Diaphorina citri psyllid: psy3940


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MYERGDASPRDIDTAMKLGAGYPMGPFELADYVGHDTTKFIIDGWHKKFPENPLFKPVDALNKLVDEGKLGVKSGEGFYNYKK
ccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccccccc
**ERGDASPRDIDTAMKLGAGYPMGPFELADYVGHDTTKFIIDGWHKKFPENPLFKPVDALNKLVDEGKLGVKSGEGFYNYK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYERGDASPRDIDTAMKLGAGYPMGPFELADYVGHDTTKFIIDGWHKKFPENPLFKPVDALNKLVDEGKLGVKSGEGFYNYKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial Plays an essential role in the mitochondrial beta-oxidation of short chain fatty acids. Exerts it highest activity toward 3-hydroxybutyryl-CoA.confidentQ16836
Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial Plays an essential role in the mitochondrial beta-oxidation of short chain fatty acids. Exerts it highest activity toward 3-hydroxybutyryl-CoA.confidentQ61425
Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial Plays an essential role in the mitochondrial beta-oxidation of short chain fatty acids. Exerts it highest activity toward 3-hydroxybutyryl-CoA.confidentQ9WVK7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044446 [CC]intracellular organelle partconfidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0014823 [BP]response to activityprobableGO:0050896, GO:0008150
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0003857 [MF]3-hydroxyacyl-CoA dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0046676 [BP]negative regulation of insulin secretionprobableGO:0090087, GO:0051046, GO:0051048, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0065007, GO:0048519, GO:0051051, GO:0050796, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0046888, GO:0032879, GO:0090278, GO:0002791, GO:0002792, GO:0048523
GO:0006635 [BP]fatty acid beta-oxidationprobableGO:0034440, GO:0006631, GO:0019752, GO:0044248, GO:0009062, GO:0044281, GO:0044282, GO:0044242, GO:0044712, GO:1901575, GO:0030258, GO:0016042, GO:0071704, GO:0006629, GO:0009987, GO:0044710, GO:0032787, GO:0008150, GO:0008152, GO:0072329, GO:0043436, GO:0019395, GO:0044255, GO:0009056, GO:0055114, GO:0044238, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0032868 [BP]response to insulin stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0043434, GO:0010033
GO:0070403 [MF]NAD+ bindingprobableGO:0043168, GO:0050662, GO:0051287, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0097159, GO:0003674, GO:0043167, GO:1901363, GO:1901265

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F0Y, chain A
Confidence level:very confident
Coverage over the Query: 1-82
View the alignment between query and template
View the model in PyMOL