Diaphorina citri psyllid: psy3880

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MEKGEMVAHSRVVVRVKEEGDDLKHLAAQVVDKGEAAVQDIINSNPALRYIMRQLFEALEHVHNHSVVHRDLKPENILLDDQMNVKLTDFGFARVLKKGEKLMDLCGTPGYLAPEVLRANMFEDATGYGQAVDVWACGVIMYTLLVGCPPFWHRKQMVMLRNIMEGKYSFSSPEWNDISGYLAPEVLRANMFEDATGYGQAVDVWACGVIMYTLLVGCPPFWHRKQMVMLRNIMEGKYSFSSPEWNDISEDPKDLIRKLLIVTPEDRYSVKEALNHSFFHPKLFDQDIEPIKKDYKTASRKLSKINQLTEFQFIILVVRAAVRISRLKYNHVPALSVTQGRDDPYGVKILRQYNALKEGREPDLSDYKEFKLKEDNVGFKMLQKLGWQEGSGLGTDGGGIQEPVNKIV
ccccccccccccEEEEEEEccccEEEEEEccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEECcccccEEccccccccccccccccccHHHHcccccccccccccccEEEHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccHHHHHccccccHHHHHccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccc
***GEMVAHSRVVVRVKEEGDDLKHLAAQVVDKGEAAVQDIINSNPALRYIMRQLFEALEHVHNHSVVHRDLKPENILLDDQMNVKLTDFGFARVLKKGEKLMDLCGTPGYLAPEVLRANMFEDATGYGQAVDVWACGVIMYTLLVGCPPFWHRKQMVMLRNIMEGKYSFSSPEWNDISGYLAPEVLRANMFEDATGYGQAVDVWACGVIMYTLLVGCPPFWHRKQMVMLRNIMEGKYSFSSPEWNDISEDPKDLIRKLLIVTPEDRYSVKEALNHSFFHPKLFDQDIEPIKKDYKTASRKLSKINQLTEFQFIILVVRAAVRISRLKYNHVPALSVTQGRDDPYGVKILRQYNALK*********YKEFKLKEDNVGFKMLQK************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKGEMVAHSRVVVRVKEEGDDLKHLAAQVVDKGEAAVQDIINSNPALRYIMRQLFEALEHVHNHSVVHRDLKPENILLDDQMNVKLTDFGFARVLKKGEKLMDLCGTPGYLAPEVLRANMFEDATGYGQAVDVWACGVIMYTLLVGCPPFWHRKQMVMLRNIMEGKYSFSSPEWNDISGYLAPEVLRANMFEDATGYGQAVDVWACGVIMYTLLVGCPPFWHRKQMVMLRNIMEGKYSFSSPEWNDISEDPKDLIRKLLIVTPEDRYSVKEALNHSFFHPKLFDQDIEPIKKDYKTASRKLSKINQLTEFQFIILVVRAAVRISRLKYNHVPALSVTQGRDDPYGVKILRQYNALKEGREPDLSDYKEFKLKEDNVGFKMLQKLGWQEGSGLGTDGGGIQEPVNKIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphorylase b kinase gamma catalytic chain, liver/testis isoform Catalytic subunit of the phosphorylase b kinase (PHK), which mediates the neural and hormonal regulation of glycogen breakdown (glycogenolysis) by phosphorylating and thereby activating glycogen phosphorylase (PYGB, PYGL or PYGM). May regulate glycogeneolysis in the testis. In vitro, phosphorylates TNNI3, TNNT2, MAPT/TAU, GAP43 and NRGN/RC3.confidentP31325
Phosphorylase b kinase gamma catalytic chain, liver/testis isoform Catalytic subunit of the phosphorylase b kinase (PHK), which mediates the neural and hormonal regulation of glycogen breakdown (glycogenolysis) by phosphorylating and thereby activating glycogen phosphorylase (PYGB, PYGL or PYGM). May regulate glycogeneolysis in the testis. In vitro, phosphorylates TNNI3, TNNT2, MAPT/TAU, GAP43 and NRGN/RC3.confidentQ9DB30
Phosphorylase b kinase gamma catalytic chain, liver/testis isoform Catalytic subunit of the phosphorylase b kinase (PHK), which mediates the neural and hormonal regulation of glycogen breakdown (glycogenolysis) by phosphorylating and thereby activating glycogen phosphorylase (PYGB, PYGL or PYGM). May regulate glycogeneolysis in the testis. In vitro, phosphorylates TNNI3, TNNT2, MAPT/TAU, GAP43 and NRGN/RC3.confidentQ2KJ16

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0032879 [BP]regulation of localizationprobableGO:0008150, GO:0065007, GO:0050789
GO:0004689 [MF]phosphorylase kinase activityprobableGO:0004683, GO:0016773, GO:0016772, GO:0003824, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0005964 [CC]phosphorylase kinase complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005977 [BP]glycogen metabolic processprobableGO:0044042, GO:0044238, GO:0044264, GO:0044262, GO:0015980, GO:0044260, GO:0005976, GO:0009987, GO:0044710, GO:0044237, GO:0043170, GO:0008152, GO:0071704, GO:0006112, GO:0008150, GO:0006073, GO:0005975, GO:0006091, GO:0055114

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PHK, chain A
Confidence level:very confident
Coverage over the Query: 8-151,222-283
View the alignment between query and template
View the model in PyMOL
Template: 3LIJ, chain A
Confidence level:very confident
Coverage over the Query: 6-151,222-321
View the alignment between query and template
View the model in PyMOL
Template: 2B9H, chain A
Confidence level:very confident
Coverage over the Query: 6-184,229-283
View the alignment between query and template
View the model in PyMOL
Template: 3V8S, chain A
Confidence level:very confident
Coverage over the Query: 6-130,201-285
View the alignment between query and template
View the model in PyMOL
Template: 3BHH, chain A
Confidence level:confident
Coverage over the Query: 6-207
View the alignment between query and template
View the model in PyMOL