Diaphorina citri psyllid: psy3897

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240

MKRRRRSDEKRLKAKSLTSMSVWERKSLFRKLPPRTGFNPVCTSGLRISALDHVGGINGPLEGYVKTKPRKSPPPNGYGVYALDTEMVYTVHGLEVARVTVVNVDGRLIYNTLVKPDCEIIDYNTKYSGISAKDFIRNPYKTLKDVQNDLMGFVSKDSIIVGHGLENDLRALKLIHSNIIDTSVLFPHSFGLPYRRSLKSIVSQLLHQSIQSGTHDSFEDARACIDLILWKLLSDFRYNH

ccccccHHHHHHHcccccccHHHHHHHHHcccccccccccccccccEEEEEECcccccccccccEEcccccccccccccEEEEEEcEEEEccccEEEEEEEEEccccEEEEEEccccccccccccccccccHHHHcccccccHHHHHHHHHHccccccEEEEEcHHHHHHHHccccccEECcccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccc

*********************VWERKSLFRKLPPRTGFNPVCTSGLRISALDHVGGINGPLEGYV***********GYGVYALDTEMVYTVHGLEVARVTVVNVDGRLIYNTLVKPDCEIIDYNTKYSGISAKDFIRNPYKTLKDVQNDLMGFVSKDSIIVGHGLENDLRALKLIHSNIIDTSVLFPHSFGLPYRRSLKSIVSQLLHQSIQSGTHDSFEDARACIDLILWKLLSDFR*N*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Exonuclease GOR		confident	Q8IX06
Exonuclease GOR		confident	P48778

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0004527 [MF]	exonuclease activity	probable	GO:0004518, GO:0016787, GO:0003674, GO:0016788, GO:0003824
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0010212 [BP]	response to ionizing radiation	probable	GO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0042771 [BP]	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	probable	GO:0097190, GO:0097193, GO:0023052, GO:0007165, GO:0007569, GO:0072331, GO:0035556, GO:0044699, GO:0072332, GO:0051716, GO:0050789, GO:0065007, GO:0010259, GO:0009987, GO:0006915, GO:0050794, GO:0006974, GO:0012501, GO:0006950, GO:0044763, GO:0007154, GO:0044700, GO:0008630, GO:0050896, GO:0033554, GO:0008150
GO:0032991 [CC]	macromolecular complex	probable	GO:0005575

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WLJ, chain A
Confidence level:very confident
Coverage over the Query: 79-234
View the alignment between query and template
View the model in PyMOL

Template: 2XRI, chain A
Confidence level:confident
Coverage over the Query: 62-238
View the alignment between query and template
View the model in PyMOL