Diaphorina citri psyllid: psy3929


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MITPYIIRLVKEEEDEEENERKRRRRRRRSWALVYREGHLVSGTLDALIQHIVPTIDYYPDRAYLFAFLLSSRLFIKPHELLGRVIALCDVQQKLTDKTPHGKKELIRKYKYNLKFFLLF
ccHHHHHHHHccccHHHHHHHHHHHHHcccccEEEEcccccEEcHHHHHHHHcccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcc
***P*************************SWALVYREGHLVSGTLDALIQHIVPTIDYYPDRAYLFAFLLSSRLFIKPHELLGRVIALCDVQQKLTDKTPHGKKELIRKYKYNLKFFLLF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITPYIxxxxxxxxxxxxxxxxxxxxxRRSWALVYREGHLVSGTLDALIQHIVPTIDYYPDRAYLFAFLLSSRLFIKPHELLGRVIALCDVQQKLTDKTPHGKKELIRKYKYNLKFFLLF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-GEF domain-containing family member 1B Guanine nucleotide exchange factor (GEF) with specificity for RAP2A and other Ras family proteins (in vitro).confidentQ8JZL7
Ras-GEF domain-containing family member 1B Guanine nucleotide exchange factor (GEF) with specificity for rap2a and other Ras family proteins (in vitro).confidentQ28EC1
Ras-GEF domain-containing family member 1B-A Guanine nucleotide exchange factor (GEF) for Ras family proteins (in vitro).confidentQ6DHR3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005088 [MF]Ras guanyl-nucleotide exchange factor activityprobableGO:0005083, GO:0005085, GO:0030695, GO:0003674, GO:0060589, GO:0030234
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2II0, chain A
Confidence level:confident
Coverage over the Query: 28-91
View the alignment between query and template
View the model in PyMOL