Diaphorina citri psyllid: psy3908

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MATDGQILLATAKWSDEGQYLREFVSKNSLPTVVKIIKGQYGNLGVPTLPSPGLQSTVLLVSAGKRQKIIAQAVKLKEGRRFVGVGSRIDIPENYPGYFELLSEEGKSMRCCETVLEISRRKIEAGCLIREAIKGIVAKYDEEGNLQSDGARIVNIGEVLLPKSEVTLGE
ccccccEEEEEEEEccccccHHHHHHcccccEEEEEEcccccccccccccccccccEEEEEEcccEEEEEEEEEEEccccEEECcccEEECcccccCEEEEEccccccccccHHHHHHHHHccccEEEEEEEEEEEEEECcccccccccccEEEEcccEEEECccccccc
******ILLATAKWSDEGQYLREFVSKNSLPTVVKIIKGQYGNLGVPTLPSPGLQSTVLLVSAGKRQKIIAQAVKLKEGRRFVGVGSRIDIPENYPGYFELLSEEGKSMRCCETVLEISRRKIEAGCLIREAIKGIVAKYDEEGNLQSDGARIVNIGEVLLPKSEVTL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATDGQILLATAKWSDEGQYLREFVSKNSLPTVVKIIKGQYGNLGVPTLPSPGLQSTVLLVSAGKRQKIIAQAVKLKEGRRFVGVGSRIDIPENYPGYFELLSEEGKSMRCCETVLEISRRKIEAGCLIREAIKGIVAKYDEEGNLQSDGARIVNIGEVLLPKSEVTLGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045179 [CC]apical cortexprobableGO:0005737, GO:0045177, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0042067 [BP]establishment of ommatidial planar polarityprobableGO:0032502, GO:0007163, GO:0007164, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0001745, GO:0048513, GO:0048729, GO:0032501, GO:0048749, GO:0009887, GO:0009987, GO:0048592, GO:0060429, GO:0009888, GO:0044767, GO:0001738, GO:0008150, GO:0048731, GO:0001736, GO:0044707, GO:0007423, GO:0048856, GO:0044763, GO:0001654

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted