555555


No 60 
>COG0848 ExbD Biopolymer transport protein [Intracellular trafficking and secretion]
Probab=27.63  E-value=62  Score=21.37  Aligned_cols=15  Identities=33%  Similarity=0.716  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHHHH
Q psy388           49 LLDVIAFIITILLVL   63 (94)
Q Consensus        49 ~lDv~~~l~~~~~~~   63 (94)
                      ++||++++++++++.
T Consensus        21 lIDVmLVLLiiFmvt   35 (137)
T COG0848          21 LIDVMLVLLIIFMVT   35 (137)
T ss_pred             HHHHHHHHHHHHHHh
Confidence            679988777665543


No 61 
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated
Probab=27.61  E-value=1.6e+02  Score=19.43  Aligned_cols=24  Identities=21%  Similarity=0.223  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHhhhhhhhhhhhhhh
Q psy388           68 YLATVRVLRKLNVIRLESEKDIKK   91 (94)
Q Consensus        68 ~~~~~~~~~~~~~~~~~~~~~~~~   91 (94)
                      +.+-+++++.+.+..-.++.++.+
T Consensus        37 ~lL~k~l~~Pi~~~l~~R~~~I~~   60 (156)
T CHL00118         37 VLLNIILYKPLLKVLDERKEYIRK   60 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344456666666665555555544


No 62 
>PF02197 RIIa:  Regulatory subunit of type II PKA R-subunit;  InterPro: IPR003117 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases [].  In the absence of cAMP, Protein Kinase A (PKA) exists as an equimolar tetramer of regulatory (R) and catalytic (C) subunits []. In addition to its role as an inhibitor of the C subunit, the R subunit anchors the holoenzyme to specific intracellular locations and prevents the C subunit from entering the nucleus. All R subunits have a conserved domain structure consisting of the N-terminal dimerization domain, inhibitory region, cAMP-binding domain A and cAMP-binding domain B. R subunits interact with C subunits primarily through the inhibitory site. The cAMP-binding domains show extensive sequence similarity and bind cAMP cooperatively.  Two types of regulatory (R) subunits exist - types I and I - which differ in molecular weight, sequence, autophosphorylation cabaility, cellular location and tissue distribution. Types I and II were further sub-divided into alpha and beta subtypes, based mainly on sequence similarity. This entry represents types I-alpha, I-beta, II-alpha and II-beta regulatory subunits of PKA proteins. These subunits contain the dimerisation interface and binding site for A-kinase-anchoring proteins (AKAPs).; GO: 0008603 cAMP-dependent protein kinase regulator activity, 0007165 signal transduction; PDB: 2IZY_E 1R2A_A 1L6E_A 2IZX_B 2KYG_A 2EZW_B 3IM4_B 3IM3_A 4F9K_C 2HWN_B ....
Probab=27.47  E-value=96  Score=15.85  Aligned_cols=23  Identities=9%  Similarity=0.109  Sum_probs=15.1

Q ss_pred             hhHHhhcCCCCHHHHHHHHHHHH
Q psy388            4 YSLLSKDTPMSPIEKSIWWIEYV   26 (94)
Q Consensus         4 ls~~~~drP~~P~d~av~wiE~v   26 (94)
                      ...+++++|.++.+=+..|-+-.
T Consensus        11 ~~~vl~~qP~Di~~F~a~yF~~L   33 (38)
T PF02197_consen   11 TREVLREQPDDILQFAADYFEKL   33 (38)
T ss_dssp             HHHHHHH--S-HHHHHHHHHHHH
T ss_pred             HHHHHHHCCCcHHHHHHHHHHHH
Confidence            46788999999998888776544


No 63 
>PF03929 PepSY_TM:  PepSY-associated TM helix;  InterPro: IPR005625  This domain represents a conserved transmembrane (TM) helix that is found in bacterial proteins. Coil residues are significantly more conserved than other residues and are frequently found within channels and transporters, where they introduce the flexibility and polarity required for transport across the membrane []. This TM helix associates with PepSY (peptidase (M4) and YpeB of subtilis). PepSY is a repeated region first identified in Thermoanaerobacter tengcongensis. The PepSY domain functions in the control of M4 peptidases through their propeptide and in the germination of spores. It may also play a part in regulating protease activity [].
Probab=26.38  E-value=88  Score=14.97  Aligned_cols=17  Identities=12%  Similarity=0.407  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy388           47 YYLLDVIAFIITILLVL   63 (94)
Q Consensus        47 y~~lDv~~~l~~~~~~~   63 (94)
                      .+..|+.++..+++.++
T Consensus         6 ~w~~~i~al~~lv~~iT   22 (27)
T PF03929_consen    6 KWFGDIFALFMLVFAIT   22 (27)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            36677777655544443


No 64 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=26.35  E-value=1.8e+02  Score=20.04  Aligned_cols=10  Identities=10%  Similarity=0.315  Sum_probs=4.6

Q ss_pred             cHHHHHHHHH
Q psy388           43 SYVQYYLLDV   52 (94)
Q Consensus        43 ~~~qy~~lDv   52 (94)
                      +|+.-++.-+
T Consensus        25 sffsthm~tI   34 (189)
T PF05568_consen   25 SFFSTHMYTI   34 (189)
T ss_pred             cHHHHHHHHH
Confidence            4555554433


No 65 
>PF09919 DUF2149:  Uncharacterized conserved protein (DUF2149);  InterPro: IPR018676  This family of conserved hypothetical proteins has no known function. 
Probab=25.64  E-value=1.1e+02  Score=18.96  Aligned_cols=19  Identities=37%  Similarity=0.441  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q psy388           48 YLLDVIAFIITILLVLLLA   66 (94)
Q Consensus        48 ~~lDv~~~l~~~~~~~~~~   66 (94)
                      +++|+.+++.+.+++.+..
T Consensus         6 NL~Dv~LVfav~llvalv~   24 (92)
T PF09919_consen    6 NLFDVMLVFAVGLLVALVM   24 (92)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            5789987766665555443


No 66 
>TIGR02976 phageshock_pspB phage shock protein B. This model describes the PspB protein of the psp (phage shock protein) operon, as found in Escherichia coli and many related species. Expression of a phage protein called secretin protein IV, and a number of other stresses including ethanol, heat shock, and defects in protein secretion trigger sigma-54-dependent expression of the phage shock regulon. PspB is both a regulator and an effector protein of the phage shock response.
Probab=25.41  E-value=1.6e+02  Score=17.59  Aligned_cols=24  Identities=17%  Similarity=0.304  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy388           52 VIAFIITILLVLLLALYLATVRVL   75 (94)
Q Consensus        52 v~~~l~~~~~~~~~~~~~~~~~~~   75 (94)
                      ++++.++++++++..++.++.+.-
T Consensus         5 fl~~Pliif~ifVap~wl~lHY~~   28 (75)
T TIGR02976         5 FLAIPLIIFVIFVAPLWLILHYRS   28 (75)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHh
Confidence            444444444444555555555443


No 67 
>PF14770 TMEM18:  Transmembrane protein 18
Probab=24.88  E-value=1.1e+02  Score=20.05  Aligned_cols=20  Identities=15%  Similarity=0.245  Sum_probs=9.9

Q ss_pred             HHHHHHHHHhcCCCccccccc
Q psy388           19 SIWWIEYVLRHKGVAHLHSAA   39 (94)
Q Consensus        19 av~wiE~vir~~g~~~l~~~~   39 (94)
                      .++-.|++-+.++ .|-++-+
T Consensus        51 ~v~~aE~iN~~~a-~nW~~Fs   70 (123)
T PF14770_consen   51 LVYCAEYINEYAA-RNWRSFS   70 (123)
T ss_pred             HHHHHHHHHHHHH-HHHHHHh
Confidence            4566666655532 3344443


No 68 
>PF06709 DUF1196:  Protein of unknown function (DUF1196);  InterPro: IPR009585 This family consists of several hypothetical bacterial proteins of around 51 residues in length which seem to be specific to Vibrio cholerae. The function of this family is unknown.
Probab=24.69  E-value=1.1e+02  Score=16.87  Aligned_cols=18  Identities=11%  Similarity=0.119  Sum_probs=10.0

Q ss_pred             HHHHhhhhhhhhhhhhhh
Q psy388           74 VLRKLNVIRLESEKDIKK   91 (94)
Q Consensus        74 ~~~~~~~~~~~~~~~~~~   91 (94)
                      ..+.+|+..+.++..+|.
T Consensus        19 ~FK~v~KGI~~K~hSIK~   36 (51)
T PF06709_consen   19 PFKGVAKGIYAKQHSIKQ   36 (51)
T ss_pred             hHHHHHHHHHHhhhhHHH
Confidence            345555666666555553


No 69 
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC and in principle may run in either direction. This model represents the F0 subunit B of this apparent second ATP synthase.
Probab=24.31  E-value=2.5e+02  Score=19.96  Aligned_cols=25  Identities=20%  Similarity=0.129  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHhhhhhhhhhhhhhh
Q psy388           67 LYLATVRVLRKLNVIRLESEKDIKK   91 (94)
Q Consensus        67 ~~~~~~~~~~~~~~~~~~~~~~~~~   91 (94)
                      .+.+.+++++.+.+..-.++..+..
T Consensus        19 ~~lL~kfl~kPi~~~l~~R~~~I~~   43 (246)
T TIGR03321        19 VWLLKRFLYRPILDAMDAREKKIAG   43 (246)
T ss_pred             HHHHHHHhHHHHHHHHHHHHHHHHH
Confidence            3444456666666665555555544


No 70 
>PF11346 DUF3149:  Protein of unknown function (DUF3149);  InterPro: IPR021494  This bacterial family of proteins has no known function. 
Probab=24.01  E-value=1.3e+02  Score=16.04  Aligned_cols=12  Identities=17%  Similarity=0.166  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHHH
Q psy388           44 YVQYYLLDVIAF   55 (94)
Q Consensus        44 ~~qy~~lDv~~~   55 (94)
                      |.+.+.-|+-+.
T Consensus         3 w~~LF~s~vGL~   14 (42)
T PF11346_consen    3 WKDLFGSDVGLM   14 (42)
T ss_pred             HHHHhcChHHHH
Confidence            344445555443


No 71 
>PF14043 WVELL:  WVELL protein
Probab=23.66  E-value=82  Score=19.00  Aligned_cols=20  Identities=30%  Similarity=0.611  Sum_probs=14.4

Q ss_pred             HhhcCCCCHHHHHHHHHHHH
Q psy388            7 LSKDTPMSPIEKSIWWIEYV   26 (94)
Q Consensus         7 ~~~drP~~P~d~av~wiE~v   26 (94)
                      ++...|+=+.+.|.+|||-.
T Consensus        11 LlekN~~Ls~~qArtWVElL   30 (75)
T PF14043_consen   11 LLEKNPMLSYEQARTWVELL   30 (75)
T ss_pred             HHHhCCCCCHHHHHHHHHHH
Confidence            44455666678899999964


No 72 
>COG5102 SFT2 Membrane protein involved in ER to Golgi transport [Intracellular trafficking and secretion]
Probab=23.34  E-value=2.3e+02  Score=19.95  Aligned_cols=29  Identities=14%  Similarity=-0.014  Sum_probs=19.3

Q ss_pred             CCCccccccccCccHHHHHHHHHHHHHHH
Q psy388           30 KGVAHLHSAAADLSYVQYYLLDVIAFIIT   58 (94)
Q Consensus        30 ~g~~~l~~~~~~l~~~qy~~lDv~~~l~~   58 (94)
                      ++.+..+|.-..++.+|++.+--..++++
T Consensus        50 dl~~~~q~s~F~Lsr~eR~vlF~~ClLGa   78 (201)
T COG5102          50 DLEHYFQSSEFGLSRFERAVLFSACLLGA   78 (201)
T ss_pred             ccccccccchhhHHHHHHHHHHHHHHhhh
Confidence            33344677778889999988875444443


No 73 
>TIGR02384 RelB_DinJ addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than Pfam model pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species.
Probab=23.32  E-value=1.8e+02  Score=17.45  Aligned_cols=31  Identities=13%  Similarity=0.285  Sum_probs=27.1

Q ss_pred             hhHHhhcCCCCHHHHHHHHHHHHHhcCCCcc
Q psy388            4 YSLLSKDTPMSPIEKSIWWIEYVLRHKGVAH   34 (94)
Q Consensus         4 ls~~~~drP~~P~d~av~wiE~vir~~g~~~   34 (94)
                      ...++.+--++|-+..--.++++++++|.|.
T Consensus        17 a~~i~~~lGl~~s~ai~~fl~qvv~~~~lPF   47 (83)
T TIGR02384        17 AYAVFEELGLTPSTAIRMFLKQVIREQGLPF   47 (83)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHHHHHhCCCCC
Confidence            4567788889999999999999999999885


No 74 
>COG5547 Small integral membrane protein [Function unknown]
Probab=23.25  E-value=1.6e+02  Score=16.96  Aligned_cols=20  Identities=10%  Similarity=0.429  Sum_probs=9.6

Q ss_pred             cHHHHHHHHHHHHHHHHHHH
Q psy388           43 SYVQYYLLDVIAFIITILLV   62 (94)
Q Consensus        43 ~~~qy~~lDv~~~l~~~~~~   62 (94)
                      .|++-+-.-+++.+..+++.
T Consensus         2 eflk~fkypIIgglvglliA   21 (62)
T COG5547           2 EFLKKFKYPIIGGLVGLLIA   21 (62)
T ss_pred             cHHHHhccchHHHHHHHHHH
Confidence            45555555555544433333


No 75 
>KOG3814|consensus
Probab=23.18  E-value=62  Score=25.79  Aligned_cols=27  Identities=19%  Similarity=0.372  Sum_probs=22.9

Q ss_pred             HhhcCCCCHHHHHHHHHHHHHhcCCCc
Q psy388            7 LSKDTPMSPIEKSIWWIEYVLRHKGVA   33 (94)
Q Consensus         7 ~~~drP~~P~d~av~wiE~vir~~g~~   33 (94)
                      .-|.||..|.+....++|+.+.|+-.+
T Consensus       418 tTrqQ~rHt~esil~Hle~Clt~~lsp  444 (531)
T KOG3814|consen  418 TTRQQPRHTMESILQHLEFCLTHDLSP  444 (531)
T ss_pred             HhhcCCCCcHHHHHHHHHHHHhcCCCH
Confidence            446899999999999999999996443


No 76 
>PHA02688 ORF059 IMV protein VP55; Provisional
Probab=22.99  E-value=1.8e+02  Score=22.30  Aligned_cols=61  Identities=20%  Similarity=0.343  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHHHhcCCCccccccccCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy388           16 IEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNV   80 (94)
Q Consensus        16 ~d~av~wiE~vir~~g~~~l~~~~~~l~~~qy~~lDv~~~l~~~~~~~~~~~~~~~~~~~~~~~~   80 (94)
                      ..++-.|++-  ++||+-+.-+.- -.||+-.+.++|+.++.+ +++++.++|-+-..++..+.|
T Consensus       256 wsrl~~Wla~--~~P~~~y~lttP-LfSfFGlfDInv~gviii-l~ii~l~IF~vnSkLlWFLaG  316 (323)
T PHA02688        256 WSRLGTWLAK--RYPGFYYFLTTP-LFSFFGLFDINVIGVIII-LFIIVLLIFDVNSKLLWFLAG  316 (323)
T ss_pred             HHHHHHHHHh--hCCchheeecch-HHHhhccchhHHHHHHHH-HHHHHHHHhcCCchHHHHHHH
Confidence            3456677654  778886543221 345666666666543333 233333344333333333333


No 77 
>PF03908 Sec20:  Sec20;  InterPro: IPR005606 Sec20 is a membrane glycoprotein associated with secretory pathway.
Probab=22.65  E-value=1.2e+02  Score=18.24  Aligned_cols=14  Identities=29%  Similarity=0.451  Sum_probs=6.2

Q ss_pred             HHHHHHHHHHHHHH
Q psy388           50 LDVIAFIITILLVL   63 (94)
Q Consensus        50 lDv~~~l~~~~~~~   63 (94)
                      .|=+.+.+++.+++
T Consensus        68 ~D~~li~~~~~~f~   81 (92)
T PF03908_consen   68 TDRILIFFAFLFFL   81 (92)
T ss_pred             HhHHHHHHHHHHHH
Confidence            35554444443333


No 78 
>KOG4433|consensus
Probab=22.59  E-value=3.6e+02  Score=22.03  Aligned_cols=63  Identities=17%  Similarity=0.198  Sum_probs=32.1

Q ss_pred             HHHHHHHHHHHHHhcCCCc--------cccccccCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Q psy388           15 PIEKSIWWIEYVLRHKGVA--------HLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNVIR   82 (94)
Q Consensus        15 P~d~av~wiE~vir~~g~~--------~l~~~~~~l~~~qy~~lDv~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (94)
                      |.-.|-||+.+.-..|..+        .++++  +-.+.| - |=+.+-+.+ ....+.+++.++..+++||++..
T Consensus         4 ~~y~a~~~v~~lh~lP~~~~~~~~tns~F~pe--~~~Y~Q-a-L~lla~l~a-a~l~l~Ll~ll~yli~~cC~Rr~   74 (526)
T KOG4433|consen    4 VMYFAPWWVNLLHVLPHLNFKLHPTNSVFRPE--DSEYQQ-A-LLLLAALAA-ACLGLSLLFLLFYLICRCCCRRE   74 (526)
T ss_pred             ccccchhHHHHhhcCCCCCceEeeccccCCCC--cHHHHH-H-HHHHHHHHH-HHHHHHHHHHHHHHHHHHHcCCC
Confidence            4456778998876666443        25555  222333 2 212221111 12233455666677778877653


No 79 
>PF14979 TMEM52:  Transmembrane 52
Probab=22.46  E-value=1.8e+02  Score=19.91  Aligned_cols=7  Identities=0%  Similarity=-0.391  Sum_probs=2.8

Q ss_pred             HHHHHHH
Q psy388           66 ALYLATV   72 (94)
Q Consensus        66 ~~~~~~~   72 (94)
                      +...++|
T Consensus        37 ~ta~C~r   43 (154)
T PF14979_consen   37 LTASCVR   43 (154)
T ss_pred             HHHHHHH
Confidence            3333444


No 80 
>PF08390 TRAM1:  TRAM1-like protein;  InterPro: IPR013599 This family comprises sequences that are similar to human TRAM1 (Q15629 from SWISSPROT). This is a transmembrane protein of the endoplasmic reticulum, thought to be involved in the membrane transfer of secretory proteins []. The region featured in this family is found N-terminal to the longevity-assurance protein region (IPR005547 from INTERPRO). 
Probab=22.36  E-value=1.7e+02  Score=16.71  Aligned_cols=21  Identities=10%  Similarity=-0.020  Sum_probs=11.2

Q ss_pred             CccHHHHHHHHHHHHHHHHHH
Q psy388           41 DLSYVQYYLLDVIAFIITILL   61 (94)
Q Consensus        41 ~l~~~qy~~lDv~~~l~~~~~   61 (94)
                      +.+.|..=.-|+..+++-+++
T Consensus        18 ~~~~Y~~G~~D~~fV~fy~i~   38 (65)
T PF08390_consen   18 GTGLYGKGWDDLYFVFFYIIV   38 (65)
T ss_pred             CCCccccCcchHHHHHHHHHH
Confidence            334455555677765554433


No 81 
>PF04689 S1FA:  DNA binding protein S1FA;  InterPro: IPR006779  S1FA is an unusual small plant peptide of only 70 amino acids with a basic domain which contains a nuclear localization signal and a putative DNA binding helix. S1FA is highly conserved between dicotyledonous and monocotyledonous plants and may be a DNA-binding protein that specifically recognises the negative promoter element S1F [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=22.11  E-value=68  Score=18.90  Aligned_cols=19  Identities=5%  Similarity=-0.251  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHhhhhhhhh
Q psy388           67 LYLATVRVLRKLNVIRLES   85 (94)
Q Consensus        67 ~~~~~~~~~~~~~~~~~~~   85 (94)
                      .-.++...+++....+.++
T Consensus        30 GnyvlY~Yaqk~lpp~kkk   48 (69)
T PF04689_consen   30 GNYVLYVYAQKTLPPKKKK   48 (69)
T ss_pred             HHHHHHHHHhhcCCCCCCC
Confidence            3444555566665554443


No 82 
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=22.10  E-value=3e+02  Score=21.41  Aligned_cols=17  Identities=18%  Similarity=0.012  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHHhhhh
Q psy388           65 LALYLATVRVLRKLNVI   81 (94)
Q Consensus        65 ~~~~~~~~~~~~~~~~~   81 (94)
                      .+++.++..+++|||+.
T Consensus        33 ~Ll~ll~yl~~~CC~r~   49 (406)
T PF04906_consen   33 SLLFLLIYLICRCCCRR   49 (406)
T ss_pred             HHHHHHHHHHHHhhCCC
Confidence            34455566666776665


No 83 
>PF06837 Fijivirus_P9-2:  Fijivirus P9-2 protein;  InterPro: IPR009650 This family consists of several Fijivirus specific P9-2 proteins from Rice black streaked dwarf virus (RBSDV) and Fiji disease virus. The function of this family is unknown.
Probab=22.04  E-value=3e+02  Score=19.67  Aligned_cols=65  Identities=8%  Similarity=0.103  Sum_probs=31.1

Q ss_pred             cCCC--CHHHHHHHHHHHHHhcCCCccccccccCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy388           10 DTPM--SPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYYLLDVIAFIITILLVLLLALYLATVRVLRKLNV   80 (94)
Q Consensus        10 drP~--~P~d~av~wiE~vir~~g~~~l~~~~~~l~~~qy~~lDv~~~l~~~~~~~~~~~~~~~~~~~~~~~~   80 (94)
                      ++|.  +-+|.-+.-.|..++-...|-+|-.-...+-+-   +=++.   .+++.++-+.++++..+.||.|.
T Consensus        43 e~~~sdse~Dd~vd~lE~~ve~~~~pl~rr~ygkvg~Ii---~mI~s---flfFGifkl~lKmfYhLfrcV~C  109 (214)
T PF06837_consen   43 ERPLSDSELDDKVDKLETDVEDKVDPLVRRKYGKVGHII---WMIFS---FLFFGIFKLTLKMFYHLFRCVCC  109 (214)
T ss_pred             cccCcchhHHHHHHHHhhhHHhCCCHHHHhhccCcceee---hHHHH---HHHHHHHHHHHHHHHHHHhhhhc
Confidence            4453  455777788888776655454433222222111   11122   22233444555666666665444


No 84 
>PHA02851 EEV glycoprotein; Provisional
Probab=21.90  E-value=1.2e+02  Score=21.23  Aligned_cols=12  Identities=8%  Similarity=0.016  Sum_probs=6.6

Q ss_pred             HHHHhhhhhhhh
Q psy388           74 VLRKLNVIRLES   85 (94)
Q Consensus        74 ~~~~~~~~~~~~   85 (94)
                      ++++-|++++++
T Consensus        22 IcKk~cKKFFkK   33 (223)
T PHA02851         22 INKKYCKKFFKK   33 (223)
T ss_pred             HhHHHHHHHHhc
Confidence            455555555554


No 85 
>PF08418 Pol_alpha_B_N:  DNA polymerase alpha subunit B N-terminal;  InterPro: IPR013627 This is the eukaryotic DNA polymerase alpha subunit B N-terminal domain which is involved in complex formation []. ; PDB: 4E2I_9 2KEB_A 3FLO_G.
Probab=21.74  E-value=71  Score=22.70  Aligned_cols=45  Identities=13%  Similarity=0.109  Sum_probs=27.1

Q ss_pred             hhhHHhhcCCCCHHHHHHHHHHHHHhcCCCccccccccCccHHHHH
Q psy388            3 YYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAHLHSAAADLSYVQYY   48 (94)
Q Consensus         3 ~ls~~~~drP~~P~d~av~wiE~vir~~g~~~l~~~~~~l~~~qy~   48 (94)
                      ++-.+.+.--++|.|.+..|.-|.+.++.- .+.....++.-|+.+
T Consensus        14 kl~slc~~~~ls~edL~~kWeaf~~~~~~~-~~~l~~~~L~~F~~~   58 (253)
T PF08418_consen   14 KLQSLCRLYNLSAEDLFYKWEAFSLNMQLD-DTKLTLDNLDQFKQY   58 (253)
T ss_dssp             HHHTHHHHST--HHHHHHHHTTHHHHTT-S-C----TTTTTGGGTT
T ss_pred             HHHHHHHHhCCCHHHHHHHHHHHHhhcCCC-cCcCCHHHHHHHHHH
Confidence            456677777889999999999999999644 333333344334433


No 86 
>PF15179 Myc_target_1:  Myc target protein 1
Probab=21.30  E-value=2.6e+02  Score=19.84  Aligned_cols=42  Identities=19%  Similarity=0.351  Sum_probs=19.9

Q ss_pred             ccHHHHHHH-HHHH-HHHHH--HHHHHHHHHHHHHHHHHHhhhhhh
Q psy388           42 LSYVQYYLL-DVIA-FIITI--LLVLLLALYLATVRVLRKLNVIRL   83 (94)
Q Consensus        42 l~~~qy~~l-Dv~~-~l~~~--~~~~~~~~~~~~~~~~~~~~~~~~   83 (94)
                      +.|.+-+++ |+++ |.+.+  .+++..++|.++.++.|+-..+.+
T Consensus        10 ~~~~~~f~~~~lIlaF~vSm~iGLviG~li~~LltwlSRRRASa~I   55 (197)
T PF15179_consen   10 LEWLENFDWEDLILAFCVSMAIGLVIGALIWALLTWLSRRRASARI   55 (197)
T ss_pred             ccchhhcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccccc
Confidence            455565533 3332 33222  223344556666666665544433


No 87 
>PF00957 Synaptobrevin:  Synaptobrevin;  InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis. Vesicle function is mediated by proteins in their membranes, although the precise nature of the protein-protein interactions underlying this are still uncertain []. Synaptobrevin may play a role in the molecular events underlying neurotransmitter release and vesicle recycling and may be involved in the regulation of membrane flow in the nerve terminal, a process mediated by interaction with low molecular weight GTP-binding proteins []. Synaptic vesicle-associated membrane proteins (VAMPs) from Torpedo californica (Pacific electric ray) and SNC1 from yeast are related to synaptobrevin.; GO: 0016192 vesicle-mediated transport, 0016021 integral to membrane; PDB: 3EGX_C 2NUP_C 3EGD_C 2NUT_C 1IOU_A 1H8M_A 3B5N_A 3ZYM_A 2NPS_A 1SFC_E ....
Probab=20.99  E-value=1.7e+02  Score=17.20  Aligned_cols=11  Identities=27%  Similarity=0.449  Sum_probs=5.3

Q ss_pred             HHHHHHHHHHH
Q psy388           44 YVQYYLLDVIA   54 (94)
Q Consensus        44 ~~qy~~lDv~~   54 (94)
                      |++.+-+=+++
T Consensus        62 ~~~~~k~~~i~   72 (89)
T PF00957_consen   62 WWRNYKLYIII   72 (89)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHhH
Confidence            55555444443


No 88 
>PF04221 RelB:  RelB antitoxin;  InterPro: IPR007337  Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. Several toxin/antitoxin pairs may occur in a single species. RelE and RelB form a toxin-antitoxin system; RelE represses translation, probably through binding ribosomes [, ]. RelB stably binds RelE, presumably deactivating it.; PDB: 2KC8_B 2K29_A.
Probab=20.81  E-value=1.7e+02  Score=17.22  Aligned_cols=32  Identities=6%  Similarity=0.183  Sum_probs=24.7

Q ss_pred             hhhHHhhcCCCCHHHHHHHHHHHHHhcCCCcc
Q psy388            3 YYSLLSKDTPMSPIEKSIWWIEYVLRHKGVAH   34 (94)
Q Consensus         3 ~ls~~~~drP~~P~d~av~wiE~vir~~g~~~   34 (94)
                      +...++.+..+++-+..--...++++++|.|.
T Consensus        15 ~a~~il~~~Glt~s~ai~~fl~qiv~~~~iPF   46 (83)
T PF04221_consen   15 EAEAILEELGLTLSDAINMFLKQIVREGGIPF   46 (83)
T ss_dssp             HHHHHHHHTT--HHHHHHHHHHHHHHHSS-S-
T ss_pred             HHHHHHHHcCCCHHHHHHHHHHHHHHhCCCCc
Confidence            35678888999999999999999999999885


No 89 
>PF04276 DUF443:  Protein of unknown function (DUF443) ;  InterPro: IPR005915  The members of this family share 50 % or greater sequence identity. They are found as eleven tandem genes, arranged head-to-tail, in Staphylococcus aureus (strain COL). Distant full-length homologs are found in a Staphylococcus haemolyticus plasmid and in Bacillus halodurans. The function of these proteins is unknown.
Probab=20.57  E-value=2e+02  Score=19.94  Aligned_cols=9  Identities=22%  Similarity=0.903  Sum_probs=4.0

Q ss_pred             HHHHHHHHH
Q psy388           44 YVQYYLLDV   52 (94)
Q Consensus        44 ~~qy~~lDv   52 (94)
                      +.++.+.+.
T Consensus        79 ~~~~~~i~~   87 (199)
T PF04276_consen   79 YIDYFNIQS   87 (199)
T ss_pred             HHHhccchh
Confidence            344444444


No 90 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=20.13  E-value=3e+02  Score=18.96  Aligned_cols=14  Identities=14%  Similarity=0.508  Sum_probs=6.0

Q ss_pred             HHHHHHHHHHHHHH
Q psy388           46 QYYLLDVIAFIITI   59 (94)
Q Consensus        46 qy~~lDv~~~l~~~   59 (94)
                      .+++-..+.+++.+
T Consensus        25 sffsthm~tILiaI   38 (189)
T PF05568_consen   25 SFFSTHMYTILIAI   38 (189)
T ss_pred             cHHHHHHHHHHHHH
Confidence            34444444444433


Done!