Query         psy3908
Match_columns 170
No_of_seqs    29 out of 31
Neff          3.0 
Searched_HMMs 46136
Date          Fri Aug 16 20:28:24 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3908.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3908hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12736 CABIT:  Cell-cycle sus  99.9 1.9E-22 4.1E-27  165.1  10.7  121   30-163     1-122 (256)
  2 PF02080 TrkA_C:  TrkA-C domain  58.3     5.8 0.00013   25.9   1.2   21  146-166    40-60  (71)
  3 PF10660 MitoNEET_N:  Iron-cont  53.7     4.3 9.4E-05   29.1   0.0   14   88-101    18-31  (64)
  4 PF12736 CABIT:  Cell-cycle sus  49.3      81  0.0017   26.1   6.8   75   18-104   166-242 (256)
  5 PF15414 DUF4621:  Protein of u  47.6      17 0.00037   32.4   2.7   62   23-106   152-213 (329)
  6 PF08615 RNase_H2_suC:  Ribonuc  45.0     9.2  0.0002   29.2   0.6   26   78-105    46-71  (137)
  7 PF05899 Cupin_3:  Protein of u  32.0      84  0.0018   21.8   3.7   28  130-162    26-56  (74)
  8 PF14400 Transglut_i_TM:  Inact  29.3   1E+02  0.0022   25.5   4.4   51   42-106     4-54  (165)
  9 cd05888 Ig1_Nectin-4_like Frst  27.6      37  0.0008   24.2   1.4   20    2-21     61-80  (100)
 10 PF13464 DUF4115:  Domain of un  27.1      59  0.0013   22.4   2.3   24  140-165    14-37  (77)
 11 PF05688 DUF824:  Salmonella re  26.9      91   0.002   21.1   3.1   33  129-161    11-43  (47)
 12 TIGR02988 YaaA_near_RecF S4 do  24.0      42 0.00092   22.1   1.0   21  143-163    39-59  (59)
 13 COG0569 TrkA K+ transport syst  23.8      98  0.0021   25.6   3.4   21  145-165   189-209 (225)
 14 PF13275 S4_2:  S4 domain; PDB:  23.1      52  0.0011   23.4   1.4   27  141-167    36-62  (65)
 15 TIGR03432 yjhG_yagF probable d  21.7      65  0.0014   32.1   2.2   31   20-50    323-363 (640)
 16 TIGR00061 L21 ribosomal protei  21.6      90   0.002   23.8   2.5   48   26-75     30-77  (101)
 17 PF06481 COX_ARM:  COX Aromatic  20.5      17 0.00038   23.8  -1.4   17  100-116    13-31  (47)

No 1  
>PF12736 CABIT:  Cell-cycle sustaining, positive selection, 
Probab=99.88  E-value=1.9e-22  Score=165.12  Aligned_cols=121  Identities=36%  Similarity=0.459  Sum_probs=110.2

Q ss_pred             CCeeEEeccCcccccCccCCCCCCcceeEeeeeccceeeeeeeehhhhcCceeccccceeeeCCCCCceeEEeccCCcee
Q psy3908          30 LPTVVKIIKGQYGNLGVPTLPSPGLQSTVLLVSAGKRQKIIAQAVKLKEGRRFVGVGSRIDIPENYPGYFELLSEEGKSM  109 (170)
Q Consensus        30 LP~vvri~~Gqy~~lGvp~l~~~slq~~~Ll~sa~~r~~i~aqa~kl~Egr~v~~IGPkI~IP~~Y~G~F~LLsed~~~v  109 (170)
                      ||+|++|..|+|...+++.|+    .+.++||.+.+.++|+|++++-++|+.   +||++.||++|+|||+++..++   
T Consensus         1 lP~vv~V~~g~y~~~~~~~l~----G~~l~l~~~~~~k~i~a~~~~~~~~~~---~g~~~~IP~~y~G~F~~~~~~~---   70 (256)
T PF12736_consen    1 LPRVVKVQSGVYFQGSVYELS----GQELCLHTGDQIKKILAQSVESEKGRK---VGPHFLIPLNYPGKFKRLPRPG---   70 (256)
T ss_pred             CCeEEEEecCCCCCCccccCC----CCEEEEEecCEeeEEEEEEEeccCccc---cCCEEEECCcccceEEECCCcc---
Confidence            799999999999998888777    566899999888999999999888887   8999999999999999999988   


Q ss_pred             eeeehHHHH-HhhccCcceEEeeeeeeeeeeecCCCCeeccceeeEecCceeeec
Q psy3908         110 RCCETVLEI-SRRKIEAGCLIREAIKGIVAKYDEEGNLQSDGARIVNIGEVLLPK  163 (170)
Q Consensus       110 R~fesV~El-a~~fp~~rvlv~E~Ir~~~~~~~ed~~~~~~~~~Tl~aGe~L~l~  163 (170)
                       +|+||+|| ++.+| .+|++++++++.. ..+++++....+++++++||.|+++
T Consensus        71 -~f~tV~eL~~~~~p-~~v~~~~~~~~~~-~~~~~~~~~~~~~~~v~~Ge~L~l~  122 (256)
T PF12736_consen   71 -PFETVYELLSRGFP-LRVVVTKDITFSS-ASGENSSVSDYGKRTVPAGEVLRLL  122 (256)
T ss_pred             -ccCCHHHHhhccCC-CEEEEcCccceec-ccccccccccCCceEECCCCEEEEE
Confidence             99999999 99999 9999999999987 5566666777889999999999999


No 2  
>PF02080 TrkA_C:  TrkA-C domain;  InterPro: IPR006037 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus. The domain is prevalent among prokaryotic K+ channels, and also found in eukaryotic, high-conductance Ca2+-activated K+ channels (BK channels) [, , ]. Largely involved in redox-linked regulation of potassium channels, the N-terminal part of the RCK domain is predicted to be an active dehydrogenase at least in some cases []. Some have a conserved sequence motif (G-x-G-x-x-G-x(n)-[DE]) for NAD+ binding [], but others do not, reflecting the diversity of ligands for RCK domains. The C-terminal part is less conserved, being absent in some channels, such as the kefC antiporter from Escherichia coli. It is predicted to bind unidentified ligands and to regulate sulphate, sodium and other transporters. The X-ray structure of several RCK domains has been solved [, , ]. It reveals an alpha-beta fold similar to dehydrogenase enzymes. The domain forms a homodimer, producing a cleft between two lobes. It has a composite structure, with an N-terminal (RCK-N), and a C-terminal (RCK-C) subdomain. The RCK-N subdomain forms a Rossmann fold with two alpha helices on one side of a six stranded parallel beta sheet and three alpha helices on the other side. The RCK-C subdomain is an all-beta-strand fold. It forms an extention of the dimer interface and further stabilises the RCK homodimer [, , ]. Ca2+ is a ligand that opens the channel in a concentration-dependent manner. Two Ca2+ ions are located at the base of a cleft between two RCK domains, coordinated by the carboxylate groups of two glutamate residues, and by an aspartate residue [, , ]. RCK domains occur in at least five different contexts:   As a single domain on the C terminus of some K+ channels (for example, many prokaryotic K+ channels).  As two tandem RCK domains on the C terminus of some transporters that form gating rings (for example, eukaryotic BK channels). The gating ring has an arrangement of eight identical RCK domains, one from each of the four pore-forming subunits and four from the intracellular solution. As two domains, one at the N terminus and another at the C terminus of transporter (for example, the prokaryotic trk system potassium uptake protein A). As a soluble protein (not part of a K+ channel) consisting of two tandem RCK domains. As a soluble protein consisting of a single RCK domain.   This entry represents the C-terminal subdomain of RCK.; GO: 0008324 cation transmembrane transporter activity, 0006813 potassium ion transport; PDB: 2BKP_A 1VCT_A 2BKO_A 2BKN_A 3L4B_C 2FY8_D 2AEF_A 1LNQ_E 3RBX_C 3KXD_A ....
Probab=58.29  E-value=5.8  Score=25.93  Aligned_cols=21  Identities=19%  Similarity=0.539  Sum_probs=14.0

Q ss_pred             eeccceeeEecCceeeecccc
Q psy3908         146 LQSDGARIVNIGEVLLPKSEV  166 (170)
Q Consensus       146 ~~~~~~~Tl~aGe~L~l~g~~  166 (170)
                      ..+.++.+|++||.|.++|..
T Consensus        40 ~~p~~~~~l~~gD~l~v~g~~   60 (71)
T PF02080_consen   40 IIPDGDTVLQAGDILIVVGDP   60 (71)
T ss_dssp             ES--TT-BE-TTEEEEEEEEH
T ss_pred             ECCCCCCEECCCCEEEEEECH
Confidence            445568899999999999863


No 3  
>PF10660 MitoNEET_N:  Iron-containing outer mitochondrial membrane protein N-terminus  ;  InterPro: IPR019610 The CDGSH iron sulphur domain are a group of iron-sulphur (Fe-S) clusters and a unique 39 amino acid CDGSH domain [C-X-C-X2-(S/T)-X3-P-X-C-D-G-(S/A/T)-H].  The CDGSH iron sulphur domain protein (also referred to as mitoNEET) is an integral membrane protein located in the outer mitochondrial membrane and whose function may be to transport iron into the mitochondria []. Iron in turn is essential for the function of several mitochondrial enzymes.  This entry represents the N-terminal of the mitoNEET and Miner-type proteins that carry a CDGSH-type cluster-binding domain (IPR018967 from INTERPRO) that coordinate a redox-active 2Fe-2S cluster. In the outer mitochondrian membrane (OMM), the CDGSH 2Fe-2S-containing domain is oriented towards the cytoplasm and is tethered to the mitochondrial membrane by the N-terminal domain found in higher vertebrates [, , ]. The whole protein regulates oxidative capacity and may function in electron transfer, for instance in redox reactions with metabolic intermediates, cofactors and/or proteins localized at the OMM.; GO: 0051537 2 iron, 2 sulfur cluster binding, 0043231 intracellular membrane-bounded organelle; PDB: 2R13_A 3REE_A 2QD0_B.
Probab=53.72  E-value=4.3  Score=29.12  Aligned_cols=14  Identities=36%  Similarity=1.058  Sum_probs=0.0

Q ss_pred             eeeeCCCCCceeEE
Q psy3908          88 RIDIPENYPGYFEL  101 (170)
Q Consensus        88 kI~IP~~Y~G~F~L  101 (170)
                      .+.||+++.|||+|
T Consensus        18 ~lPiP~s~gg~f~L   31 (64)
T PF10660_consen   18 SLPIPDSFGGFFKL   31 (64)
T ss_dssp             --------------
T ss_pred             cccccccccccccc
Confidence            37899999999996


No 4  
>PF12736 CABIT:  Cell-cycle sustaining, positive selection, 
Probab=49.33  E-value=81  Score=26.13  Aligned_cols=75  Identities=24%  Similarity=0.367  Sum_probs=44.9

Q ss_pred             cccHHHHhhhcCCCeeEEeccCcccccCccCCCCCCccee--EeeeeccceeeeeeeehhhhcCceeccccceeeeCCCC
Q psy3908          18 GQYLREFVSKNSLPTVVKIIKGQYGNLGVPTLPSPGLQST--VLLVSAGKRQKIIAQAVKLKEGRRFVGVGSRIDIPENY   95 (170)
Q Consensus        18 ~~~L~~~vsk~rLP~vvri~~Gqy~~lGvp~l~~~slq~~--~Ll~sa~~r~~i~aqa~kl~Egr~v~~IGPkI~IP~~Y   95 (170)
                      ...|++++.+++||.-+|+..|.      |.++.-.+..+  +-|.+.--..-++|+++.  +.+..+.    +.||.+-
T Consensus       166 ~ytL~el~~~~~LP~~vk~~~~~------~~~~~d~~~~~~~l~l~~~~~e~~~~~~~~~--~~~~~~~----~eiP~~l  233 (256)
T PF12736_consen  166 RYTLKELLQQFRLPCNVKVVSGD------PSLPRDPLHFTPELRLEELIEEPFLVASALM--KPRETIS----VEIPSDL  233 (256)
T ss_pred             ceEHHHHHhccCCCeEEEEecCC------CCCcccccccCCceEEeeeEeeeEEEEEECC--CCCcceE----EEeCCCC
Confidence            48899999999999999999777      33332122221  333333334556666665  3333211    6888886


Q ss_pred             CceeEEecc
Q psy3908          96 PGYFELLSE  104 (170)
Q Consensus        96 ~G~F~LLse  104 (170)
                      .=.|.....
T Consensus       234 ~v~v~~~~~  242 (256)
T PF12736_consen  234 DVKVVDVTG  242 (256)
T ss_pred             ceEEEECcc
Confidence            555555544


No 5  
>PF15414 DUF4621:  Protein of unknown function (DUF4621)
Probab=47.62  E-value=17  Score=32.44  Aligned_cols=62  Identities=32%  Similarity=0.369  Sum_probs=50.8

Q ss_pred             HHhhhcCCCeeEEeccCcccccCccCCCCCCcceeEeeeeccceeeeeeeehhhhcCceeccccceeeeCCCCCceeEEe
Q psy3908          23 EFVSKNSLPTVVKIIKGQYGNLGVPTLPSPGLQSTVLLVSAGKRQKIIAQAVKLKEGRRFVGVGSRIDIPENYPGYFELL  102 (170)
Q Consensus        23 ~~vsk~rLP~vvri~~Gqy~~lGvp~l~~~slq~~~Ll~sa~~r~~i~aqa~kl~Egr~v~~IGPkI~IP~~Y~G~F~LL  102 (170)
                      .||.+-+||-++.|.+                |..-|-+||..+||+-|-|-.|.|=||-      +.+|++-.-.|.-+
T Consensus       152 kfvkneklpgivqivp----------------qkihlslsadskqwtnapadalselrya------velpltpapefsav  209 (329)
T PF15414_consen  152 KFVKNEKLPGIVQIVP----------------QKIHLSLSADSKQWTNAPADALSELRYA------VELPLTPAPEFSAV  209 (329)
T ss_pred             hhhhcccCCceEEeec----------------cceEEEeecchhhhccCchHHHHhhHhh------eeccCCCCccccee
Confidence            4788889999988862                4456778899999999999999999996      57888888888877


Q ss_pred             ccCC
Q psy3908         103 SEEG  106 (170)
Q Consensus       103 sed~  106 (170)
                      |-++
T Consensus       210 sver  213 (329)
T PF15414_consen  210 SVER  213 (329)
T ss_pred             ehhh
Confidence            7655


No 6  
>PF08615 RNase_H2_suC:  Ribonuclease H2 non-catalytic subunit (Ylr154p-like);  InterPro: IPR013924 Whereas bacterial and archaeal RNases H2 are active as single polypeptides, the Saccharomyces cerevisiae (Baker's yeast) homologue, Rnh2Ap, when expressed in Escherichia coli, fails to produce an active RNase H2. For RNase H2 activity three proteins are required [Rnh2Ap (Rnh201p), Ydr279p (Rnh202p) and Ylr154p (Rnh203p)]. Deletion of any one of the proteins or mutations in the catalytic site in Rnh2A leads to loss of RNase H2 activity []. RNase H2 is an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. It participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication.  This entry represents the non-catalytic C subunit of RNase H2, which in S. cerevisiae is Q12338 from SWISSPROT (Ylr154p/Rnh203p).; PDB: 3PUF_L 3P56_C 3P5J_C 3KIO_C.
Probab=45.03  E-value=9.2  Score=29.19  Aligned_cols=26  Identities=31%  Similarity=0.629  Sum_probs=19.8

Q ss_pred             cCceeccccceeeeCCCCCceeEEeccC
Q psy3908          78 EGRRFVGVGSRIDIPENYPGYFELLSEE  105 (170)
Q Consensus        78 Egr~v~~IGPkI~IP~~Y~G~F~LLsed  105 (170)
                      +||+.  +|=++.+|++|.|+.---++.
T Consensus        46 RGR~L--~G~~l~lP~gy~g~vl~~~~~   71 (137)
T PF08615_consen   46 RGRKL--RGKELSLPEGYRGVVLSKSNK   71 (137)
T ss_dssp             TTEEE--EEEEEE--TTEEEEEEECCTT
T ss_pred             cCcEE--eccEeecCCCceEEEEEecCC
Confidence            89999  999999999999986554443


No 7  
>PF05899 Cupin_3:  Protein of unknown function (DUF861);  InterPro: IPR008579 The function of the proteins in this entry are unknown. They contain the conserved barrel domain of the 'cupin' superfamily and members are specific to plants and bacteria.; PDB: 1RC6_A 3MYX_A 1O5U_A 2K9Z_A 1LKN_A 3ES4_A 1SFN_B 3BCW_A.
Probab=32.02  E-value=84  Score=21.75  Aligned_cols=28  Identities=18%  Similarity=0.299  Sum_probs=18.5

Q ss_pred             eeeeeeeeee---ecCCCCeeccceeeEecCceeee
Q psy3908         130 REAIKGIVAK---YDEEGNLQSDGARIVNIGEVLLP  162 (170)
Q Consensus       130 ~E~Ir~~~~~---~~ed~~~~~~~~~Tl~aGe~L~l  162 (170)
                      .|.+-++.++   .++||+     ..++.|||.+.+
T Consensus        26 ~E~~~vleG~v~it~~~G~-----~~~~~aGD~~~~   56 (74)
T PF05899_consen   26 DEFFYVLEGEVTITDEDGE-----TVTFKAGDAFFL   56 (74)
T ss_dssp             EEEEEEEEEEEEEEETTTE-----EEEEETTEEEEE
T ss_pred             CEEEEEEEeEEEEEECCCC-----EEEEcCCcEEEE
Confidence            4444445554   356775     579999998875


No 8  
>PF14400 Transglut_i_TM:  Inactive transglutaminase fused to 7 transmembrane helices
Probab=29.31  E-value=1e+02  Score=25.51  Aligned_cols=51  Identities=39%  Similarity=0.539  Sum_probs=36.2

Q ss_pred             cccCccCCCCCCcceeEeeeeccceeeeeeeehhhhcCceeccccceeeeCCCCCceeEEeccCC
Q psy3908          42 GNLGVPTLPSPGLQSTVLLVSAGKRQKIIAQAVKLKEGRRFVGVGSRIDIPENYPGYFELLSEEG  106 (170)
Q Consensus        42 ~~lGvp~l~~~slq~~~Ll~sa~~r~~i~aqa~kl~Egr~v~~IGPkI~IP~~Y~G~F~LLsed~  106 (170)
                      ..+|+|.+|  +++..+-.+.|  |-...|+-      .   +|==.+.+|.+-+| |.+|+|+-
T Consensus         4 ~~~gvP~~P--ge~~~vW~VEA--rV~F~a~g------~---pvkvsl~lP~~~pg-f~il~E~~   54 (165)
T PF14400_consen    4 IVLGVPLLP--GEQRQVWNVEA--RVEFDATG------G---PVKVSLALPDTQPG-FTILDENF   54 (165)
T ss_pred             EEeCCCCCC--CCceeEEEEEE--EEEEecCC------C---CEEEEEcCCCCCCC-eEEEcccc
Confidence            467999888  89988888888  44444332      1   12347899999998 67888765


No 9  
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=27.61  E-value=37  Score=24.16  Aligned_cols=20  Identities=40%  Similarity=0.694  Sum_probs=17.6

Q ss_pred             CCCceEEEeeeeecCCcccH
Q psy3908           2 ATDGQILLATAKWSDEGQYL   21 (170)
Q Consensus         2 atd~~i~l~~~~Ws~~~~~L   21 (170)
                      ..|++|.+..++.||++.|-
T Consensus        61 ~~~~sL~I~nv~~sD~GtY~   80 (100)
T cd05888          61 IADGALILRNAVQADEGKYK   80 (100)
T ss_pred             CCceEEEEecCccccceEEE
Confidence            46899999999999999884


No 10 
>PF13464 DUF4115:  Domain of unknown function (DUF4115)
Probab=27.12  E-value=59  Score=22.44  Aligned_cols=24  Identities=17%  Similarity=0.210  Sum_probs=17.4

Q ss_pred             ecCCCCeeccceeeEecCceeeeccc
Q psy3908         140 YDEEGNLQSDGARIVNIGEVLLPKSE  165 (170)
Q Consensus       140 ~~ed~~~~~~~~~Tl~aGe~L~l~g~  165 (170)
                      .|.||++.  +..++++||++++.++
T Consensus        14 ~d~dG~~~--~~~~l~~G~~~~~~~~   37 (77)
T PF13464_consen   14 TDADGKVL--FSGTLKAGETKTFEGK   37 (77)
T ss_pred             EeCCCcEe--eeeeeCCCcEEEEeCC
Confidence            35677643  3789999999998654


No 11 
>PF05688 DUF824:  Salmonella repeat of unknown function (DUF824);  InterPro: IPR008542 This family consists of a series of repeated sequences (of around 180 residues) which are found in Salmonella typhimurium, Salmonella typhi and Escherichia coli. These repeats are almost always found with this entry. The repeats are associated with RatA and RatB, the coding sequences of which are found in the pathogeneicity island of Salmonella. The sequences may be determinants of pathogenicity [, ].
Probab=26.88  E-value=91  Score=21.05  Aligned_cols=33  Identities=21%  Similarity=0.213  Sum_probs=26.7

Q ss_pred             EeeeeeeeeeeecCCCCeeccceeeEecCceee
Q psy3908         129 IREAIKGIVAKYDEEGNLQSDGARIVNIGEVLL  161 (170)
Q Consensus       129 v~E~Ir~~~~~~~ed~~~~~~~~~Tl~aGe~L~  161 (170)
                      +=|.|...+.-.|-+|+.++...|||.-|+-..
T Consensus        11 ~Ge~I~ltVt~kda~G~pv~n~~f~l~r~~~~n   43 (47)
T PF05688_consen   11 VGETIPLTVTVKDANGNPVPNAPFTLTRGDAKN   43 (47)
T ss_pred             cCCeEEEEEEEECCCCCCcCCceEEEEecCccc
Confidence            457888877778889999988889999887654


No 12 
>TIGR02988 YaaA_near_RecF S4 domain protein YaaA. This small protein has a single S4 domain (pfam01479), as do bacterial ribosomal protein S4, some pseudouridine synthases, tyrosyl-tRNA synthetases. The S4 domain may bind RNA. Members of this protein family are found almost exclusively in the Firmicutes, and almost invariably just a few nucleotides upstream of the gene for the DNA replication and repair protein RecF. The few members of this family that are not near recF are found instead near dnaA and/or dnaN, the usual neighbors of recF, near the origin of replication. The conserved location suggests a possible role in replication in the Firmicutes lineage.
Probab=23.96  E-value=42  Score=22.07  Aligned_cols=21  Identities=19%  Similarity=0.352  Sum_probs=14.3

Q ss_pred             CCCeeccceeeEecCceeeec
Q psy3908         143 EGNLQSDGARIVNIGEVLLPK  163 (170)
Q Consensus       143 d~~~~~~~~~Tl~aGe~L~l~  163 (170)
                      ||.+....+..|.+||+|.+|
T Consensus        39 Ng~~~~~~~~~l~~Gd~v~i~   59 (59)
T TIGR02988        39 NGELENRRGKKLYPGDVIEIP   59 (59)
T ss_pred             CCEEccCCCCCCCCCCEEEeC
Confidence            334333446789999999875


No 13 
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]
Probab=23.81  E-value=98  Score=25.64  Aligned_cols=21  Identities=14%  Similarity=0.256  Sum_probs=18.6

Q ss_pred             CeeccceeeEecCceeeeccc
Q psy3908         145 NLQSDGARIVNIGEVLLPKSE  165 (170)
Q Consensus       145 ~~~~~~~~Tl~aGe~L~l~g~  165 (170)
                      .+.++++.+|++||.|+..|.
T Consensus       189 ~~~p~g~~~l~~gD~l~v~~~  209 (225)
T COG0569         189 LIIPRGDTTLEAGDRLIVIGA  209 (225)
T ss_pred             eecCCCCCEecCCCEEEEEEc
Confidence            477889999999999999885


No 14 
>PF13275 S4_2:  S4 domain; PDB: 1P9K_A.
Probab=23.11  E-value=52  Score=23.42  Aligned_cols=27  Identities=15%  Similarity=0.262  Sum_probs=14.6

Q ss_pred             cCCCCeeccceeeEecCceeeeccccc
Q psy3908         141 DEEGNLQSDGARIVNIGEVLLPKSEVT  167 (170)
Q Consensus       141 ~ed~~~~~~~~~Tl~aGe~L~l~g~~~  167 (170)
                      .=||++.....+-|++||++...|+.+
T Consensus        36 ~VNGe~e~rrg~Kl~~GD~V~~~~~~~   62 (65)
T PF13275_consen   36 KVNGEVETRRGKKLRPGDVVEIDGEEY   62 (65)
T ss_dssp             EETTB----SS----SSEEEEETTEEE
T ss_pred             EECCEEccccCCcCCCCCEEEECCEEE
Confidence            346777767789999999999987654


No 15 
>TIGR03432 yjhG_yagF probable dehydratase, YjhG/YagF family. This homolog of dihydroxy-acid dehydratases has an odd, sparse distribution. Members are found in two Acidobacteria, two Planctomycetes, Bacillus clausii KSM-K16, and (in two copies each) in strains K12-MG1655 and W3110 of Escherichia coli. The local context is not well conserved, but a few members are adjacent to homologs of the gluconate:H+ symporter (see TIGR00791).
Probab=21.67  E-value=65  Score=32.05  Aligned_cols=31  Identities=19%  Similarity=0.395  Sum_probs=20.5

Q ss_pred             cHHHHhh-hcCCCeeEEec-cCc--c------cccCccCCC
Q psy3908          20 YLREFVS-KNSLPTVVKII-KGQ--Y------GNLGVPTLP   50 (170)
Q Consensus        20 ~L~~~vs-k~rLP~vvri~-~Gq--y------~~lGvp~l~   50 (170)
                      .|++|-. .-+.|.++++- .|+  |      ...|+|.+-
T Consensus       323 tlddfd~is~~vP~L~~l~P~G~~~~~~~d~~~AGGvpaVm  363 (640)
T TIGR03432       323 TVDDWTRINRKVPRLVDALPNGPVGHPTVRVFLAGGVPEVM  363 (640)
T ss_pred             CHHHHHHHhcccCceEEeccCCCCCccHHHHHHccCHHHHH
Confidence            5677743 23789999996 455  2      355888665


No 16 
>TIGR00061 L21 ribosomal protein L21. Eubacterial and chloroplast.
Probab=21.62  E-value=90  Score=23.78  Aligned_cols=48  Identities=17%  Similarity=0.268  Sum_probs=36.7

Q ss_pred             hhcCCCeeEEeccCcccccCccCCCCCCcceeEeeeeccceeeeeeeehh
Q psy3908          26 SKNSLPTVVKIIKGQYGNLGVPTLPSPGLQSTVLLVSAGKRQKIIAQAVK   75 (170)
Q Consensus        26 sk~rLP~vvri~~Gqy~~lGvp~l~~~slq~~~Ll~sa~~r~~i~aqa~k   75 (170)
                      ++..|+.|.-+..|+...+|.|.|+  +....|-++.+.+-.+|++-=.+
T Consensus        30 ~~i~l~~VLlv~~~~~~~iG~P~l~--~a~V~a~V~~~~r~~Ki~vfK~k   77 (101)
T TIGR00061        30 DTVEFDKVLMVNKGGDVKIGKPYVE--GAKVVAEVEKHGRGKKVKVYKYR   77 (101)
T ss_pred             CEEEEEEEEEEecCCCeEECCeEcC--CCEEEEEEEeecCCCCEEEEEeC
Confidence            5567888888877888899999998  55667778888777777755443


No 17 
>PF06481 COX_ARM:  COX Aromatic Rich Motif;  InterPro: IPR010514 COX2 (Cytochrome O ubiquinol OXidase 2) is a major component of the respiratory complex during vegetative growth. It transfers electrons from a quinol to the binuclear centre of the catalytic subunit 1. The function of this region is not known.; GO: 0008827 cytochrome o ubiquinol oxidase activity, 0022900 electron transport chain, 0055114 oxidation-reduction process, 0016021 integral to membrane; PDB: 1CYX_A 1CYW_A 1FFT_G.
Probab=20.52  E-value=17  Score=23.78  Aligned_cols=17  Identities=12%  Similarity=0.192  Sum_probs=8.5

Q ss_pred             EEeccCC--ceeeeeehHH
Q psy3908         100 ELLSEEG--KSMRCCETVL  116 (170)
Q Consensus       100 ~LLsed~--~~vR~fesV~  116 (170)
                      .-|.+.+  .+|+||+||+
T Consensus        13 ~~La~PS~~~pv~yfssv~   31 (47)
T PF06481_consen   13 DELAKPSENNPVTYFSSVE   31 (47)
T ss_dssp             HHHCSS-SS--SEEES-B-
T ss_pred             HHHHCcCcCCCceeeccCC
Confidence            3344555  4999999986


Done!