Query         psy3948
Match_columns 143
No_of_seqs    105 out of 2275
Neff          10.7
Searched_HMMs 46136
Date          Fri Aug 16 21:27:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3948.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3948hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9   5E-27 1.1E-31  154.6   5.5  119    4-122   127-265 (279)
  2 KOG2462|consensus               99.9 8.2E-26 1.8E-30  148.9   5.5  105   29-135   132-250 (279)
  3 KOG3608|consensus               99.6 2.1E-15 4.6E-20  103.1   4.0  139    2-141   202-365 (467)
  4 KOG3576|consensus               99.5 1.1E-15 2.3E-20   97.4   1.1   82   44-125   117-198 (267)
  5 KOG3576|consensus               99.5 6.2E-15 1.3E-19   93.9   2.7  116    5-129   115-241 (267)
  6 KOG3623|consensus               99.5 3.7E-15   8E-20  109.9   0.8   80   42-121   892-971 (1007)
  7 KOG3623|consensus               99.5 4.1E-15 8.8E-20  109.7   0.9  109    6-122   209-331 (1007)
  8 KOG1074|consensus               99.5 1.1E-14 2.3E-19  108.8   2.4   59   72-130   605-663 (958)
  9 KOG3608|consensus               99.3 2.8E-12   6E-17   88.1   5.6  124    4-128   234-380 (467)
 10 KOG1074|consensus               99.2 7.1E-12 1.5E-16   94.1   4.0   60   73-132   880-939 (958)
 11 PLN03086 PRLI-interacting fact  99.2 8.9E-11 1.9E-15   86.4   7.8  126    8-139   408-553 (567)
 12 PHA00733 hypothetical protein   99.2   3E-11 6.4E-16   73.6   3.7   82   42-125    38-124 (128)
 13 PHA02768 hypothetical protein;  99.0 1.5E-10 3.3E-15   59.1   1.8   44   72-117     5-48  (55)
 14 PLN03086 PRLI-interacting fact  99.0 2.2E-09 4.8E-14   79.3   7.1  110    9-124   435-564 (567)
 15 PF13465 zf-H2C2_2:  Zinc-finge  98.9 8.1E-10 1.7E-14   48.5   2.5   26   87-112     1-26  (26)
 16 PHA00616 hypothetical protein   98.9 1.3E-09 2.8E-14   53.1   2.0   33  100-132     1-33  (44)
 17 PHA02768 hypothetical protein;  98.6 1.5E-08 3.4E-13   51.8   1.4   42   45-88      6-47  (55)
 18 PHA00733 hypothetical protein   98.6 8.6E-08 1.9E-12   58.5   4.8   84    5-96     38-123 (128)
 19 PF00096 zf-C2H2:  Zinc finger,  98.3 8.8E-07 1.9E-11   37.5   2.4   23  101-123     1-23  (23)
 20 PHA00616 hypothetical protein   98.2 6.2E-07 1.3E-11   43.8   1.5   33   72-104     1-33  (44)
 21 PF13465 zf-H2C2_2:  Zinc-finge  98.2 4.8E-07   1E-11   39.5   1.0   25   59-83      1-25  (26)
 22 PHA00732 hypothetical protein   98.2 1.4E-06 3.1E-11   48.5   2.2   42   73-120     2-44  (79)
 23 KOG3993|consensus               98.2 5.7E-07 1.2E-11   63.7   0.8  120    7-126   295-484 (500)
 24 KOG3993|consensus               98.1   8E-07 1.7E-11   63.0   0.8   85   44-128   295-384 (500)
 25 PF05605 zf-Di19:  Drought indu  98.0 1.8E-05 3.8E-10   40.9   4.6   50   73-125     3-54  (54)
 26 PF13894 zf-C2H2_4:  C2H2-type   98.0 6.4E-06 1.4E-10   34.9   2.4   24  101-124     1-24  (24)
 27 PF13912 zf-C2H2_6:  C2H2-type   98.0   3E-06 6.4E-11   37.3   1.1   26  100-125     1-26  (27)
 28 PF09237 GAGA:  GAGA factor;  I  97.7 5.8E-05 1.3E-09   37.7   2.9   33   96-128    20-52  (54)
 29 PHA00732 hypothetical protein   97.6 4.5E-05 9.8E-10   42.5   2.4   46   44-95      1-47  (79)
 30 PF13909 zf-H2C2_5:  C2H2-type   97.5 0.00016 3.5E-09   30.7   2.6   24  101-125     1-24  (24)
 31 smart00355 ZnF_C2H2 zinc finge  97.4 0.00013 2.7E-09   31.2   2.0   24  101-124     1-24  (26)
 32 PF00096 zf-C2H2:  Zinc finger,  97.4 8.9E-05 1.9E-09   31.1   1.1   20   46-65      2-21  (23)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.3 0.00019 4.1E-09   41.6   2.6   78   46-128     1-79  (100)
 34 PF05605 zf-Di19:  Drought indu  97.1 0.00099 2.2E-08   34.3   3.5   48   45-95      3-52  (54)
 35 PF13912 zf-C2H2_6:  C2H2-type   96.9 0.00049 1.1E-08   30.0   1.3   23   45-67      2-24  (27)
 36 PF12874 zf-met:  Zinc-finger o  96.9  0.0006 1.3E-08   29.1   1.4   23  101-123     1-23  (25)
 37 COG5189 SFP1 Putative transcri  96.9 0.00027 5.8E-09   48.9   0.4   52   70-121   347-419 (423)
 38 PRK04860 hypothetical protein;  96.9 0.00076 1.7E-08   42.7   2.1   37   72-112   119-155 (160)
 39 PF13894 zf-C2H2_4:  C2H2-type   96.7  0.0017 3.6E-08   27.1   2.0   21   74-94      2-22  (24)
 40 COG5189 SFP1 Putative transcri  96.5  0.0015 3.2E-08   45.4   1.9   19    4-22    346-366 (423)
 41 PF12171 zf-C2H2_jaz:  Zinc-fin  96.3 0.00066 1.4E-08   29.7  -0.7   22  101-122     2-23  (27)
 42 smart00355 ZnF_C2H2 zinc finge  96.2  0.0075 1.6E-07   25.3   2.7   22   74-95      2-23  (26)
 43 PF13913 zf-C2HC_2:  zinc-finge  95.9  0.0078 1.7E-07   25.8   1.9   21  101-122     3-23  (25)
 44 COG4049 Uncharacterized protei  95.6    0.01 2.2E-07   30.3   1.7   32   95-126    12-43  (65)
 45 PF09237 GAGA:  GAGA factor;  I  95.4   0.019 4.2E-07   28.9   2.4   33   68-100    20-52  (54)
 46 PRK04860 hypothetical protein;  95.4   0.017 3.7E-07   36.7   2.7   36  100-139   119-155 (160)
 47 smart00451 ZnF_U1 U1-like zinc  95.1   0.018 3.9E-07   26.5   1.7   22  100-121     3-24  (35)
 48 PF12756 zf-C2H2_2:  C2H2 type   94.4    0.04 8.8E-07   31.6   2.4   24   72-95     50-73  (100)
 49 COG5048 FOG: Zn-finger [Genera  92.6   0.021 4.6E-07   41.4  -1.1   62   71-132   288-355 (467)
 50 COG2888 Predicted Zn-ribbon RN  91.6    0.22 4.7E-06   25.9   2.3    9   99-107    49-57  (61)
 51 PF07754 DUF1610:  Domain of un  91.4    0.24 5.1E-06   20.9   1.9   10   42-51     14-23  (24)
 52 PF13717 zinc_ribbon_4:  zinc-r  90.6     0.2 4.4E-06   23.3   1.5   11   44-54     25-35  (36)
 53 TIGR00622 ssl1 transcription f  90.6     0.6 1.3E-05   27.8   3.7   87    6-95     14-104 (112)
 54 PF02892 zf-BED:  BED zinc fing  89.9    0.44 9.6E-06   23.1   2.5   28   97-124    13-44  (45)
 55 PF13719 zinc_ribbon_5:  zinc-r  88.8     0.3 6.4E-06   22.9   1.3   10   45-54     26-35  (37)
 56 COG1198 PriA Primosomal protei  88.7    0.46   1E-05   37.5   2.9   10   71-80    474-483 (730)
 57 PF15135 UPF0515:  Uncharacteri  88.5     0.3 6.5E-06   33.1   1.6   55    4-58    109-169 (278)
 58 PF09538 FYDLN_acid:  Protein o  88.1    0.39 8.6E-06   28.5   1.8   28   30-57     12-39  (108)
 59 smart00614 ZnF_BED BED zinc fi  87.7    0.69 1.5E-05   23.2   2.3   23  101-123    19-46  (50)
 60 PRK14890 putative Zn-ribbon RN  86.2    0.84 1.8E-05   23.8   2.1   11   43-53     24-34  (59)
 61 cd00350 rubredoxin_like Rubred  86.1    0.42   9E-06   21.8   0.9    9   45-53      2-10  (33)
 62 KOG1146|consensus               86.1    0.31 6.8E-06   40.5   0.8   23   99-121   517-539 (1406)
 63 PF10571 UPF0547:  Uncharacteri  85.7    0.75 1.6E-05   19.8   1.6    8   47-54     17-24  (26)
 64 smart00834 CxxC_CXXC_SSSS Puta  85.0    0.16 3.5E-06   24.2  -0.8   15    7-21      5-19  (41)
 65 TIGR02098 MJ0042_CXXC MJ0042 f  85.0    0.59 1.3E-05   21.8   1.2   10    8-17      3-12  (38)
 66 PF09723 Zn-ribbon_8:  Zinc rib  84.9    0.13 2.9E-06   24.9  -1.1   15    8-22      6-20  (42)
 67 COG5048 FOG: Zn-finger [Genera  84.5    0.32   7E-06   35.2   0.2   62   43-104   288-355 (467)
 68 PF09845 DUF2072:  Zn-ribbon co  83.8    0.62 1.3E-05   28.5   1.1   27    7-35      1-27  (131)
 69 KOG2186|consensus               83.3    0.72 1.6E-05   31.5   1.4   38   45-84      4-41  (276)
 70 KOG1146|consensus               83.1    0.86 1.9E-05   38.1   2.0   65    1-66    459-540 (1406)
 71 TIGR02605 CxxC_CxxC_SSSS putat  83.0    0.21 4.6E-06   25.2  -0.9   15    7-21      5-19  (52)
 72 PF12013 DUF3505:  Protein of u  83.0     1.3 2.7E-05   26.2   2.3   25  101-125    81-109 (109)
 73 PRK00398 rpoP DNA-directed RNA  82.6    0.87 1.9E-05   22.4   1.2   11    7-17      3-13  (46)
 74 KOG2893|consensus               81.8    0.46   1E-05   32.1   0.1   21   43-63     33-53  (341)
 75 KOG2231|consensus               81.8       2 4.3E-05   33.7   3.3   93   29-125   101-207 (669)
 76 smart00659 RPOLCX RNA polymera  81.6    0.91   2E-05   22.2   1.1   13   44-56     19-31  (44)
 77 PRK06266 transcription initiat  81.5    0.64 1.4E-05   30.2   0.6   10   45-54    137-146 (178)
 78 TIGR02300 FYDLN_acid conserved  81.0     1.3 2.9E-05   26.9   1.8   28   30-57     12-39  (129)
 79 PF15269 zf-C2H2_7:  Zinc-finge  80.5     1.5 3.2E-05   21.5   1.5   28  101-128    21-48  (54)
 80 PF04959 ARS2:  Arsenite-resist  80.0     1.2 2.5E-05   29.9   1.5   30   98-127    75-104 (214)
 81 COG1592 Rubrerythrin [Energy p  79.6       1 2.3E-05   28.8   1.1   24   72-108   134-157 (166)
 82 smart00531 TFIIE Transcription  79.5     1.4 3.1E-05   27.6   1.7   35   44-82     99-133 (147)
 83 smart00734 ZnF_Rad18 Rad18-lik  79.4     2.1 4.6E-05   18.3   1.7   19  102-121     3-21  (26)
 84 PF06524 NOA36:  NOA36 protein;  79.3    0.74 1.6E-05   31.5   0.4   94   29-124   127-233 (314)
 85 PF08274 PhnA_Zn_Ribbon:  PhnA   78.9    0.71 1.5E-05   20.6   0.2   23   30-52      5-27  (30)
 86 KOG2186|consensus               78.5     1.1 2.4E-05   30.6   1.0   54   73-129     4-57  (276)
 87 PF05443 ROS_MUCR:  ROS/MUCR tr  78.1     1.8 3.9E-05   26.7   1.8   27   99-128    71-97  (132)
 88 PF15616 TerY-C:  TerY-C metal   78.0     1.3 2.9E-05   27.2   1.2   15   39-53    100-114 (131)
 89 PF09986 DUF2225:  Uncharacteri  77.6     1.3 2.9E-05   29.6   1.2   14   45-58      6-19  (214)
 90 TIGR00686 phnA alkylphosphonat  77.5     1.5 3.3E-05   25.8   1.3   29   29-57      4-32  (109)
 91 PF03604 DNA_RNApol_7kD:  DNA d  77.2     1.2 2.5E-05   20.2   0.6   10   45-54     18-27  (32)
 92 PRK10220 hypothetical protein;  76.9     2.2 4.8E-05   25.2   1.8   30   29-58      5-34  (111)
 93 PRK09678 DNA-binding transcrip  76.2     0.9 1.9E-05   24.8   0.1   17   97-113    24-42  (72)
 94 PF08790 zf-LYAR:  LYAR-type C2  75.7    0.67 1.5E-05   20.3  -0.4   20  101-121     1-20  (28)
 95 COG1198 PriA Primosomal protei  74.7     2.5 5.3E-05   33.7   2.2   29   66-109   456-484 (730)
 96 PRK00464 nrdR transcriptional   72.1    0.82 1.8E-05   29.0  -0.8   13   73-85     29-41  (154)
 97 PHA00626 hypothetical protein   71.7     2.4 5.3E-05   21.8   1.0   16   98-113    21-36  (59)
 98 PF10083 DUF2321:  Uncharacteri  71.6     3.1 6.6E-05   26.3   1.7   17   71-87     67-83  (158)
 99 PF14353 CpXC:  CpXC protein     70.5     3.3 7.2E-05   25.1   1.7   11    9-19      3-13  (128)
100 TIGR00595 priA primosomal prot  69.1     5.1 0.00011   30.5   2.7    6   74-79    255-260 (505)
101 PRK04023 DNA polymerase II lar  68.4       6 0.00013   32.7   3.0    9   45-53    639-647 (1121)
102 PF02176 zf-TRAF:  TRAF-type zi  68.0       4 8.7E-05   21.0   1.5   25   87-111    25-53  (60)
103 COG3364 Zn-ribbon containing p  67.4     2.9 6.3E-05   24.4   0.9   27    7-35      2-28  (112)
104 TIGR00373 conserved hypothetic  67.3     5.9 0.00013   25.2   2.4   32   70-110   107-138 (158)
105 COG5151 SSL1 RNA polymerase II  66.9     6.7 0.00015   27.8   2.7   25   71-95    387-411 (421)
106 PF07975 C1_4:  TFIIH C1-like d  65.6     1.7 3.7E-05   22.0  -0.3   24   43-66     20-43  (51)
107 PF05290 Baculo_IE-1:  Baculovi  64.5       3 6.6E-05   25.6   0.6   56   43-115    79-136 (140)
108 smart00154 ZnF_AN1 AN1-like Zi  64.4     2.4 5.3E-05   20.1   0.2   14    7-20     12-25  (39)
109 PF08209 Sgf11:  Sgf11 (transcr  63.5     8.2 0.00018   17.6   1.8   23  100-123     4-26  (33)
110 COG5236 Uncharacterized conser  63.4     2.6 5.6E-05   30.3   0.2   23  102-124   222-244 (493)
111 PRK03681 hypA hydrogenase nick  62.7     4.8  0.0001   24.1   1.3    6   46-51     89-94  (114)
112 PRK14873 primosome assembly pr  62.5     6.9 0.00015   31.0   2.3   10   72-81    422-431 (665)
113 PRK00420 hypothetical protein;  62.0     7.4 0.00016   23.3   1.9   27   29-55     25-51  (112)
114 KOG2593|consensus               61.3     6.9 0.00015   29.0   2.0   19    4-22    125-143 (436)
115 KOG3408|consensus               60.9     6.8 0.00015   23.7   1.6   22  100-121    57-78  (129)
116 cd00729 rubredoxin_SM Rubredox  60.0     5.4 0.00012   18.2   0.9    9   45-53      3-11  (34)
117 PF08271 TF_Zn_Ribbon:  TFIIB z  59.9     1.1 2.5E-05   21.6  -1.5   10   45-54     20-29  (43)
118 PF12907 zf-met2:  Zinc-binding  59.8     5.5 0.00012   19.1   0.9   27  101-127     2-31  (40)
119 PRK00432 30S ribosomal protein  59.3     8.8 0.00019   19.3   1.7    7   73-79     38-44  (50)
120 PF12773 DZR:  Double zinc ribb  58.8     7.7 0.00017   19.1   1.4    6   47-52     15-20  (50)
121 PF04780 DUF629:  Protein of un  58.8     9.2  0.0002   28.9   2.3   26  100-125    57-82  (466)
122 PRK00564 hypA hydrogenase nick  58.1     6.7 0.00015   23.6   1.3   10   45-54     72-81  (117)
123 COG5236 Uncharacterized conser  58.0      19 0.00042   26.1   3.7   75   46-125   222-306 (493)
124 COG4530 Uncharacterized protei  57.7     6.9 0.00015   23.2   1.3   26   30-55     12-37  (129)
125 PRK05580 primosome assembly pr  57.6      11 0.00023   30.0   2.7    6   74-79    423-428 (679)
126 KOG0978|consensus               57.5     1.6 3.4E-05   34.4  -1.8   12   74-85    680-691 (698)
127 KOG2785|consensus               56.6      13 0.00028   27.2   2.7   27   97-123    65-91  (390)
128 TIGR01206 lysW lysine biosynth  56.6     1.9 4.1E-05   22.2  -1.0   10    8-17      3-12  (54)
129 smart00440 ZnF_C2C2 C2C2 Zinc   55.6     1.2 2.7E-05   21.2  -1.7   11  100-110    28-38  (40)
130 PRK11823 DNA repair protein Ra  55.6     6.7 0.00015   29.4   1.2   32    1-38      1-32  (446)
131 KOG2907|consensus               55.4     6.5 0.00014   23.4   0.9   39   72-112    74-114 (116)
132 PF13240 zinc_ribbon_2:  zinc-r  55.4      11 0.00024   15.5   1.4    6   47-52     16-21  (23)
133 PF10276 zf-CHCC:  Zinc-finger   52.1     4.6 9.9E-05   19.3  -0.1   11    7-17     29-39  (40)
134 PTZ00255 60S ribosomal protein  51.6     8.1 0.00018   22.1   0.9   32   72-113    36-67  (90)
135 PRK12496 hypothetical protein;  51.1      12 0.00025   24.1   1.6    8   30-37    130-137 (164)
136 COG1773 Rubredoxin [Energy pro  50.8     8.2 0.00018   19.9   0.7   12  100-111     3-14  (55)
137 PRK03824 hypA hydrogenase nick  49.8     8.9 0.00019   23.7   0.9   15   43-57     69-83  (135)
138 PF01363 FYVE:  FYVE zinc finge  49.5     8.9 0.00019   20.3   0.8   27   30-57     12-38  (69)
139 PF13248 zf-ribbon_3:  zinc-rib  49.3      14 0.00031   15.5   1.3    6   47-52     19-24  (26)
140 KOG4167|consensus               49.1     6.8 0.00015   31.2   0.4   28  100-127   792-819 (907)
141 cd00924 Cyt_c_Oxidase_Vb Cytoc  49.0      11 0.00023   22.0   1.1   18   94-112    74-91  (97)
142 PLN03238 probable histone acet  49.0      19 0.00041   25.4   2.5   28   98-125    46-73  (290)
143 COG0068 HypF Hydrogenase matur  48.6       3 6.5E-05   32.9  -1.5   76   29-111   103-184 (750)
144 COG4957 Predicted transcriptio  47.8      11 0.00024   23.3   1.1   25  101-128    77-101 (148)
145 PLN02294 cytochrome c oxidase   47.3      11 0.00024   24.3   1.1   16   98-113   139-154 (174)
146 PF01428 zf-AN1:  AN1-like Zinc  47.3     8.8 0.00019   18.5   0.5   15   99-113    12-26  (43)
147 PF04216 FdhE:  Protein involve  47.0     4.1 8.9E-05   28.6  -0.9   69   29-112   174-250 (290)
148 KOG2785|consensus               46.9      41 0.00089   24.7   3.9   59   71-129   165-250 (390)
149 PRK03564 formate dehydrogenase  46.4      14  0.0003   26.4   1.6   14   99-112   251-264 (309)
150 PF07282 OrfB_Zn_ribbon:  Putat  45.9      17 0.00037   19.2   1.6    7   73-79     47-53  (69)
151 PRK12380 hydrogenase nickel in  45.9      12 0.00025   22.4   1.0    8   45-52     71-78  (113)
152 KOG2893|consensus               45.5     6.6 0.00014   26.8  -0.1   41   47-91     13-53  (341)
153 TIGR00416 sms DNA repair prote  44.8      12 0.00026   28.2   1.1   30    3-38      3-32  (454)
154 PF13878 zf-C2H2_3:  zinc-finge  44.7      31 0.00068   16.4   2.2   10  102-111    15-24  (41)
155 COG5112 UFD2 U1-like Zn-finger  44.1      16 0.00034   21.6   1.3   22  100-121    55-76  (126)
156 PF06397 Desulfoferrod_N:  Desu  43.2     8.5 0.00018   18.0   0.1   12    6-17      5-16  (36)
157 PF12760 Zn_Tnp_IS1595:  Transp  43.1      17 0.00038   17.6   1.2   11   98-108    35-45  (46)
158 TIGR00100 hypA hydrogenase nic  42.9      15 0.00032   22.0   1.1   11   45-55     71-81  (115)
159 cd00065 FYVE FYVE domain; Zinc  42.6      21 0.00046   17.9   1.6   11   45-55     19-29  (57)
160 PF01155 HypA:  Hydrogenase exp  42.4     3.9 8.4E-05   24.4  -1.4   11   45-55     71-81  (113)
161 KOG1842|consensus               42.1      16 0.00035   27.4   1.4   24  101-124    16-39  (505)
162 KOG1280|consensus               41.9      22 0.00047   25.8   1.9   32   98-129    77-108 (381)
163 PF14369 zf-RING_3:  zinc-finge  41.8     9.4  0.0002   17.6   0.1   10    9-18     23-32  (35)
164 COG4888 Uncharacterized Zn rib  41.5     4.5 9.9E-05   23.6  -1.1   13    5-17     20-32  (104)
165 PF13451 zf-trcl:  Probable zin  41.4      12 0.00026   18.8   0.5   18    5-22      2-19  (49)
166 PF00301 Rubredoxin:  Rubredoxi  41.4      14 0.00031   18.3   0.7   12  101-112     2-13  (47)
167 PF14446 Prok-RING_1:  Prokaryo  41.4      26 0.00056   18.0   1.7    6   46-51     23-28  (54)
168 PF01286 XPA_N:  XPA protein N-  41.4      12 0.00026   17.2   0.4   12  102-113     5-16  (34)
169 KOG2482|consensus               41.2      18 0.00039   26.2   1.5   23  100-122   195-217 (423)
170 KOG2231|consensus               40.9      75  0.0016   25.5   4.8   22   46-67    184-205 (669)
171 KOG2272|consensus               40.9      21 0.00047   24.6   1.7   15    8-22    164-178 (332)
172 COG1997 RPL43A Ribosomal prote  40.8      23  0.0005   20.2   1.6   28   29-56     37-65  (89)
173 smart00661 RPOL9 RNA polymeras  40.8      32 0.00069   16.9   2.1   12   44-55     20-31  (52)
174 PF10013 DUF2256:  Uncharacteri  40.3      12 0.00026   18.1   0.4   16  102-117    10-25  (42)
175 COG1996 RPC10 DNA-directed RNA  40.1      16 0.00034   18.4   0.8   11    7-17      6-16  (49)
176 COG3677 Transposase and inacti  39.9      14 0.00029   22.7   0.7   17   97-113    50-66  (129)
177 COG2331 Uncharacterized protei  39.8     4.4 9.4E-05   22.3  -1.3   31    7-37     12-43  (82)
178 cd00730 rubredoxin Rubredoxin;  38.0      14  0.0003   18.6   0.4   12  101-112     2-13  (50)
179 smart00064 FYVE Protein presen  37.8      26 0.00056   18.4   1.5   11   45-55     27-37  (68)
180 PF05191 ADK_lid:  Adenylate ki  36.0      18 0.00039   16.8   0.6   12  101-112     2-13  (36)
181 PF14255 Cys_rich_CPXG:  Cystei  35.7     5.6 0.00012   20.3  -1.2   14    9-22      2-15  (52)
182 PF08792 A2L_zn_ribbon:  A2L zi  34.6      30 0.00066   15.7   1.2   10   45-54     22-31  (33)
183 COG1066 Sms Predicted ATP-depe  34.5      23 0.00049   26.6   1.2   31    2-38      2-32  (456)
184 PLN00104 MYST -like histone ac  34.1      29 0.00063   26.2   1.7   27   98-124   196-222 (450)
185 PF14803 Nudix_N_2:  Nudix N-te  33.6      25 0.00053   16.1   0.8    7   45-51     23-29  (34)
186 PTZ00064 histone acetyltransfe  33.6      34 0.00075   26.2   2.0   27   99-125   279-305 (552)
187 COG3024 Uncharacterized protei  33.5      24 0.00051   18.8   0.8   10    7-16      7-16  (65)
188 PF02748 PyrI_C:  Aspartate car  33.4      15 0.00032   18.7   0.1   15    4-18     32-46  (52)
189 PRK00762 hypA hydrogenase nick  33.0      27 0.00059   21.2   1.2   10   45-55     71-80  (124)
190 COG3091 SprT Zn-dependent meta  32.4      25 0.00054   22.3   1.0   10  100-110   117-126 (156)
191 PF02591 DUF164:  Putative zinc  32.2      34 0.00073   17.4   1.3    7   73-79     47-53  (56)
192 PF13453 zf-TFIIB:  Transcripti  32.0      45 0.00098   15.7   1.7   20   99-118    18-37  (41)
193 KOG2807|consensus               31.8      65  0.0014   23.3   3.0   27   99-125   344-370 (378)
194 PLN03239 histone acetyltransfe  31.5      38 0.00082   24.7   1.8   25   98-122   104-128 (351)
195 COG1327 Predicted transcriptio  31.5      15 0.00033   23.2  -0.1    9    9-17      2-10  (156)
196 cd00974 DSRD Desulforedoxin (D  31.0      20 0.00044   16.1   0.3   10    7-16      4-13  (34)
197 TIGR00319 desulf_FeS4 desulfof  29.9      29 0.00063   15.5   0.8    9   45-53      8-16  (34)
198 KOG2636|consensus               29.8      40 0.00087   25.4   1.8   29   93-121   394-423 (497)
199 COG4306 Uncharacterized protei  29.5      44 0.00096   20.4   1.7   10   46-55     70-79  (160)
200 COG4391 Uncharacterized protei  29.3      24 0.00052   18.6   0.5    9    9-17     50-58  (62)
201 PF14787 zf-CCHC_5:  GAG-polypr  29.2      18 0.00039   16.9  -0.0   15    8-22      3-17  (36)
202 KOG1994|consensus               29.0      33 0.00072   23.3   1.2   21   99-119   238-258 (268)
203 PF14354 Lar_restr_allev:  Rest  28.8      28  0.0006   17.9   0.7    9    7-15      3-11  (61)
204 PF09788 Tmemb_55A:  Transmembr  28.7      16 0.00036   25.1  -0.3   29    8-36    158-186 (256)
205 PF01215 COX5B:  Cytochrome c o  28.1      30 0.00066   21.5   0.8   19   94-113   107-125 (136)
206 PF11672 DUF3268:  Protein of u  27.6      28 0.00061   20.5   0.6   10   44-53      2-11  (102)
207 COG1571 Predicted DNA-binding   27.6      45 0.00097   25.0   1.7   28   30-57    353-380 (421)
208 KOG4684|consensus               27.6      28 0.00062   23.4   0.7   29    8-37    171-199 (275)
209 TIGR01562 FdhE formate dehydro  26.6      58  0.0013   23.3   2.1   14   99-112   251-264 (305)
210 COG1326 Uncharacterized archae  26.4      81  0.0018   21.0   2.5   12   99-110    29-40  (201)
211 PHA02998 RNA polymerase subuni  26.4      12 0.00025   24.4  -1.2   12  100-111   171-182 (195)
212 KOG0717|consensus               26.2      48   0.001   25.2   1.7   21  101-121   293-313 (508)
213 PF06677 Auto_anti-p27:  Sjogre  25.8      49  0.0011   15.9   1.2   22   29-50     19-40  (41)
214 PF04423 Rad50_zn_hook:  Rad50   25.6      72  0.0016   16.0   1.9   12  102-113    22-33  (54)
215 KOG2071|consensus               25.2      53  0.0011   25.7   1.8   28   97-124   415-442 (579)
216 KOG4118|consensus               25.0      35 0.00076   18.2   0.6   30  100-129    38-67  (74)
217 PF02318 FYVE_2:  FYVE-type zin  25.0      18  0.0004   21.7  -0.5   12   97-108    91-102 (118)
218 KOG4167|consensus               24.9      14  0.0003   29.6  -1.2   25   44-68    792-816 (907)
219 PF05129 Elf1:  Transcription e  24.4      33 0.00073   19.2   0.5   10    5-14     20-29  (81)
220 PF09332 Mcm10:  Mcm10 replicat  24.1      13 0.00027   27.0  -1.5   17    6-22    251-267 (344)
221 KOG4173|consensus               23.6      40 0.00086   22.7   0.8   77   45-124    80-170 (253)
222 cd01121 Sms Sms (bacterial rad  23.6      36 0.00077   25.0   0.6   25    8-38      1-25  (372)
223 COG1439 Predicted nucleic acid  23.3      45 0.00098   21.8   1.0   22   29-53    141-162 (177)
224 KOG1701|consensus               23.3      15 0.00032   27.4  -1.3   12  100-111   427-438 (468)
225 COG1594 RPB9 DNA-directed RNA   23.2      21 0.00046   21.3  -0.5   12  100-111   100-111 (113)
226 COG5188 PRP9 Splicing factor 3  23.0      63  0.0014   23.7   1.7   28   93-120   367-395 (470)
227 COG1645 Uncharacterized Zn-fin  22.7      63  0.0014   20.0   1.5   25   29-54     30-54  (131)
228 PTZ00043 cytochrome c oxidase   22.3      46   0.001   22.7   0.9   16   98-113   179-194 (268)
229 COG2824 PhnA Uncharacterized Z  22.3      51  0.0011   19.6   1.0   26   30-55      6-31  (112)
230 PRK14559 putative protein seri  21.8      67  0.0014   25.7   1.8   11   47-57     44-54  (645)
231 PF06827 zf-FPG_IleRS:  Zinc fi  21.8      11 0.00024   16.4  -1.4    9    9-17      3-11  (30)
232 PF03833 PolC_DP2:  DNA polymer  20.7      33 0.00071   28.1   0.0    9    8-16    656-664 (900)
233 PTZ00303 phosphatidylinositol   20.7      49  0.0011   27.1   0.9   29    8-37    461-491 (1374)
234 PHA02942 putative transposase;  20.5      92   0.002   23.1   2.2   10   72-81    342-351 (383)
235 PRK12722 transcriptional activ  20.4      73  0.0016   21.0   1.5   10   29-38    136-145 (187)
236 PF01096 TFIIS_C:  Transcriptio  20.3      53  0.0012   15.4   0.7   10  101-110    29-38  (39)
237 COG1675 TFA1 Transcription ini  20.0 1.2E+02  0.0025   19.9   2.4   32   69-109   110-141 (176)

No 1  
>KOG2462|consensus
Probab=99.94  E-value=5e-27  Score=154.61  Aligned_cols=119  Identities=25%  Similarity=0.462  Sum_probs=69.9

Q ss_pred             CCccccCCcchhhhccchh---hHHHhh--------hcccCCCCCC---------CCCCcceeccCCCCccCCcchHHHh
Q psy3948           4 DHTILKCTFCNIIFNKLQD---EELIMT--------HCKSCKKPKR---------PDKSYNYACFICTYHTRKHGDMIGH   63 (143)
Q Consensus         4 ~~~~~~C~~C~~~f~~~~~---~~~~~~--------~c~~c~~~~~---------~~~~~~~~c~~c~~~~~~~~~l~~h   63 (143)
                      ....|+|+.||+.+.+..+   |+..|-        .|+.|++.|.         .+..-+++|.+||+.|.....|+.|
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSRPWLLQGH  206 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSRPWLLQGH  206 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccchHHhhcc
Confidence            4567899999999866665   443332        3555555554         1223345555555555555555555


Q ss_pred             hhhcCCCCCccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHHHHHHH
Q psy3948          64 MRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLED  122 (143)
Q Consensus        64 ~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~~  122 (143)
                      +++|+|++||.|+.|+++|...++|..|+++|.+.++|+|..|++.|+..|.|.+|.+.
T Consensus       207 iRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  207 IRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            55555555555555555555555555555555555555555555555555555555543


No 2  
>KOG2462|consensus
Probab=99.92  E-value=8.2e-26  Score=148.91  Aligned_cols=105  Identities=20%  Similarity=0.285  Sum_probs=97.4

Q ss_pred             hcccCCCCCCCCC--------------CcceeccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCCCChHHHHHHHHH
Q psy3948          29 HCKSCKKPKRPDK--------------SYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKR   94 (143)
Q Consensus        29 ~c~~c~~~~~~~~--------------~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~   94 (143)
                      .|..|++.+....              .+.+.|++||+.+.....|..|+++|+  .+++|..||+.|.+.+.|+.|+|+
T Consensus       132 ~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRT  209 (279)
T KOG2462|consen  132 KCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRT  209 (279)
T ss_pred             eccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhccccc
Confidence            6999999997433              567999999999999999999999998  588999999999999999999999


Q ss_pred             hcCCCceecccccccccchHHHHHHHHHHhcCCCcccceee
Q psy3948          95 HTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVNIAL  135 (143)
Q Consensus        95 h~~e~~~~C~~C~~~f~~~s~l~~h~~~~~~~~~~~~~~~~  135 (143)
                      |||||||.|+.|++.|.++|+|+-|+++|...+.|.|....
T Consensus       210 HTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~  250 (279)
T KOG2462|consen  210 HTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCG  250 (279)
T ss_pred             ccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchh
Confidence            99999999999999999999999999999999999999443


No 3  
>KOG3608|consensus
Probab=99.57  E-value=2.1e-15  Score=103.10  Aligned_cols=139  Identities=19%  Similarity=0.415  Sum_probs=104.5

Q ss_pred             CCCCccccCCcchhhhccchh---hHHHhh-------hcccCCCCCCC---------CCCcceeccCCCCccCCcchHHH
Q psy3948           2 FVDHTILKCTFCNIIFNKLQD---EELIMT-------HCKSCKKPKRP---------DKSYNYACFICTYHTRKHGDMIG   62 (143)
Q Consensus         2 ~~~~~~~~C~~C~~~f~~~~~---~~~~~~-------~c~~c~~~~~~---------~~~~~~~c~~c~~~~~~~~~l~~   62 (143)
                      |+++|...|+.||..|.....   |.+..+       .|..|.+.|..         ..-..|+|+.|+......++|..
T Consensus       202 Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL~~  281 (467)
T KOG3608|consen  202 HSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSLTT  281 (467)
T ss_pred             cCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHHHH
Confidence            678899999999999966554   443322       47777777762         11234788888888888888888


Q ss_pred             hhh-hcCCCCCccCCCCCCCCCChHHHHHHHHHhcCCCceeccc--ccccccchHHHHHHHHHHh-cC--CCcccceeee
Q psy3948          63 HMR-KHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCAN--VIIIAIMYHILEIMLEDIQ-GR--DHINVNIALT  136 (143)
Q Consensus        63 h~~-~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~--C~~~f~~~s~l~~h~~~~~-~~--~~~~~~~~~~  136 (143)
                      |++ .|...+||.|..|...+.....|++|...|. +..|.|..  |...|.+.-.+.+|.+.++ +.  .+|.|....+
T Consensus       282 H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr  360 (467)
T KOG3608|consen  282 HIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDR  360 (467)
T ss_pred             HHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchh
Confidence            865 4666788889888888888888998888776 67788876  8888888888888877555 44  4478887666


Q ss_pred             eeeee
Q psy3948         137 LQFSA  141 (143)
Q Consensus       137 ~~~~~  141 (143)
                      +.+++
T Consensus       361 ~ft~G  365 (467)
T KOG3608|consen  361 FFTSG  365 (467)
T ss_pred             hhccc
Confidence            66654


No 4  
>KOG3576|consensus
Probab=99.55  E-value=1.1e-15  Score=97.37  Aligned_cols=82  Identities=23%  Similarity=0.412  Sum_probs=52.6

Q ss_pred             ceeccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHHHHHHHH
Q psy3948          44 NYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDI  123 (143)
Q Consensus        44 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~~~  123 (143)
                      .|.|.+|++.|....-|..|+..|...+.+.|..||+.|...-.|..|.++|+|-+||+|..|++.|+.+-.|..|+++.
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kv  196 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKV  196 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHH
Confidence            46666666666666666666666666666666666666666666666666666666666666666666666666666655


Q ss_pred             hc
Q psy3948         124 QG  125 (143)
Q Consensus       124 ~~  125 (143)
                      |+
T Consensus       197 hg  198 (267)
T KOG3576|consen  197 HG  198 (267)
T ss_pred             cC
Confidence            54


No 5  
>KOG3576|consensus
Probab=99.52  E-value=6.2e-15  Score=93.91  Aligned_cols=116  Identities=22%  Similarity=0.342  Sum_probs=91.9

Q ss_pred             CccccCCcchhhhccchhhHHHhhhcccCCCCCCCCCCcceeccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCCCC
Q psy3948           5 HTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCST   84 (143)
Q Consensus         5 ~~~~~C~~C~~~f~~~~~~~~~~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f~~   84 (143)
                      ...|.|..|++.|....-..++. .|.        ..-+.+.|..||+.|.+.-.|..|.++|+|.+||.|..|+++|..
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~-kch--------~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftq  185 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHL-KCH--------SDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQ  185 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHh-hhc--------cHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHh
Confidence            45678888998885443322221 121        122446799999999999999999999999999999999999999


Q ss_pred             hHHHHHHHH-Hhc----------CCCceecccccccccchHHHHHHHHHHhcCCCc
Q psy3948          85 KSALSVHQK-RHT----------GLKAHKCANVIIIAIMYHILEIMLEDIQGRDHI  129 (143)
Q Consensus        85 ~~~l~~h~~-~h~----------~e~~~~C~~C~~~f~~~s~l~~h~~~~~~~~~~  129 (143)
                      .-+|..|.+ .|.          .++-|.|..||.+-.....+..|++.|+..-++
T Consensus       186 rcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Spa  241 (267)
T KOG3576|consen  186 RCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSPA  241 (267)
T ss_pred             hccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCHH
Confidence            999999986 342          246799999999999999999999999876553


No 6  
>KOG3623|consensus
Probab=99.50  E-value=3.7e-15  Score=109.90  Aligned_cols=80  Identities=23%  Similarity=0.421  Sum_probs=76.5

Q ss_pred             CcceeccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHHHHHH
Q psy3948          42 SYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLE  121 (143)
Q Consensus        42 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~  121 (143)
                      +-.|.|..|+++|...++|.+|...|+|.+||.|..|.++|..+-.|..|.|.|.|||||+|+.|++.|+.+..+..|+.
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhc
Confidence            34699999999999999999999999999999999999999999999999999999999999999999999999999964


No 7  
>KOG3623|consensus
Probab=99.50  E-value=4.1e-15  Score=109.69  Aligned_cols=109  Identities=22%  Similarity=0.471  Sum_probs=88.2

Q ss_pred             ccccCCcchhhhccchhhHHHhhhcccCCCCCCCCC-CcceeccCCCCccCCcchHHHhhhhcCC-------------CC
Q psy3948           6 TILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDK-SYNYACFICTYHTRKHGDMIGHMRKHTG-------------VK   71 (143)
Q Consensus         6 ~~~~C~~C~~~f~~~~~~~~~~~~c~~c~~~~~~~~-~~~~~c~~c~~~~~~~~~l~~h~~~~~~-------------~~   71 (143)
                      ....|++|++++.++...+.+..        +++.+ +..|.|..|..+|.+...|..|+..|..             .+
T Consensus       209 qlltcpycdrgykrltslkeHik--------yrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lR  280 (1007)
T KOG3623|consen  209 QLLTCPYCDRGYKRLTSLKEHIK--------YRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLR  280 (1007)
T ss_pred             hhhcchhHHHHHHHHHHHHHHHH--------HHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhc
Confidence            35689999999876665332211        11112 2347899999999999999999887653             34


Q ss_pred             CccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHHHHHHH
Q psy3948          72 PLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLED  122 (143)
Q Consensus        72 ~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~~  122 (143)
                      .|.|..|+++|..+-.|..|+|+|.|||||.|+.|++.|+.+..+..|+..
T Consensus       281 KFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  281 KFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             cccccccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            599999999999999999999999999999999999999999999999764


No 8  
>KOG1074|consensus
Probab=99.49  E-value=1.1e-14  Score=108.77  Aligned_cols=59  Identities=24%  Similarity=0.279  Sum_probs=51.4

Q ss_pred             CccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHHHHHHHHhcCCCcc
Q psy3948          72 PLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHIN  130 (143)
Q Consensus        72 ~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~~~~~~~~~~  130 (143)
                      |-.|..|.+.+.=...|+-|.++|+|||||+|..||+.|+++.+|+.|+-+|....+++
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R  663 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPAR  663 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCcccc
Confidence            45677888888888999999999999999999999999999999999999888776654


No 9  
>KOG3608|consensus
Probab=99.33  E-value=2.8e-12  Score=88.09  Aligned_cols=124  Identities=19%  Similarity=0.315  Sum_probs=101.5

Q ss_pred             CCccccCCcchhhhccchh---hHH-Hhh--hcccCCCCCC------------CCCCcceeccCCCCccCCcchHHHhhh
Q psy3948           4 DHTILKCTFCNIIFNKLQD---EEL-IMT--HCKSCKKPKR------------PDKSYNYACFICTYHTRKHGDMIGHMR   65 (143)
Q Consensus         4 ~~~~~~C~~C~~~f~~~~~---~~~-~~~--~c~~c~~~~~------------~~~~~~~~c~~c~~~~~~~~~l~~h~~   65 (143)
                      ...+|.|..|-+.|.++.-   |++ +..  .|+.|..+-+            +.+.++|+|..|+..+...+.|..|..
T Consensus       234 ~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~  313 (467)
T KOG3608|consen  234 NTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQ  313 (467)
T ss_pred             cCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHH
Confidence            4568999999999977655   333 332  6888887654            677899999999999999999999999


Q ss_pred             hcCCCCCccCCC--CCCCCCChHHHHHHHHH-hcC--CCceecccccccccchHHHHHHHHHHhcCCC
Q psy3948          66 KHTGVKPLKCSS--CNYSCSTKSALSVHQKR-HTG--LKAHKCANVIIIAIMYHILEIMLEDIQGRDH  128 (143)
Q Consensus        66 ~~~~~~~~~c~~--c~~~f~~~~~l~~h~~~-h~~--e~~~~C~~C~~~f~~~s~l~~h~~~~~~~~~  128 (143)
                      +|. ...|.|..  |..++.+...+..|.+. |.|  +.+|.|..|++.|++-.+|..|+...|+=+.
T Consensus       314 ~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~~  380 (467)
T KOG3608|consen  314 VHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGFRL  380 (467)
T ss_pred             hcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhcccC
Confidence            888 55688887  98899999999999874 445  4569999999999999999999887775443


No 10 
>KOG1074|consensus
Probab=99.23  E-value=7.1e-12  Score=94.05  Aligned_cols=60  Identities=20%  Similarity=0.224  Sum_probs=55.7

Q ss_pred             ccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHHHHHHHHhcCCCcccc
Q psy3948          73 LKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHINVN  132 (143)
Q Consensus        73 ~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~~~~~~~~~~~~  132 (143)
                      ..|.+|++.|.....|+.|+++|+++|||.|..|++.|+.+.+|+.|+.+|....+....
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~srr  939 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPSRR  939 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCccC
Confidence            678999999999999999999999999999999999999999999999999977766544


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.19  E-value=8.9e-11  Score=86.43  Aligned_cols=126  Identities=17%  Similarity=0.293  Sum_probs=93.9

Q ss_pred             ccCCcchhhhccchh--hHHHhh----hcc--cCCCCCC-CCCCcceeccCCCCccCCcchHHHhhhhcCCCCCccCCCC
Q psy3948           8 LKCTFCNIIFNKLQD--EELIMT----HCK--SCKKPKR-PDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSC   78 (143)
Q Consensus         8 ~~C~~C~~~f~~~~~--~~~~~~----~c~--~c~~~~~-~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c   78 (143)
                      -.|+.|++......-  |...-.    .|+  .|+..|. ...+..+.|+.|+..|. ...+..|...++  .++.|+ |
T Consensus       408 V~C~NC~~~i~l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-C  483 (567)
T PLN03086        408 VECRNCKHYIPSRSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-C  483 (567)
T ss_pred             EECCCCCCccchhHHHHHHhhCCCcceeCCcccccceeeccccccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-C
Confidence            469999886433222  322211    476  4888875 34456688999999996 567899988874  789999 9


Q ss_pred             CCCCCChHHHHHHHHHhcCCCceeccccccccc----------chHHHHHHHHHHhcCCCcccc-eeeeeee
Q psy3948          79 NYSCSTKSALSVHQKRHTGLKAHKCANVIIIAI----------MYHILEIMLEDIQGRDHINVN-IALTLQF  139 (143)
Q Consensus        79 ~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~----------~~s~l~~h~~~~~~~~~~~~~-~~~~~~~  139 (143)
                      +..+ ....|..|+.+|..++++.|..|++.|.          ..+.|..|... .+.+++.|. +...+..
T Consensus       484 g~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~-CG~rt~~C~~Cgk~Vrl  553 (567)
T PLN03086        484 GVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI-CGSRTAPCDSCGRSVML  553 (567)
T ss_pred             CCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh-cCCcceEccccCCeeee
Confidence            9654 6689999999999999999999999985          24689999887 489999998 4444443


No 12 
>PHA00733 hypothetical protein
Probab=99.17  E-value=3e-11  Score=73.57  Aligned_cols=82  Identities=10%  Similarity=0.001  Sum_probs=65.1

Q ss_pred             CcceeccCCCCccCCcchHHHh--h---hhcCCCCCccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHH
Q psy3948          42 SYNYACFICTYHTRKHGDMIGH--M---RKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHIL  116 (143)
Q Consensus        42 ~~~~~c~~c~~~~~~~~~l~~h--~---~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l  116 (143)
                      .+.+.|.+|...+.+...|..+  +   ..+.+.+||.|..|++.|.....|..|++.+  +.+|.|..|++.|...+.|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL  115 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDST  115 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHH
Confidence            3556778887777666555433  1   1234478999999999999999999999876  4579999999999999999


Q ss_pred             HHHHHHHhc
Q psy3948         117 EIMLEDIQG  125 (143)
Q Consensus       117 ~~h~~~~~~  125 (143)
                      ..|+...|+
T Consensus       116 ~~H~~~~h~  124 (128)
T PHA00733        116 LDHVCKKHN  124 (128)
T ss_pred             HHHHHHhcC
Confidence            999988774


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.01  E-value=1.5e-10  Score=59.15  Aligned_cols=44  Identities=16%  Similarity=0.256  Sum_probs=38.5

Q ss_pred             CccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHH
Q psy3948          72 PLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILE  117 (143)
Q Consensus        72 ~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~  117 (143)
                      .|.|+.|++.|...++|..|+++|+  ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4789999999999999999999988  6899999999998877765


No 14 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.97  E-value=2.2e-09  Score=79.27  Aligned_cols=110  Identities=15%  Similarity=0.336  Sum_probs=78.7

Q ss_pred             cCCc--chhhhccchhhHHHhhhcccCCCCCCC--------CCCcceeccCCCCccCCcchHHHhhhhcCCCCCccCCCC
Q psy3948           9 KCTF--CNIIFNKLQDEELIMTHCKSCKKPKRP--------DKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSC   78 (143)
Q Consensus         9 ~C~~--C~~~f~~~~~~~~~~~~c~~c~~~~~~--------~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c   78 (143)
                      .|+.  |+.+|....-  ..|..|+.|++.|..        .-..++.|+ ||..+ ....|..|+..|...+++.|..|
T Consensus       435 ~Cp~~~Cg~v~~r~el--~~H~~C~~Cgk~f~~s~LekH~~~~Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC  510 (567)
T PLN03086        435 VCPHDGCGIVLRVEEA--KNHVHCEKCGQAFQQGEMEKHMKVFHEPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFC  510 (567)
T ss_pred             eCCcccccceeecccc--ccCccCCCCCCccchHHHHHHHHhcCCCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCC
Confidence            4653  7776632221  111257777776651        012668899 99765 55789999999999999999999


Q ss_pred             CCCCCC----------hHHHHHHHHHhcCCCceecccccccccchHHHHHHHHHHh
Q psy3948          79 NYSCST----------KSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQ  124 (143)
Q Consensus        79 ~~~f~~----------~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~~~~  124 (143)
                      +..+..          ...|..|.... |.+++.|..||+.+..+ +|..|+...|
T Consensus       511 ~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~~h  564 (567)
T PLN03086        511 GDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIAVH  564 (567)
T ss_pred             CCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHHHHhh
Confidence            987742          34788888775 89999999999988855 6888876554


No 15 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.94  E-value=8.1e-10  Score=48.50  Aligned_cols=26  Identities=31%  Similarity=0.277  Sum_probs=23.4

Q ss_pred             HHHHHHHHhcCCCceecccccccccc
Q psy3948          87 ALSVHQKRHTGLKAHKCANVIIIAIM  112 (143)
Q Consensus        87 ~l~~h~~~h~~e~~~~C~~C~~~f~~  112 (143)
                      +|..|+++|++++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47889999999999999999999863


No 16 
>PHA00616 hypothetical protein
Probab=98.87  E-value=1.3e-09  Score=53.11  Aligned_cols=33  Identities=9%  Similarity=0.045  Sum_probs=30.9

Q ss_pred             ceecccccccccchHHHHHHHHHHhcCCCcccc
Q psy3948         100 AHKCANVIIIAIMYHILEIMLEDIQGRDHINVN  132 (143)
Q Consensus       100 ~~~C~~C~~~f~~~s~l~~h~~~~~~~~~~~~~  132 (143)
                      ||+|+.||++|...++|.+|+++||+++++.+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            689999999999999999999999999998776


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.62  E-value=1.5e-08  Score=51.79  Aligned_cols=42  Identities=36%  Similarity=0.551  Sum_probs=36.7

Q ss_pred             eeccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCCCChHHH
Q psy3948          45 YACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSAL   88 (143)
Q Consensus        45 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f~~~~~l   88 (143)
                      |+|+.||+.|...+.|..|++.|+  +++.|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            689999999999999999999998  688999999988866544


No 18 
>PHA00733 hypothetical protein
Probab=98.61  E-value=8.6e-08  Score=58.46  Aligned_cols=84  Identities=13%  Similarity=0.156  Sum_probs=59.4

Q ss_pred             CccccCCcchhhhccchhhHHH--hhhcccCCCCCCCCCCcceeccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCC
Q psy3948           5 HTILKCTFCNIIFNKLQDEELI--MTHCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSC   82 (143)
Q Consensus         5 ~~~~~C~~C~~~f~~~~~~~~~--~~~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f   82 (143)
                      .+.++|..|+..|.........  ..      +--...+..+|.|+.||+.|.....|..|++.+  ..++.|..|++.|
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~------~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F  109 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLY------KLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEF  109 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHH------hhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCcc
Confidence            4567777777766443321000  00      000134467899999999999999999998866  3578999999999


Q ss_pred             CChHHHHHHHHHhc
Q psy3948          83 STKSALSVHQKRHT   96 (143)
Q Consensus        83 ~~~~~l~~h~~~h~   96 (143)
                      .....|..|+....
T Consensus       110 ~~~~sL~~H~~~~h  123 (128)
T PHA00733        110 RNTDSTLDHVCKKH  123 (128)
T ss_pred             CCHHHHHHHHHHhc
Confidence            99999999987543


No 19 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.28  E-value=8.8e-07  Score=37.49  Aligned_cols=23  Identities=13%  Similarity=-0.096  Sum_probs=20.9

Q ss_pred             eecccccccccchHHHHHHHHHH
Q psy3948         101 HKCANVIIIAIMYHILEIMLEDI  123 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~~~  123 (143)
                      |.|+.|++.|.+.+.|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999874


No 20 
>PHA00616 hypothetical protein
Probab=98.23  E-value=6.2e-07  Score=43.77  Aligned_cols=33  Identities=12%  Similarity=0.094  Sum_probs=22.8

Q ss_pred             CccCCCCCCCCCChHHHHHHHHHhcCCCceecc
Q psy3948          72 PLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCA  104 (143)
Q Consensus        72 ~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~  104 (143)
                      ||.|+.||+.|.....+..|++.|+|++++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            456777777777777777777777777766654


No 21 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.22  E-value=4.8e-07  Score=39.54  Aligned_cols=25  Identities=52%  Similarity=0.897  Sum_probs=22.2

Q ss_pred             hHHHhhhhcCCCCCccCCCCCCCCC
Q psy3948          59 DMIGHMRKHTGVKPLKCSSCNYSCS   83 (143)
Q Consensus        59 ~l~~h~~~~~~~~~~~c~~c~~~f~   83 (143)
                      +|..|++.|++++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3778999999999999999998875


No 22 
>PHA00732 hypothetical protein
Probab=98.16  E-value=1.4e-06  Score=48.53  Aligned_cols=42  Identities=29%  Similarity=0.426  Sum_probs=22.2

Q ss_pred             ccCCCCCCCCCChHHHHHHHH-HhcCCCceecccccccccchHHHHHHH
Q psy3948          73 LKCSSCNYSCSTKSALSVHQK-RHTGLKAHKCANVIIIAIMYHILEIML  120 (143)
Q Consensus        73 ~~c~~c~~~f~~~~~l~~h~~-~h~~e~~~~C~~C~~~f~~~s~l~~h~  120 (143)
                      |.|..|++.|.+...|..|++ .|.   ++.|+.|++.|.   .|..|.
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~   44 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHF   44 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhh
Confidence            455555555555555555554 233   235666666555   244444


No 23 
>KOG3993|consensus
Probab=98.16  E-value=5.7e-07  Score=63.72  Aligned_cols=120  Identities=11%  Similarity=0.074  Sum_probs=71.8

Q ss_pred             cccCCcchhhhccchh---hHHHhhhcccCC-------C--------------CCCCCCCcceeccCCCCccCCcchHHH
Q psy3948           7 ILKCTFCNIIFNKLQD---EELIMTHCKSCK-------K--------------PKRPDKSYNYACFICTYHTRKHGDMIG   62 (143)
Q Consensus         7 ~~~C~~C~~~f~~~~~---~~~~~~~c~~c~-------~--------------~~~~~~~~~~~c~~c~~~~~~~~~l~~   62 (143)
                      -|.|++|+|+|.--.+   |.|+|-.=..-.       +              +-....+..|.|.+|++.|.....|..
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrK  374 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRK  374 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHH
Confidence            4789999999966555   766654000000       0              000122347999999999999999999


Q ss_pred             hhhhcCCCCC----------------------------------------------ccCCCCCCCCCChHHHHHHHHHhc
Q psy3948          63 HMRKHTGVKP----------------------------------------------LKCSSCNYSCSTKSALSVHQKRHT   96 (143)
Q Consensus        63 h~~~~~~~~~----------------------------------------------~~c~~c~~~f~~~~~l~~h~~~h~   96 (143)
                      |+.+|.....                                              ..++.++..+.++..-..+.+...
T Consensus       375 Hqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~  454 (500)
T KOG3993|consen  375 HQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGI  454 (500)
T ss_pred             hHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeeccccccCCCCCCCCcccCCCCCccccccc
Confidence            9765543100                                              011112222222222222222222


Q ss_pred             CCCceecccccccccchHHHHHHHHHHhcC
Q psy3948          97 GLKAHKCANVIIIAIMYHILEIMLEDIQGR  126 (143)
Q Consensus        97 ~e~~~~C~~C~~~f~~~s~l~~h~~~~~~~  126 (143)
                      .+..|.|..|...|.++.+|.+|+...|-.
T Consensus       455 ~~q~f~~ky~~atfyss~~ltrhin~~Hps  484 (500)
T KOG3993|consen  455 AEQGFTCKYCPATFYSSPGLTRHINKCHPS  484 (500)
T ss_pred             hhhccccccchHhhhcCcchHhHhhhcChH
Confidence            234588999999999999999999887754


No 24 
>KOG3993|consensus
Probab=98.11  E-value=8e-07  Score=63.02  Aligned_cols=85  Identities=12%  Similarity=0.005  Sum_probs=52.4

Q ss_pred             ceeccCCCCccCCcchHHHhhhhcCCCCCccCCC--CCCCCCChHHHHHH-HHHh--cCCCceecccccccccchHHHHH
Q psy3948          44 NYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSS--CNYSCSTKSALSVH-QKRH--TGLKAHKCANVIIIAIMYHILEI  118 (143)
Q Consensus        44 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~--c~~~f~~~~~l~~h-~~~h--~~e~~~~C~~C~~~f~~~s~l~~  118 (143)
                      -|+|++|++.|.-..+|..|+++|.-...-.-..  -.+.-...-.+.+. .+..  ..+-.|.|..|++.|.+...|++
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrK  374 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRK  374 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHH
Confidence            3889999999999999999988886532211000  00000000000000 0100  12347999999999999999999


Q ss_pred             HHHHHhcCCC
Q psy3948         119 MLEDIQGRDH  128 (143)
Q Consensus       119 h~~~~~~~~~  128 (143)
                      |+..|+...-
T Consensus       375 Hqlthq~~~~  384 (500)
T KOG3993|consen  375 HQLTHQRAPL  384 (500)
T ss_pred             hHHhhhcccc
Confidence            9999885543


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.02  E-value=1.8e-05  Score=40.94  Aligned_cols=50  Identities=20%  Similarity=0.224  Sum_probs=37.2

Q ss_pred             ccCCCCCCCCCChHHHHHHHH-HhcCC-CceecccccccccchHHHHHHHHHHhc
Q psy3948          73 LKCSSCNYSCSTKSALSVHQK-RHTGL-KAHKCANVIIIAIMYHILEIMLEDIQG  125 (143)
Q Consensus        73 ~~c~~c~~~f~~~~~l~~h~~-~h~~e-~~~~C~~C~~~f~~~s~l~~h~~~~~~  125 (143)
                      |.|+.|++ ..+...|..|.. .|..+ +.+.|+.|...+.  .+|..|+...|+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            67888888 566778888865 45443 4688999998654  489999887763


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.01  E-value=6.4e-06  Score=34.92  Aligned_cols=24  Identities=8%  Similarity=-0.076  Sum_probs=19.5

Q ss_pred             eecccccccccchHHHHHHHHHHh
Q psy3948         101 HKCANVIIIAIMYHILEIMLEDIQ  124 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~~~~  124 (143)
                      |.|+.|++.|.+...|..|++.++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999998775


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.98  E-value=3e-06  Score=37.31  Aligned_cols=26  Identities=8%  Similarity=-0.064  Sum_probs=22.6

Q ss_pred             ceecccccccccchHHHHHHHHHHhc
Q psy3948         100 AHKCANVIIIAIMYHILEIMLEDIQG  125 (143)
Q Consensus       100 ~~~C~~C~~~f~~~s~l~~h~~~~~~  125 (143)
                      ||.|..|++.|.+.+.|..|++.|++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            68999999999999999999877653


No 28 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.69  E-value=5.8e-05  Score=37.74  Aligned_cols=33  Identities=12%  Similarity=-0.024  Sum_probs=23.8

Q ss_pred             cCCCceecccccccccchHHHHHHHHHHhcCCC
Q psy3948          96 TGLKAHKCANVIIIAIMYHILEIMLEDIQGRDH  128 (143)
Q Consensus        96 ~~e~~~~C~~C~~~f~~~s~l~~h~~~~~~~~~  128 (143)
                      ..+.|-.|+.|+..+.++-+|++|++..|..++
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            346788999999999999999999999887765


No 29 
>PHA00732 hypothetical protein
Probab=97.64  E-value=4.5e-05  Score=42.51  Aligned_cols=46  Identities=33%  Similarity=0.538  Sum_probs=34.4

Q ss_pred             ceeccCCCCccCCcchHHHhhhh-cCCCCCccCCCCCCCCCChHHHHHHHHHh
Q psy3948          44 NYACFICTYHTRKHGDMIGHMRK-HTGVKPLKCSSCNYSCSTKSALSVHQKRH   95 (143)
Q Consensus        44 ~~~c~~c~~~~~~~~~l~~h~~~-~~~~~~~~c~~c~~~f~~~~~l~~h~~~h   95 (143)
                      +|.|..|++.|.....|..|++. |.   ++.|+.|++.|.+   +..|..+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~~---l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYRR---LNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeCC---hhhhhccc
Confidence            36788999999988889888873 54   3579999988874   66666543


No 30 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.48  E-value=0.00016  Score=30.68  Aligned_cols=24  Identities=17%  Similarity=0.102  Sum_probs=19.5

Q ss_pred             eecccccccccchHHHHHHHHHHhc
Q psy3948         101 HKCANVIIIAIMYHILEIMLEDIQG  125 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~~~~~  125 (143)
                      |.|..|+.... .+.|.+|++.+++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            78999999998 9999999998874


No 31 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.43  E-value=0.00013  Score=31.23  Aligned_cols=24  Identities=8%  Similarity=0.044  Sum_probs=20.5

Q ss_pred             eecccccccccchHHHHHHHHHHh
Q psy3948         101 HKCANVIIIAIMYHILEIMLEDIQ  124 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~~~~  124 (143)
                      |.|..|++.|...+.|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            578899999999999999988554


No 32 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.37  E-value=8.9e-05  Score=31.11  Aligned_cols=20  Identities=30%  Similarity=0.584  Sum_probs=10.2

Q ss_pred             eccCCCCccCCcchHHHhhh
Q psy3948          46 ACFICTYHTRKHGDMIGHMR   65 (143)
Q Consensus        46 ~c~~c~~~~~~~~~l~~h~~   65 (143)
                      .|+.|++.|.....|..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    2 KCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCccCCHHHHHHHHh
Confidence            45555555555555555543


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.34  E-value=0.00019  Score=41.56  Aligned_cols=78  Identities=13%  Similarity=0.205  Sum_probs=23.2

Q ss_pred             eccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHHHHHHHH-h
Q psy3948          46 ACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDI-Q  124 (143)
Q Consensus        46 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~~~-~  124 (143)
                      +|..|+..|.+...+..|+....+... .   ....+.....+..+.+.-. ...+.|..|++.|.+...|..|++.+ |
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~-~---~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~~H   75 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDI-P---DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSKHH   75 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTTT
T ss_pred             Ccccccccccccccccccccccccccc-c---ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCccC
Confidence            377888888888888888754443211 1   0011112222222222211 22689999999999999999999965 4


Q ss_pred             cCCC
Q psy3948         125 GRDH  128 (143)
Q Consensus       125 ~~~~  128 (143)
                      ....
T Consensus        76 ~~~~   79 (100)
T PF12756_consen   76 KKRN   79 (100)
T ss_dssp             TC-S
T ss_pred             CCcc
Confidence            4433


No 34 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.11  E-value=0.00099  Score=34.32  Aligned_cols=48  Identities=19%  Similarity=0.453  Sum_probs=31.1

Q ss_pred             eeccCCCCccCCcchHHHhhh-hcCCC-CCccCCCCCCCCCChHHHHHHHHHh
Q psy3948          45 YACFICTYHTRKHGDMIGHMR-KHTGV-KPLKCSSCNYSCSTKSALSVHQKRH   95 (143)
Q Consensus        45 ~~c~~c~~~~~~~~~l~~h~~-~~~~~-~~~~c~~c~~~f~~~~~l~~h~~~h   95 (143)
                      |.|+.|++ -.+...|..|.. .|..+ +.+.|++|...+.  .+|..|+..+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            67888888 455667777744 34443 4578888886433  4777777654


No 35 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=96.95  E-value=0.00049  Score=29.99  Aligned_cols=23  Identities=22%  Similarity=0.411  Sum_probs=12.0

Q ss_pred             eeccCCCCccCCcchHHHhhhhc
Q psy3948          45 YACFICTYHTRKHGDMIGHMRKH   67 (143)
Q Consensus        45 ~~c~~c~~~~~~~~~l~~h~~~~   67 (143)
                      |.|..|++.|.+...|..|++.|
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCccCCccCChhHHHHHhHHh
Confidence            45555555555555555554443


No 36 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.92  E-value=0.0006  Score=29.11  Aligned_cols=23  Identities=13%  Similarity=-0.074  Sum_probs=19.6

Q ss_pred             eecccccccccchHHHHHHHHHH
Q psy3948         101 HKCANVIIIAIMYHILEIMLEDI  123 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~~~  123 (143)
                      |.|..|++.|.+...|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67899999999999999998643


No 37 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.91  E-value=0.00027  Score=48.91  Aligned_cols=52  Identities=21%  Similarity=0.226  Sum_probs=38.5

Q ss_pred             CCCccCCC--CCCCCCChHHHHHHHHHhc-------------------CCCceecccccccccchHHHHHHHH
Q psy3948          70 VKPLKCSS--CNYSCSTKSALSVHQKRHT-------------------GLKAHKCANVIIIAIMYHILEIMLE  121 (143)
Q Consensus        70 ~~~~~c~~--c~~~f~~~~~l~~h~~~h~-------------------~e~~~~C~~C~~~f~~~s~l~~h~~  121 (143)
                      ++||.|++  |.+.|.....|..|+....                   ..|||.|+.|++.+.....|+=|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            47777776  6677777777777764211                   2489999999999999888887743


No 38 
>PRK04860 hypothetical protein; Provisional
Probab=96.85  E-value=0.00076  Score=42.75  Aligned_cols=37  Identities=16%  Similarity=0.423  Sum_probs=20.3

Q ss_pred             CccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccc
Q psy3948          72 PLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIM  112 (143)
Q Consensus        72 ~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~  112 (143)
                      +|.|. |+.   ....+..|.++++++++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            35554 543   44445555566666666666666655543


No 39 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=96.70  E-value=0.0017  Score=27.08  Aligned_cols=21  Identities=33%  Similarity=0.624  Sum_probs=9.5

Q ss_pred             cCCCCCCCCCChHHHHHHHHH
Q psy3948          74 KCSSCNYSCSTKSALSVHQKR   94 (143)
Q Consensus        74 ~c~~c~~~f~~~~~l~~h~~~   94 (143)
                      .|+.|+..|.+...|..|+..
T Consensus         2 ~C~~C~~~~~~~~~l~~H~~~   22 (24)
T PF13894_consen    2 QCPICGKSFRSKSELRQHMRT   22 (24)
T ss_dssp             E-SSTS-EESSHHHHHHHHHH
T ss_pred             CCcCCCCcCCcHHHHHHHHHh
Confidence            444555555555555555443


No 40 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.55  E-value=0.0015  Score=45.37  Aligned_cols=19  Identities=26%  Similarity=0.574  Sum_probs=14.4

Q ss_pred             CCccccCCc--chhhhccchh
Q psy3948           4 DHTILKCTF--CNIIFNKLQD   22 (143)
Q Consensus         4 ~~~~~~C~~--C~~~f~~~~~   22 (143)
                      +.|||+|+.  |+|.+....-
T Consensus       346 d~KpykCpV~gC~K~YknqnG  366 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNG  366 (423)
T ss_pred             cCceecCCCCCchhhhccccc
Confidence            349999998  9998865443


No 41 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.27  E-value=0.00066  Score=29.67  Aligned_cols=22  Identities=9%  Similarity=-0.002  Sum_probs=18.8

Q ss_pred             eecccccccccchHHHHHHHHH
Q psy3948         101 HKCANVIIIAIMYHILEIMLED  122 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~~  122 (143)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6799999999999999988763


No 42 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.23  E-value=0.0075  Score=25.34  Aligned_cols=22  Identities=36%  Similarity=0.726  Sum_probs=13.4

Q ss_pred             cCCCCCCCCCChHHHHHHHHHh
Q psy3948          74 KCSSCNYSCSTKSALSVHQKRH   95 (143)
Q Consensus        74 ~c~~c~~~f~~~~~l~~h~~~h   95 (143)
                      .|..|+..|.....+..|++.|
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHHh
Confidence            4566666666666666666544


No 43 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.94  E-value=0.0078  Score=25.75  Aligned_cols=21  Identities=14%  Similarity=-0.210  Sum_probs=15.8

Q ss_pred             eecccccccccchHHHHHHHHH
Q psy3948         101 HKCANVIIIAIMYHILEIMLED  122 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~~  122 (143)
                      ..|+.||+.| ..+.|.+|++.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3688888888 57778888664


No 44 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.57  E-value=0.01  Score=30.31  Aligned_cols=32  Identities=9%  Similarity=0.087  Sum_probs=27.1

Q ss_pred             hcCCCceecccccccccchHHHHHHHHHHhcC
Q psy3948          95 HTGLKAHKCANVIIIAIMYHILEIMLEDIQGR  126 (143)
Q Consensus        95 h~~e~~~~C~~C~~~f~~~s~l~~h~~~~~~~  126 (143)
                      -.||--+.|+-||..|..+.+..+|+...|+-
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~~   43 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAHGW   43 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHhhh
Confidence            34677789999999999999999999877753


No 45 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=95.42  E-value=0.019  Score=28.86  Aligned_cols=33  Identities=18%  Similarity=0.255  Sum_probs=17.4

Q ss_pred             CCCCCccCCCCCCCCCChHHHHHHHHHhcCCCc
Q psy3948          68 TGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKA  100 (143)
Q Consensus        68 ~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~  100 (143)
                      ....|..|+.|+..+.+.-+|..|+....+.+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            344566777777777777777777765555444


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=95.39  E-value=0.017  Score=36.71  Aligned_cols=36  Identities=14%  Similarity=0.119  Sum_probs=30.4

Q ss_pred             ceecccccccccchHHHHHHHHHHhcCCCcccc-eeeeeee
Q psy3948         100 AHKCANVIIIAIMYHILEIMLEDIQGRDHINVN-IALTLQF  139 (143)
Q Consensus       100 ~~~C~~C~~~f~~~s~l~~h~~~~~~~~~~~~~-~~~~~~~  139 (143)
                      +|.|. |+.   ....+.+|.+++.++.+|.|+ +...+.+
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            69998 997   678899999999999999997 6555544


No 47 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.07  E-value=0.018  Score=26.47  Aligned_cols=22  Identities=14%  Similarity=0.033  Sum_probs=19.5

Q ss_pred             ceecccccccccchHHHHHHHH
Q psy3948         100 AHKCANVIIIAIMYHILEIMLE  121 (143)
Q Consensus       100 ~~~C~~C~~~f~~~s~l~~h~~  121 (143)
                      +|.|..|+..|.+...+..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            5789999999999999999976


No 48 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.42  E-value=0.04  Score=31.61  Aligned_cols=24  Identities=25%  Similarity=0.639  Sum_probs=17.4

Q ss_pred             CccCCCCCCCCCChHHHHHHHHHh
Q psy3948          72 PLKCSSCNYSCSTKSALSVHQKRH   95 (143)
Q Consensus        72 ~~~c~~c~~~f~~~~~l~~h~~~h   95 (143)
                      .+.|..|+..|.+...|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            567888888888888888887754


No 49 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.59  E-value=0.021  Score=41.36  Aligned_cols=62  Identities=23%  Similarity=0.255  Sum_probs=53.5

Q ss_pred             CCccCCCCCCCCCChHHHHHHHH--HhcCC--Cceecc--cccccccchHHHHHHHHHHhcCCCcccc
Q psy3948          71 KPLKCSSCNYSCSTKSALSVHQK--RHTGL--KAHKCA--NVIIIAIMYHILEIMLEDIQGRDHINVN  132 (143)
Q Consensus        71 ~~~~c~~c~~~f~~~~~l~~h~~--~h~~e--~~~~C~--~C~~~f~~~s~l~~h~~~~~~~~~~~~~  132 (143)
                      .++.+..|...|.....+..|.+  .|.++  +++.|+  .|++.|.+...+..|...|.+..++.+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            35778888889999999999998  79999  999999  7999999999999999999888765544


No 50 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=91.64  E-value=0.22  Score=25.93  Aligned_cols=9  Identities=11%  Similarity=0.360  Sum_probs=5.0

Q ss_pred             Cceeccccc
Q psy3948          99 KAHKCANVI  107 (143)
Q Consensus        99 ~~~~C~~C~  107 (143)
                      .+|.|+.||
T Consensus        49 ~~Y~Cp~CG   57 (61)
T COG2888          49 NPYRCPKCG   57 (61)
T ss_pred             CceECCCcC
Confidence            455555555


No 51 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=91.43  E-value=0.24  Score=20.91  Aligned_cols=10  Identities=20%  Similarity=0.660  Sum_probs=6.5

Q ss_pred             CcceeccCCC
Q psy3948          42 SYNYACFICT   51 (143)
Q Consensus        42 ~~~~~c~~c~   51 (143)
                      ...|.|+.||
T Consensus        14 ~v~f~CPnCG   23 (24)
T PF07754_consen   14 AVPFPCPNCG   23 (24)
T ss_pred             CceEeCCCCC
Confidence            3457777776


No 52 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=90.57  E-value=0.2  Score=23.35  Aligned_cols=11  Identities=18%  Similarity=0.295  Sum_probs=5.8

Q ss_pred             ceeccCCCCcc
Q psy3948          44 NYACFICTYHT   54 (143)
Q Consensus        44 ~~~c~~c~~~~   54 (143)
                      ..+|+.|+..|
T Consensus        25 ~v~C~~C~~~f   35 (36)
T PF13717_consen   25 KVRCSKCGHVF   35 (36)
T ss_pred             EEECCCCCCEe
Confidence            34555555544


No 53 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=90.56  E-value=0.6  Score=27.82  Aligned_cols=87  Identities=14%  Similarity=0.139  Sum_probs=44.6

Q ss_pred             ccccCCcchhhhccchhhHHHhhhcccCCCCCC----CCCCcceeccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCC
Q psy3948           6 TILKCTFCNIIFNKLQDEELIMTHCKSCKKPKR----PDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYS   81 (143)
Q Consensus         6 ~~~~C~~C~~~f~~~~~~~~~~~~c~~c~~~~~----~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~   81 (143)
                      -|-.|+.||.+..+.-+..|... --..-+.|.    ......-.|-.|...|+.......-  .......|.|+.|...
T Consensus        14 LP~~CpiCgLtLVss~HLARSyH-HLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~--~~~~~~~y~C~~C~~~   90 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSYH-HLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFD--ELKDSHRYVCAVCKNV   90 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhhh-ccCCCcccccccccccCCCCcccCcCCCCCCccccccc--ccccccceeCCCCCCc
Confidence            35678888887655555333211 000011111    0011112366777776654211100  0122346889889888


Q ss_pred             CCChHHHHHHHHHh
Q psy3948          82 CSTKSALSVHQKRH   95 (143)
Q Consensus        82 f~~~~~l~~h~~~h   95 (143)
                      |.-.-+...|...|
T Consensus        91 FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        91 FCVDCDVFVHESLH  104 (112)
T ss_pred             cccccchhhhhhcc
Confidence            88888888887665


No 54 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=89.86  E-value=0.44  Score=23.14  Aligned_cols=28  Identities=18%  Similarity=0.094  Sum_probs=17.6

Q ss_pred             CCCceecccccccccch----HHHHHHHHHHh
Q psy3948          97 GLKAHKCANVIIIAIMY----HILEIMLEDIQ  124 (143)
Q Consensus        97 ~e~~~~C~~C~~~f~~~----s~l~~h~~~~~  124 (143)
                      +.....|..|++.+...    +.|.+|++..+
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            44557899999988774    88999986543


No 55 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=88.84  E-value=0.3  Score=22.92  Aligned_cols=10  Identities=20%  Similarity=0.265  Sum_probs=4.9

Q ss_pred             eeccCCCCcc
Q psy3948          45 YACFICTYHT   54 (143)
Q Consensus        45 ~~c~~c~~~~   54 (143)
                      ..|+.|+..|
T Consensus        26 vrC~~C~~~f   35 (37)
T PF13719_consen   26 VRCPKCGHVF   35 (37)
T ss_pred             EECCCCCcEe
Confidence            4455555444


No 56 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=88.66  E-value=0.46  Score=37.53  Aligned_cols=10  Identities=30%  Similarity=0.869  Sum_probs=6.1

Q ss_pred             CCccCCCCCC
Q psy3948          71 KPLKCSSCNY   80 (143)
Q Consensus        71 ~~~~c~~c~~   80 (143)
                      .|..|+.|+.
T Consensus       474 ~p~~Cp~Cgs  483 (730)
T COG1198         474 IPQSCPECGS  483 (730)
T ss_pred             CCCCCCCCCC
Confidence            4566666664


No 57 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=88.54  E-value=0.3  Score=33.12  Aligned_cols=55  Identities=16%  Similarity=0.437  Sum_probs=38.1

Q ss_pred             CCccccCCcchhhhccchhhHHHhhhcccCCCCCCCCC------CcceeccCCCCccCCcc
Q psy3948           4 DHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKRPDK------SYNYACFICTYHTRKHG   58 (143)
Q Consensus         4 ~~~~~~C~~C~~~f~~~~~~~~~~~~c~~c~~~~~~~~------~~~~~c~~c~~~~~~~~   58 (143)
                      .+..|.|..|+..++...-.......|..|.+.|.+..      ---|.|+.|+..|....
T Consensus       109 ~drqFaC~~Cd~~WwRrvp~rKeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G~~  169 (278)
T PF15135_consen  109 VDRQFACSSCDHMWWRRVPQRKEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRGFA  169 (278)
T ss_pred             cceeeeccccchHHHhccCcccccccccccccccCCCccccccceeeeecccccccchhhh
Confidence            35689999998887654433333447999998886311      12388999999998654


No 58 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.10  E-value=0.39  Score=28.46  Aligned_cols=28  Identities=18%  Similarity=0.246  Sum_probs=12.6

Q ss_pred             cccCCCCCCCCCCcceeccCCCCccCCc
Q psy3948          30 CKSCKKPKRPDKSYNYACFICTYHTRKH   57 (143)
Q Consensus        30 c~~c~~~~~~~~~~~~~c~~c~~~~~~~   57 (143)
                      |+.||+.|=--.+.|..|+.||..|.-.
T Consensus        12 Cp~CG~kFYDLnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   12 CPSCGAKFYDLNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCCCcchhccCCCCCccCCCCCCccCcc
Confidence            4444444432222344556666555543


No 59 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=87.70  E-value=0.69  Score=23.18  Aligned_cols=23  Identities=17%  Similarity=-0.048  Sum_probs=17.1

Q ss_pred             eecccccccccch-----HHHHHHHHHH
Q psy3948         101 HKCANVIIIAIMY-----HILEIMLEDI  123 (143)
Q Consensus       101 ~~C~~C~~~f~~~-----s~l~~h~~~~  123 (143)
                      -.|..|++.++..     +.|.+|++..
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~~   46 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRRK   46 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHhH
Confidence            4688888887665     6899998843


No 60 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=86.19  E-value=0.84  Score=23.79  Aligned_cols=11  Identities=18%  Similarity=0.431  Sum_probs=6.3

Q ss_pred             cceeccCCCCc
Q psy3948          43 YNYACFICTYH   53 (143)
Q Consensus        43 ~~~~c~~c~~~   53 (143)
                      ..|.|+.||..
T Consensus        24 ~~F~CPnCG~~   34 (59)
T PRK14890         24 VKFLCPNCGEV   34 (59)
T ss_pred             CEeeCCCCCCe
Confidence            44666666644


No 61 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=86.14  E-value=0.42  Score=21.76  Aligned_cols=9  Identities=44%  Similarity=1.283  Sum_probs=4.4

Q ss_pred             eeccCCCCc
Q psy3948          45 YACFICTYH   53 (143)
Q Consensus        45 ~~c~~c~~~   53 (143)
                      +.|..||..
T Consensus         2 ~~C~~CGy~   10 (33)
T cd00350           2 YVCPVCGYI   10 (33)
T ss_pred             EECCCCCCE
Confidence            345555544


No 62 
>KOG1146|consensus
Probab=86.06  E-value=0.31  Score=40.47  Aligned_cols=23  Identities=22%  Similarity=0.181  Sum_probs=21.2

Q ss_pred             CceecccccccccchHHHHHHHH
Q psy3948          99 KAHKCANVIIIAIMYHILEIMLE  121 (143)
Q Consensus        99 ~~~~C~~C~~~f~~~s~l~~h~~  121 (143)
                      ++|.|..|.+.++...+|.+|+.
T Consensus       517 ~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  517 KPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             CcccceeeeeeeecchHHHHHHH
Confidence            57999999999999999999976


No 63 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=85.73  E-value=0.75  Score=19.76  Aligned_cols=8  Identities=38%  Similarity=0.912  Sum_probs=4.2

Q ss_pred             ccCCCCcc
Q psy3948          47 CFICTYHT   54 (143)
Q Consensus        47 c~~c~~~~   54 (143)
                      |+.||..|
T Consensus        17 Cp~CG~~F   24 (26)
T PF10571_consen   17 CPHCGYDF   24 (26)
T ss_pred             CCCCCCCC
Confidence            55555544


No 64 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=85.03  E-value=0.16  Score=24.15  Aligned_cols=15  Identities=33%  Similarity=0.642  Sum_probs=10.5

Q ss_pred             cccCCcchhhhccch
Q psy3948           7 ILKCTFCNIIFNKLQ   21 (143)
Q Consensus         7 ~~~C~~C~~~f~~~~   21 (143)
                      -|.|+.||..|....
T Consensus         5 ~y~C~~Cg~~fe~~~   19 (41)
T smart00834        5 EYRCEDCGHTFEVLQ   19 (41)
T ss_pred             EEEcCCCCCEEEEEE
Confidence            467888888875443


No 65 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=84.98  E-value=0.59  Score=21.83  Aligned_cols=10  Identities=30%  Similarity=0.989  Sum_probs=5.3

Q ss_pred             ccCCcchhhh
Q psy3948           8 LKCTFCNIIF   17 (143)
Q Consensus         8 ~~C~~C~~~f   17 (143)
                      ..|+.|+..|
T Consensus         3 ~~CP~C~~~~   12 (38)
T TIGR02098         3 IQCPNCKTSF   12 (38)
T ss_pred             EECCCCCCEE
Confidence            3455555554


No 66 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=84.88  E-value=0.13  Score=24.85  Aligned_cols=15  Identities=33%  Similarity=0.680  Sum_probs=10.9

Q ss_pred             ccCCcchhhhccchh
Q psy3948           8 LKCTFCNIIFNKLQD   22 (143)
Q Consensus         8 ~~C~~C~~~f~~~~~   22 (143)
                      |.|+.||..|.....
T Consensus         6 y~C~~Cg~~fe~~~~   20 (42)
T PF09723_consen    6 YRCEECGHEFEVLQS   20 (42)
T ss_pred             EEeCCCCCEEEEEEE
Confidence            678888888855544


No 67 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=84.52  E-value=0.32  Score=35.21  Aligned_cols=62  Identities=26%  Similarity=0.430  Sum_probs=52.5

Q ss_pred             cceeccCCCCccCCcchHHHhhh--hcCCC--CCccCC--CCCCCCCChHHHHHHHHHhcCCCceecc
Q psy3948          43 YNYACFICTYHTRKHGDMIGHMR--KHTGV--KPLKCS--SCNYSCSTKSALSVHQKRHTGLKAHKCA  104 (143)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~h~~--~~~~~--~~~~c~--~c~~~f~~~~~l~~h~~~h~~e~~~~C~  104 (143)
                      .++.|..|...+.....+..|.+  .|.++  +++.|+  .|++.|.+...+..|...|++.+++.+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            35778889999999999999988  79998  899999  7999999999999998888877665553


No 68 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=83.75  E-value=0.62  Score=28.48  Aligned_cols=27  Identities=30%  Similarity=0.582  Sum_probs=18.6

Q ss_pred             cccCCcchhhhccchhhHHHhhhcccCCC
Q psy3948           7 ILKCTFCNIIFNKLQDEELIMTHCKSCKK   35 (143)
Q Consensus         7 ~~~C~~C~~~f~~~~~~~~~~~~c~~c~~   35 (143)
                      ||+|..||++|..-+..+..  =|+.||.
T Consensus         1 PH~Ct~Cg~~f~dgs~eil~--GCP~CGg   27 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGSKEILS--GCPECGG   27 (131)
T ss_pred             CcccCcCCCCcCCCcHHHHc--cCcccCC
Confidence            68999999999765543222  3777764


No 69 
>KOG2186|consensus
Probab=83.33  E-value=0.72  Score=31.45  Aligned_cols=38  Identities=18%  Similarity=0.520  Sum_probs=15.8

Q ss_pred             eeccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCCCC
Q psy3948          45 YACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCST   84 (143)
Q Consensus        45 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f~~   84 (143)
                      |.|.+||.+..-+ .+..|+..-++ ..|.|..|+..|..
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~   41 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER   41 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc
Confidence            3444444444422 33334333333 23444445444444


No 70 
>KOG1146|consensus
Probab=83.12  E-value=0.86  Score=38.10  Aligned_cols=65  Identities=22%  Similarity=0.379  Sum_probs=42.9

Q ss_pred             CCCCCccccCCcchhhhccchh---hHHHhhhc---ccC----------C-CCCCCCCCcceeccCCCCccCCcchHHHh
Q psy3948           1 MFVDHTILKCTFCNIIFNKLQD---EELIMTHC---KSC----------K-KPKRPDKSYNYACFICTYHTRKHGDMIGH   63 (143)
Q Consensus         1 ~~~~~~~~~C~~C~~~f~~~~~---~~~~~~~c---~~c----------~-~~~~~~~~~~~~c~~c~~~~~~~~~l~~h   63 (143)
                      |+.-.+.++|+.|+..|.....   |++.....   ..|          . ..+ ....+++.|..|..++.....|.+|
T Consensus       459 L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~-~~~~~p~~C~~C~~stttng~Lsih  537 (1406)
T KOG1146|consen  459 LHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVY-RCPGKPYPCRACNYSTTTNGNLSIH  537 (1406)
T ss_pred             eecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccc-cCCCCcccceeeeeeeecchHHHHH
Confidence            3455689999999999977776   55542200   111          0 111 2334678899999999888888888


Q ss_pred             hhh
Q psy3948          64 MRK   66 (143)
Q Consensus        64 ~~~   66 (143)
                      +..
T Consensus       538 lqS  540 (1406)
T KOG1146|consen  538 LQS  540 (1406)
T ss_pred             HHH
Confidence            764


No 71 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=83.02  E-value=0.21  Score=25.19  Aligned_cols=15  Identities=40%  Similarity=0.709  Sum_probs=11.0

Q ss_pred             cccCCcchhhhccch
Q psy3948           7 ILKCTFCNIIFNKLQ   21 (143)
Q Consensus         7 ~~~C~~C~~~f~~~~   21 (143)
                      -|.|+.||..|..+.
T Consensus         5 ey~C~~Cg~~fe~~~   19 (52)
T TIGR02605         5 EYRCTACGHRFEVLQ   19 (52)
T ss_pred             EEEeCCCCCEeEEEE
Confidence            367999998885543


No 72 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=83.01  E-value=1.3  Score=26.20  Aligned_cols=25  Identities=12%  Similarity=0.163  Sum_probs=23.1

Q ss_pred             eec----ccccccccchHHHHHHHHHHhc
Q psy3948         101 HKC----ANVIIIAIMYHILEIMLEDIQG  125 (143)
Q Consensus       101 ~~C----~~C~~~f~~~s~l~~h~~~~~~  125 (143)
                      |.|    ..|++...+...+.+|.+.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999998875


No 73 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=82.64  E-value=0.87  Score=22.37  Aligned_cols=11  Identities=27%  Similarity=0.495  Sum_probs=6.0

Q ss_pred             cccCCcchhhh
Q psy3948           7 ILKCTFCNIIF   17 (143)
Q Consensus         7 ~~~C~~C~~~f   17 (143)
                      .|.|+.||..|
T Consensus         3 ~y~C~~CG~~~   13 (46)
T PRK00398          3 EYKCARCGREV   13 (46)
T ss_pred             EEECCCCCCEE
Confidence            35555555554


No 74 
>KOG2893|consensus
Probab=81.80  E-value=0.46  Score=32.10  Aligned_cols=21  Identities=19%  Similarity=0.384  Sum_probs=13.9

Q ss_pred             cceeccCCCCccCCcchHHHh
Q psy3948          43 YNYACFICTYHTRKHGDMIGH   63 (143)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~h   63 (143)
                      +.|+|.+|.+.+.+-..|..|
T Consensus        33 khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   33 KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             ccceeeeehhhhccCCCceee
Confidence            457777777776666666555


No 75 
>KOG2231|consensus
Probab=81.76  E-value=2  Score=33.67  Aligned_cols=93  Identities=18%  Similarity=0.201  Sum_probs=47.4

Q ss_pred             hcccCCCCCCCCCCcceeccCCCCccCCcchHHHhhhhcCCCCCccCCCCC---------CCCCChHHHHHHHHHhcC-C
Q psy3948          29 HCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCN---------YSCSTKSALSVHQKRHTG-L   98 (143)
Q Consensus        29 ~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~---------~~f~~~~~l~~h~~~h~~-e   98 (143)
                      .|..|++.+.- ......|..| ..|.....|..|+.....  -+.|..|.         ...-+...|+.|.....- +
T Consensus       101 ~C~~C~~~~~~-~~~~~~~~~c-~~~~s~~~Lk~H~~~~H~--~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~  176 (669)
T KOG2231|consen  101 SCHICDRRFRA-LYNKKECLHC-TEFKSVENLKNHMRDQHK--LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDD  176 (669)
T ss_pred             hcCccccchhh-hcccCCCccc-cchhHHHHHHHHHHHhhh--hhccccccccceeeeeeeehehHHHHHHHHhcCCCcc
Confidence            57777766631 0111235556 455555666777632221  12333322         123344556666553221 2


Q ss_pred             C----ceecccccccccchHHHHHHHHHHhc
Q psy3948          99 K----AHKCANVIIIAIMYHILEIMLEDIQG  125 (143)
Q Consensus        99 ~----~~~C~~C~~~f~~~s~l~~h~~~~~~  125 (143)
                      +    .-.|..|...|.....|.+|++.+|.
T Consensus       177 ~s~rGhp~C~~C~~~fld~~el~rH~~~~h~  207 (669)
T KOG2231|consen  177 ESCRGHPLCKFCHERFLDDDELYRHLRFDHE  207 (669)
T ss_pred             ccccCCccchhhhhhhccHHHHHHhhcccee
Confidence            1    12577777777777777777776653


No 76 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=81.55  E-value=0.91  Score=22.23  Aligned_cols=13  Identities=23%  Similarity=0.401  Sum_probs=7.0

Q ss_pred             ceeccCCCCccCC
Q psy3948          44 NYACFICTYHTRK   56 (143)
Q Consensus        44 ~~~c~~c~~~~~~   56 (143)
                      ...|+.||.....
T Consensus        19 ~irC~~CG~rIly   31 (44)
T smart00659       19 VVRCRECGYRILY   31 (44)
T ss_pred             ceECCCCCceEEE
Confidence            3456666655443


No 77 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=81.47  E-value=0.64  Score=30.19  Aligned_cols=10  Identities=20%  Similarity=0.514  Sum_probs=4.9

Q ss_pred             eeccCCCCcc
Q psy3948          45 YACFICTYHT   54 (143)
Q Consensus        45 ~~c~~c~~~~   54 (143)
                      |.|+.||...
T Consensus       137 F~Cp~Cg~~L  146 (178)
T PRK06266        137 FRCPQCGEML  146 (178)
T ss_pred             CcCCCCCCCC
Confidence            4455555443


No 78 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=81.03  E-value=1.3  Score=26.93  Aligned_cols=28  Identities=4%  Similarity=-0.177  Sum_probs=15.0

Q ss_pred             cccCCCCCCCCCCcceeccCCCCccCCc
Q psy3948          30 CKSCKKPKRPDKSYNYACFICTYHTRKH   57 (143)
Q Consensus        30 c~~c~~~~~~~~~~~~~c~~c~~~~~~~   57 (143)
                      |+.|++.|---.+.|..|+.||..+.-.
T Consensus        12 Cp~cg~kFYDLnk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        12 CPNTGSKFYDLNRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCCcCccccccCCCCccCCCcCCccCcc
Confidence            5555555543333455666676665544


No 79 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=80.54  E-value=1.5  Score=21.46  Aligned_cols=28  Identities=11%  Similarity=-0.040  Sum_probs=22.3

Q ss_pred             eecccccccccchHHHHHHHHHHhcCCC
Q psy3948         101 HKCANVIIIAIMYHILEIMLEDIQGRDH  128 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~~~~~~~~  128 (143)
                      |+|-.|..+..-.|.|..|++-.-+++.
T Consensus        21 ykcfqcpftc~~kshl~nhmky~lckns   48 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKYSLCKNS   48 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHHHhhhhh
Confidence            6888898888899999999886554443


No 80 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=80.00  E-value=1.2  Score=29.89  Aligned_cols=30  Identities=3%  Similarity=-0.076  Sum_probs=21.5

Q ss_pred             CCceecccccccccchHHHHHHHHHHhcCC
Q psy3948          98 LKAHKCANVIIIAIMYHILEIMLEDIQGRD  127 (143)
Q Consensus        98 e~~~~C~~C~~~f~~~s~l~~h~~~~~~~~  127 (143)
                      +..|.|+.|++.|.-..-..+|+...|.+.
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            446889999999999888999988777553


No 81 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=79.62  E-value=1  Score=28.82  Aligned_cols=24  Identities=25%  Similarity=0.531  Sum_probs=16.3

Q ss_pred             CccCCCCCCCCCChHHHHHHHHHhcCCCceecccccc
Q psy3948          72 PLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVII  108 (143)
Q Consensus        72 ~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~  108 (143)
                      .|.|++||.             ++.|+.|.+||.||-
T Consensus       134 ~~vC~vCGy-------------~~~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGY-------------THEGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCC-------------cccCCCCCcCCCCCC
Confidence            577888863             334577778888873


No 82 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=79.51  E-value=1.4  Score=27.57  Aligned_cols=35  Identities=14%  Similarity=0.159  Sum_probs=18.3

Q ss_pred             ceeccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCC
Q psy3948          44 NYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSC   82 (143)
Q Consensus        44 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f   82 (143)
                      .|.|+.|+..|.....+....   . ...|.|+.|+...
T Consensus        99 ~Y~Cp~C~~~y~~~ea~~~~d---~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       99 YYKCPNCQSKYTFLEANQLLD---M-DGTFTCPRCGEEL  133 (147)
T ss_pred             EEECcCCCCEeeHHHHHHhcC---C-CCcEECCCCCCEE
Confidence            466777776666544333211   1 2236777776543


No 83 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=79.39  E-value=2.1  Score=18.29  Aligned_cols=19  Identities=11%  Similarity=0.235  Sum_probs=14.1

Q ss_pred             ecccccccccchHHHHHHHH
Q psy3948         102 KCANVIIIAIMYHILEIMLE  121 (143)
Q Consensus       102 ~C~~C~~~f~~~s~l~~h~~  121 (143)
                      .|+.|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            578888877 5677777776


No 84 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=79.29  E-value=0.74  Score=31.55  Aligned_cols=94  Identities=17%  Similarity=0.268  Sum_probs=54.3

Q ss_pred             hcccCCCCCCCCCCcceeccCCCCccCCcchHHHhhhh-c-CCCCCccCCCCCCCCCChHHH-------HHHHH----Hh
Q psy3948          29 HCKSCKKPKRPDKSYNYACFICTYHTRKHGDMIGHMRK-H-TGVKPLKCSSCNYSCSTKSAL-------SVHQK----RH   95 (143)
Q Consensus        29 ~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~-~-~~~~~~~c~~c~~~f~~~~~l-------~~h~~----~h   95 (143)
                      .|..|.+..+..+.+.|.|..|..-+---..+. |+.. . .....|.|..|.+. ...+-|       ..|.+    ..
T Consensus       127 ~C~EC~R~vw~hGGrif~CsfC~~flCEDDQFE-HQAsCQvLe~E~~KC~SCNrl-Gq~sCLRCK~cfCddHvrrKg~ky  204 (314)
T PF06524_consen  127 VCIECERGVWDHGGRIFKCSFCDNFLCEDDQFE-HQASCQVLESETFKCQSCNRL-GQYSCLRCKICFCDDHVRRKGFKY  204 (314)
T ss_pred             EeeeeecccccCCCeEEEeecCCCeeeccchhh-hhhhhhhhhcccccccccccc-cchhhhheeeeehhhhhhhccccc
Confidence            355666666678888999999986554444443 3221 1 11123566655431 111111       12333    23


Q ss_pred             cCCCceecccccccccchHHHHHHHHHHh
Q psy3948          96 TGLKAHKCANVIIIAIMYHILEIMLEDIQ  124 (143)
Q Consensus        96 ~~e~~~~C~~C~~~f~~~s~l~~h~~~~~  124 (143)
                      ...+++.|+.|+.-.....+|....+.|.
T Consensus       205 ~k~k~~PCPKCg~et~eTkdLSmStR~hk  233 (314)
T PF06524_consen  205 EKGKPIPCPKCGYETQETKDLSMSTRSHK  233 (314)
T ss_pred             ccCCCCCCCCCCCcccccccceeeeecch
Confidence            34578999999998888878877666654


No 85 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=78.86  E-value=0.71  Score=20.61  Aligned_cols=23  Identities=17%  Similarity=0.358  Sum_probs=8.4

Q ss_pred             cccCCCCCCCCCCcceeccCCCC
Q psy3948          30 CKSCKKPKRPDKSYNYACFICTY   52 (143)
Q Consensus        30 c~~c~~~~~~~~~~~~~c~~c~~   52 (143)
                      |+.|+..+.......+.|+.|+.
T Consensus         5 Cp~C~se~~y~D~~~~vCp~C~~   27 (30)
T PF08274_consen    5 CPLCGSEYTYEDGELLVCPECGH   27 (30)
T ss_dssp             -TTT-----EE-SSSEEETTTTE
T ss_pred             CCCCCCcceeccCCEEeCCcccc
Confidence            44444444333344566666654


No 86 
>KOG2186|consensus
Probab=78.50  E-value=1.1  Score=30.60  Aligned_cols=54  Identities=15%  Similarity=0.170  Sum_probs=39.5

Q ss_pred             ccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccchHHHHHHHHHHhcCCCc
Q psy3948          73 LKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMYHILEIMLEDIQGRDHI  129 (143)
Q Consensus        73 ~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~l~~h~~~~~~~~~~  129 (143)
                      |.|..|+... -...+..|+....+ ..|.|..|++.|-. .++..|.+=.+....|
T Consensus         4 FtCnvCgEsv-KKp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCITEaQKY   57 (276)
T KOG2186|consen    4 FTCNVCGESV-KKPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCITEAQKY   57 (276)
T ss_pred             Eehhhhhhhc-cccchHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcchHHHh
Confidence            5788888653 44566778776655 56999999999997 7788887766655444


No 87 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=78.09  E-value=1.8  Score=26.68  Aligned_cols=27  Identities=15%  Similarity=-0.001  Sum_probs=17.5

Q ss_pred             CceecccccccccchHHHHHHHHHHhcCCC
Q psy3948          99 KAHKCANVIIIAIMYHILEIMLEDIQGRDH  128 (143)
Q Consensus        99 ~~~~C~~C~~~f~~~s~l~~h~~~~~~~~~  128 (143)
                      .-..|-+||+.|..   |.+|+..|++-.+
T Consensus        71 d~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   71 DYIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             S-EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             CeeEEccCCcccch---HHHHHHHccCCCH
Confidence            34689999999886   4999999987765


No 88 
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=78.04  E-value=1.3  Score=27.18  Aligned_cols=15  Identities=20%  Similarity=0.288  Sum_probs=8.2

Q ss_pred             CCCCcceeccCCCCc
Q psy3948          39 PDKSYNYACFICTYH   53 (143)
Q Consensus        39 ~~~~~~~~c~~c~~~   53 (143)
                      ..++....|+.|++.
T Consensus       100 i~g~~~~~CPwCg~~  114 (131)
T PF15616_consen  100 IDGEGEVTCPWCGNE  114 (131)
T ss_pred             eCCCCCEECCCCCCe
Confidence            344445566666654


No 89 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=77.63  E-value=1.3  Score=29.62  Aligned_cols=14  Identities=14%  Similarity=0.465  Sum_probs=7.3

Q ss_pred             eeccCCCCccCCcc
Q psy3948          45 YACFICTYHTRKHG   58 (143)
Q Consensus        45 ~~c~~c~~~~~~~~   58 (143)
                      ..||+|+..|..+.
T Consensus         6 ~~CPvC~~~F~~~~   19 (214)
T PF09986_consen    6 ITCPVCGKEFKTKK   19 (214)
T ss_pred             eECCCCCCeeeeeE
Confidence            44555555555443


No 90 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=77.54  E-value=1.5  Score=25.81  Aligned_cols=29  Identities=17%  Similarity=0.452  Sum_probs=20.7

Q ss_pred             hcccCCCCCCCCCCcceeccCCCCccCCc
Q psy3948          29 HCKSCKKPKRPDKSYNYACFICTYHTRKH   57 (143)
Q Consensus        29 ~c~~c~~~~~~~~~~~~~c~~c~~~~~~~   57 (143)
                      .|+.|...|.......+.|++|+..|...
T Consensus         4 ~CP~C~seytY~dg~~~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTYHDGTQLICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceEecCCeeECcccccccccc
Confidence            46667666665566668899998887654


No 91 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=77.17  E-value=1.2  Score=20.24  Aligned_cols=10  Identities=20%  Similarity=0.398  Sum_probs=4.8

Q ss_pred             eeccCCCCcc
Q psy3948          45 YACFICTYHT   54 (143)
Q Consensus        45 ~~c~~c~~~~   54 (143)
                      ..|+.||...
T Consensus        18 irC~~CG~RI   27 (32)
T PF03604_consen   18 IRCPECGHRI   27 (32)
T ss_dssp             SSBSSSS-SE
T ss_pred             EECCcCCCeE
Confidence            3566665443


No 92 
>PRK10220 hypothetical protein; Provisional
Probab=76.91  E-value=2.2  Score=25.22  Aligned_cols=30  Identities=20%  Similarity=0.439  Sum_probs=21.5

Q ss_pred             hcccCCCCCCCCCCcceeccCCCCccCCcc
Q psy3948          29 HCKSCKKPKRPDKSYNYACFICTYHTRKHG   58 (143)
Q Consensus        29 ~c~~c~~~~~~~~~~~~~c~~c~~~~~~~~   58 (143)
                      .|+.|...|.......+.|+.|+..|....
T Consensus         5 ~CP~C~seytY~d~~~~vCpeC~hEW~~~~   34 (111)
T PRK10220          5 HCPKCNSEYTYEDNGMYICPECAHEWNDAE   34 (111)
T ss_pred             cCCCCCCcceEcCCCeEECCcccCcCCccc
Confidence            467777767666666788999888876553


No 93 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=76.25  E-value=0.9  Score=24.84  Aligned_cols=17  Identities=29%  Similarity=0.489  Sum_probs=10.2

Q ss_pred             CCCceecc--cccccccch
Q psy3948          97 GLKAHKCA--NVIIIAIMY  113 (143)
Q Consensus        97 ~e~~~~C~--~C~~~f~~~  113 (143)
                      .++.++|.  +||..|+..
T Consensus        24 ~~~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678         24 KERYHQCQNVNCSATFITY   42 (72)
T ss_pred             heeeeecCCCCCCCEEEEE
Confidence            34556665  677776653


No 94 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=75.73  E-value=0.67  Score=20.31  Aligned_cols=20  Identities=5%  Similarity=-0.139  Sum_probs=11.5

Q ss_pred             eecccccccccchHHHHHHHH
Q psy3948         101 HKCANVIIIAIMYHILEIMLE  121 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~  121 (143)
                      |.|..|++.| .......|.+
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht~   20 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHTS   20 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT---
T ss_pred             CeeecCCCCc-CcCCcCCCCc
Confidence            4677888888 4455555544


No 95 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=74.75  E-value=2.5  Score=33.67  Aligned_cols=29  Identities=21%  Similarity=0.453  Sum_probs=18.8

Q ss_pred             hcCCCCCccCCCCCCCCCChHHHHHHHHHhcCCCceeccccccc
Q psy3948          66 KHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIII  109 (143)
Q Consensus        66 ~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~  109 (143)
                      .|.......|..|+..               ...|..|+.||..
T Consensus       456 ~H~~~~~L~CH~Cg~~---------------~~~p~~Cp~Cgs~  484 (730)
T COG1198         456 LHKATGQLRCHYCGYQ---------------EPIPQSCPECGSE  484 (730)
T ss_pred             EecCCCeeEeCCCCCC---------------CCCCCCCCCCCCC
Confidence            3444456688888742               2357889988865


No 96 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=72.08  E-value=0.82  Score=28.96  Aligned_cols=13  Identities=23%  Similarity=0.488  Sum_probs=7.8

Q ss_pred             ccCCCCCCCCCCh
Q psy3948          73 LKCSSCNYSCSTK   85 (143)
Q Consensus        73 ~~c~~c~~~f~~~   85 (143)
                      +.|+.|+..|...
T Consensus        29 ~~c~~c~~~f~~~   41 (154)
T PRK00464         29 RECLACGKRFTTF   41 (154)
T ss_pred             eeccccCCcceEe
Confidence            5666666665543


No 97 
>PHA00626 hypothetical protein
Probab=71.68  E-value=2.4  Score=21.82  Aligned_cols=16  Identities=6%  Similarity=-0.120  Sum_probs=12.8

Q ss_pred             CCceecccccccccch
Q psy3948          98 LKAHKCANVIIIAIMY  113 (143)
Q Consensus        98 e~~~~C~~C~~~f~~~  113 (143)
                      ...|.|+.||+.|+..
T Consensus        21 snrYkCkdCGY~ft~~   36 (59)
T PHA00626         21 SDDYVCCDCGYNDSKD   36 (59)
T ss_pred             CcceEcCCCCCeechh
Confidence            3579999999998854


No 98 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=71.62  E-value=3.1  Score=26.32  Aligned_cols=17  Identities=18%  Similarity=0.429  Sum_probs=11.2

Q ss_pred             CCccCCCCCCCCCChHH
Q psy3948          71 KPLKCSSCNYSCSTKSA   87 (143)
Q Consensus        71 ~~~~c~~c~~~f~~~~~   87 (143)
                      .|.-|..||+.|.+...
T Consensus        67 ~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   67 APSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CChhHHhCCCCCchHHH
Confidence            56667777777766543


No 99 
>PF14353 CpXC:  CpXC protein
Probab=70.52  E-value=3.3  Score=25.15  Aligned_cols=11  Identities=27%  Similarity=0.703  Sum_probs=8.1

Q ss_pred             cCCcchhhhcc
Q psy3948           9 KCTFCNIIFNK   19 (143)
Q Consensus         9 ~C~~C~~~f~~   19 (143)
                      .||.|+..|..
T Consensus         3 tCP~C~~~~~~   13 (128)
T PF14353_consen    3 TCPHCGHEFEF   13 (128)
T ss_pred             CCCCCCCeeEE
Confidence            58888888744


No 100
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=69.15  E-value=5.1  Score=30.55  Aligned_cols=6  Identities=33%  Similarity=1.337  Sum_probs=2.5

Q ss_pred             cCCCCC
Q psy3948          74 KCSSCN   79 (143)
Q Consensus        74 ~c~~c~   79 (143)
                      .|+.|+
T Consensus       255 ~Cp~C~  260 (505)
T TIGR00595       255 TCPQCG  260 (505)
T ss_pred             CCCCCC
Confidence            344443


No 101
>PRK04023 DNA polymerase II large subunit; Validated
Probab=68.39  E-value=6  Score=32.67  Aligned_cols=9  Identities=33%  Similarity=0.770  Sum_probs=4.4

Q ss_pred             eeccCCCCc
Q psy3948          45 YACFICTYH   53 (143)
Q Consensus        45 ~~c~~c~~~   53 (143)
                      +.|+.||..
T Consensus       639 frCP~CG~~  647 (1121)
T PRK04023        639 RRCPFCGTH  647 (1121)
T ss_pred             ccCCCCCCC
Confidence            445555543


No 102
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=68.00  E-value=4  Score=20.95  Aligned_cols=25  Identities=12%  Similarity=0.066  Sum_probs=10.8

Q ss_pred             HHHHHHHHhcCCCceeccc----cccccc
Q psy3948          87 ALSVHQKRHTGLKAHKCAN----VIIIAI  111 (143)
Q Consensus        87 ~l~~h~~~h~~e~~~~C~~----C~~~f~  111 (143)
                      .|..|....-..++..|+.    |+..+.
T Consensus        25 ~l~~H~~~~C~~~~v~C~~~~~GC~~~~~   53 (60)
T PF02176_consen   25 ELDDHLENECPKRPVPCPYSPYGCKERVP   53 (60)
T ss_dssp             CHHHHHHTTSTTSEEE-SS----S--EEE
T ss_pred             HHHHHHHccCCCCcEECCCCCCCCCCccc
Confidence            4455554333344555655    555544


No 103
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=67.45  E-value=2.9  Score=24.39  Aligned_cols=27  Identities=26%  Similarity=0.626  Sum_probs=17.6

Q ss_pred             cccCCcchhhhccchhhHHHhhhcccCCC
Q psy3948           7 ILKCTFCNIIFNKLQDEELIMTHCKSCKK   35 (143)
Q Consensus         7 ~~~C~~C~~~f~~~~~~~~~~~~c~~c~~   35 (143)
                      ++.|..||.+|..-+..+  ..-|+.|+.
T Consensus         2 pH~CtrCG~vf~~g~~~i--l~GCp~CG~   28 (112)
T COG3364           2 PHQCTRCGEVFDDGSEEI--LSGCPKCGC   28 (112)
T ss_pred             CceecccccccccccHHH--HccCccccc
Confidence            789999999996643322  223777763


No 104
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=67.26  E-value=5.9  Score=25.19  Aligned_cols=32  Identities=9%  Similarity=0.126  Sum_probs=20.7

Q ss_pred             CCCccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccc
Q psy3948          70 VKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIA  110 (143)
Q Consensus        70 ~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f  110 (143)
                      ..-|.|+.|+..|+...++.         .-|.|+.||...
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            34467777777776666553         247788887663


No 105
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=66.95  E-value=6.7  Score=27.85  Aligned_cols=25  Identities=16%  Similarity=0.478  Sum_probs=19.5

Q ss_pred             CCccCCCCCCCCCChHHHHHHHHHh
Q psy3948          71 KPLKCSSCNYSCSTKSALSVHQKRH   95 (143)
Q Consensus        71 ~~~~c~~c~~~f~~~~~l~~h~~~h   95 (143)
                      ..|.|+.|...|...-....|...|
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHh
Confidence            4578888888888888777777665


No 106
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=65.59  E-value=1.7  Score=22.05  Aligned_cols=24  Identities=25%  Similarity=0.332  Sum_probs=10.5

Q ss_pred             cceeccCCCCccCCcchHHHhhhh
Q psy3948          43 YNYACFICTYHTRKHGDMIGHMRK   66 (143)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~h~~~   66 (143)
                      ..|.|+.|...|-..-.+..|...
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~L   43 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHETL   43 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTTS
T ss_pred             CeEECCCCCCccccCcChhhhccc
Confidence            346677776666655555555433


No 107
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=64.53  E-value=3  Score=25.65  Aligned_cols=56  Identities=21%  Similarity=0.314  Sum_probs=32.6

Q ss_pred             cceeccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCCCCh--HHHHHHHHHhcCCCceecccccccccchHH
Q psy3948          43 YNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTK--SALSVHQKRHTGLKAHKCANVIIIAIMYHI  115 (143)
Q Consensus        43 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f~~~--~~l~~h~~~h~~e~~~~C~~C~~~f~~~s~  115 (143)
                      +.|+|.+|..++..+..|          +|=+|  ||......  ..|+.|-.+|.     .|+.|.-+|.+++.
T Consensus        79 ~lYeCnIC~etS~ee~FL----------KPneC--CgY~iCn~Cya~LWK~~~~yp-----vCPvCkTSFKss~~  136 (140)
T PF05290_consen   79 KLYECNICKETSAEERFL----------KPNEC--CGYSICNACYANLWKFCNLYP-----VCPVCKTSFKSSSS  136 (140)
T ss_pred             CceeccCcccccchhhcC----------Ccccc--cchHHHHHHHHHHHHHcccCC-----CCCccccccccccc
Confidence            779999998776654322          23233  33221111  34555554443     69999999887653


No 108
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=64.37  E-value=2.4  Score=20.07  Aligned_cols=14  Identities=29%  Similarity=0.598  Sum_probs=10.0

Q ss_pred             cccCCcchhhhccc
Q psy3948           7 ILKCTFCNIIFNKL   20 (143)
Q Consensus         7 ~~~C~~C~~~f~~~   20 (143)
                      +++|.+|+++|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            67788888887433


No 109
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=63.52  E-value=8.2  Score=17.61  Aligned_cols=23  Identities=17%  Similarity=0.041  Sum_probs=15.9

Q ss_pred             ceecccccccccchHHHHHHHHHH
Q psy3948         100 AHKCANVIIIAIMYHILEIMLEDI  123 (143)
Q Consensus       100 ~~~C~~C~~~f~~~s~l~~h~~~~  123 (143)
                      .+.|+.|++... .+-+..|+..-
T Consensus         4 ~~~C~nC~R~v~-a~RfA~HLekC   26 (33)
T PF08209_consen    4 YVECPNCGRPVA-ASRFAPHLEKC   26 (33)
T ss_dssp             EEE-TTTSSEEE-GGGHHHHHHHH
T ss_pred             eEECCCCcCCcc-hhhhHHHHHHH
Confidence            468999998655 56688887754


No 110
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=63.45  E-value=2.6  Score=30.31  Aligned_cols=23  Identities=13%  Similarity=-0.142  Sum_probs=13.2

Q ss_pred             ecccccccccchHHHHHHHHHHh
Q psy3948         102 KCANVIIIAIMYHILEIMLEDIQ  124 (143)
Q Consensus       102 ~C~~C~~~f~~~s~l~~h~~~~~  124 (143)
                      .|..|...|-+...|.+|.+..|
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H  244 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH  244 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh
Confidence            35556666666666666655443


No 111
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=62.65  E-value=4.8  Score=24.08  Aligned_cols=6  Identities=33%  Similarity=0.910  Sum_probs=2.7

Q ss_pred             eccCCC
Q psy3948          46 ACFICT   51 (143)
Q Consensus        46 ~c~~c~   51 (143)
                      .||.||
T Consensus        89 ~CP~Cg   94 (114)
T PRK03681         89 RCPQCH   94 (114)
T ss_pred             cCcCcC
Confidence            344444


No 112
>PRK14873 primosome assembly protein PriA; Provisional
Probab=62.54  E-value=6.9  Score=31.00  Aligned_cols=10  Identities=20%  Similarity=0.783  Sum_probs=6.1

Q ss_pred             CccCCCCCCC
Q psy3948          72 PLKCSSCNYS   81 (143)
Q Consensus        72 ~~~c~~c~~~   81 (143)
                      |..|+.|+..
T Consensus       422 p~~Cp~Cgs~  431 (665)
T PRK14873        422 DWRCPRCGSD  431 (665)
T ss_pred             CccCCCCcCC
Confidence            4567777643


No 113
>PRK00420 hypothetical protein; Validated
Probab=62.05  E-value=7.4  Score=23.28  Aligned_cols=27  Identities=22%  Similarity=0.268  Sum_probs=17.2

Q ss_pred             hcccCCCCCCCCCCcceeccCCCCccC
Q psy3948          29 HCKSCKKPKRPDKSYNYACFICTYHTR   55 (143)
Q Consensus        29 ~c~~c~~~~~~~~~~~~~c~~c~~~~~   55 (143)
                      .|+.|+.++..-.+....|+.||....
T Consensus        25 ~CP~Cg~pLf~lk~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         25 HCPVCGLPLFELKDGEVVCPVHGKVYI   51 (112)
T ss_pred             CCCCCCCcceecCCCceECCCCCCeee
Confidence            688888666432444556888887544


No 114
>KOG2593|consensus
Probab=61.27  E-value=6.9  Score=29.03  Aligned_cols=19  Identities=16%  Similarity=0.391  Sum_probs=13.0

Q ss_pred             CCccccCCcchhhhccchh
Q psy3948           4 DHTILKCTFCNIIFNKLQD   22 (143)
Q Consensus         4 ~~~~~~C~~C~~~f~~~~~   22 (143)
                      ...-|.|+.|++.|..+.-
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea  143 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEA  143 (436)
T ss_pred             ccccccCCccccchhhhHH
Confidence            4456778888877766655


No 115
>KOG3408|consensus
Probab=60.88  E-value=6.8  Score=23.69  Aligned_cols=22  Identities=14%  Similarity=0.125  Sum_probs=19.6

Q ss_pred             ceecccccccccchHHHHHHHH
Q psy3948         100 AHKCANVIIIAIMYHILEIMLE  121 (143)
Q Consensus       100 ~~~C~~C~~~f~~~s~l~~h~~  121 (143)
                      .|-|..|.+.|.+...|..|.+
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHh
Confidence            4789999999999999999966


No 116
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=60.00  E-value=5.4  Score=18.21  Aligned_cols=9  Identities=33%  Similarity=1.147  Sum_probs=4.3

Q ss_pred             eeccCCCCc
Q psy3948          45 YACFICTYH   53 (143)
Q Consensus        45 ~~c~~c~~~   53 (143)
                      +.|..||..
T Consensus         3 ~~C~~CG~i   11 (34)
T cd00729           3 WVCPVCGYI   11 (34)
T ss_pred             EECCCCCCE
Confidence            445555543


No 117
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=59.86  E-value=1.1  Score=21.58  Aligned_cols=10  Identities=20%  Similarity=0.404  Sum_probs=5.4

Q ss_pred             eeccCCCCcc
Q psy3948          45 YACFICTYHT   54 (143)
Q Consensus        45 ~~c~~c~~~~   54 (143)
                      +.|..||...
T Consensus        20 ~vC~~CG~Vl   29 (43)
T PF08271_consen   20 LVCPNCGLVL   29 (43)
T ss_dssp             EEETTT-BBE
T ss_pred             EECCCCCCEe
Confidence            4677776543


No 118
>PF12907 zf-met2:  Zinc-binding
Probab=59.79  E-value=5.5  Score=19.06  Aligned_cols=27  Identities=11%  Similarity=0.012  Sum_probs=18.6

Q ss_pred             eecccccccccc---hHHHHHHHHHHhcCC
Q psy3948         101 HKCANVIIIAIM---YHILEIMLEDIQGRD  127 (143)
Q Consensus       101 ~~C~~C~~~f~~---~s~l~~h~~~~~~~~  127 (143)
                      +.|..|...|..   ...|..|....|.+.
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            568888865544   567888888666554


No 119
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=59.32  E-value=8.8  Score=19.31  Aligned_cols=7  Identities=29%  Similarity=1.132  Sum_probs=3.6

Q ss_pred             ccCCCCC
Q psy3948          73 LKCSSCN   79 (143)
Q Consensus        73 ~~c~~c~   79 (143)
                      +.|..|+
T Consensus        38 ~~C~~Cg   44 (50)
T PRK00432         38 WHCGKCG   44 (50)
T ss_pred             EECCCcC
Confidence            4555554


No 120
>PF12773 DZR:  Double zinc ribbon
Probab=58.85  E-value=7.7  Score=19.13  Aligned_cols=6  Identities=33%  Similarity=0.778  Sum_probs=2.3

Q ss_pred             ccCCCC
Q psy3948          47 CFICTY   52 (143)
Q Consensus        47 c~~c~~   52 (143)
                      |+.||.
T Consensus        15 C~~CG~   20 (50)
T PF12773_consen   15 CPHCGT   20 (50)
T ss_pred             ChhhcC
Confidence            334443


No 121
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=58.81  E-value=9.2  Score=28.87  Aligned_cols=26  Identities=8%  Similarity=-0.164  Sum_probs=22.7

Q ss_pred             ceecccccccccchHHHHHHHHHHhc
Q psy3948         100 AHKCANVIIIAIMYHILEIMLEDIQG  125 (143)
Q Consensus       100 ~~~C~~C~~~f~~~s~l~~h~~~~~~  125 (143)
                      -|.|+.|.+.|.+...+..|+...|-
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhh
Confidence            46899999999999999999986663


No 122
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=58.13  E-value=6.7  Score=23.60  Aligned_cols=10  Identities=20%  Similarity=0.368  Sum_probs=4.6

Q ss_pred             eeccCCCCcc
Q psy3948          45 YACFICTYHT   54 (143)
Q Consensus        45 ~~c~~c~~~~   54 (143)
                      +.|..||..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            4455555333


No 123
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=58.05  E-value=19  Score=26.11  Aligned_cols=75  Identities=13%  Similarity=0.123  Sum_probs=43.7

Q ss_pred             eccCCCCccCCcchHHHhhhhcCCCCCccCCCCCC----CCCChHHHHHHHHHhcCCCceeccc--cc----ccccchHH
Q psy3948          46 ACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNY----SCSTKSALSVHQKRHTGLKAHKCAN--VI----IIAIMYHI  115 (143)
Q Consensus        46 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~----~f~~~~~l~~h~~~h~~e~~~~C~~--C~----~~f~~~s~  115 (143)
                      .|..|...|-.-..|..|.+.. .++-+.|.+-+.    -|..-..|..|-+.    -.|.|..  |.    +.|.+...
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~-HE~ChICD~v~p~~~QYFK~Y~~Le~HF~~----~hy~ct~qtc~~~k~~vf~~~~e  296 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLR-HEACHICDMVGPIRYQYFKSYEDLEAHFRN----AHYCCTFQTCRVGKCYVFPYHTE  296 (493)
T ss_pred             hhhhccceecChHHHHHHHHhh-hhhhhhhhccCccchhhhhCHHHHHHHhhc----CceEEEEEEEecCcEEEeccHHH
Confidence            4777777777777777776642 233344444332    24555566666542    1355543  22    35778888


Q ss_pred             HHHHHHHHhc
Q psy3948         116 LEIMLEDIQG  125 (143)
Q Consensus       116 l~~h~~~~~~  125 (143)
                      |..|+..-|+
T Consensus       297 l~~h~~~~h~  306 (493)
T COG5236         297 LLEHLTRFHK  306 (493)
T ss_pred             HHHHHHHHhh
Confidence            8888776664


No 124
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=57.72  E-value=6.9  Score=23.22  Aligned_cols=26  Identities=4%  Similarity=-0.345  Sum_probs=12.8

Q ss_pred             cccCCCCCCCCCCcceeccCCCCccC
Q psy3948          30 CKSCKKPKRPDKSYNYACFICTYHTR   55 (143)
Q Consensus        30 c~~c~~~~~~~~~~~~~c~~c~~~~~   55 (143)
                      |+.|++.|---...|..|+.||++|+
T Consensus        12 dPetg~KFYDLNrdPiVsPytG~s~P   37 (129)
T COG4530          12 DPETGKKFYDLNRDPIVSPYTGKSYP   37 (129)
T ss_pred             CccccchhhccCCCccccCcccccch
Confidence            44444444322234455666666664


No 125
>PRK05580 primosome assembly protein PriA; Validated
Probab=57.64  E-value=11  Score=30.02  Aligned_cols=6  Identities=33%  Similarity=1.309  Sum_probs=2.4

Q ss_pred             cCCCCC
Q psy3948          74 KCSSCN   79 (143)
Q Consensus        74 ~c~~c~   79 (143)
                      .|+.|+
T Consensus       423 ~Cp~Cg  428 (679)
T PRK05580        423 ACPECG  428 (679)
T ss_pred             CCCCCc
Confidence            344443


No 126
>KOG0978|consensus
Probab=57.48  E-value=1.6  Score=34.37  Aligned_cols=12  Identities=33%  Similarity=0.844  Sum_probs=6.5

Q ss_pred             cCCCCCCCCCCh
Q psy3948          74 KCSSCNYSCSTK   85 (143)
Q Consensus        74 ~c~~c~~~f~~~   85 (143)
                      .||.|+.+|..-
T Consensus       680 KCP~Cn~aFgan  691 (698)
T KOG0978|consen  680 KCPKCNAAFGAN  691 (698)
T ss_pred             CCCCCCCCCCcc
Confidence            455665555443


No 127
>KOG2785|consensus
Probab=56.63  E-value=13  Score=27.22  Aligned_cols=27  Identities=11%  Similarity=-0.100  Sum_probs=22.0

Q ss_pred             CCCceecccccccccchHHHHHHHHHH
Q psy3948          97 GLKAHKCANVIIIAIMYHILEIMLEDI  123 (143)
Q Consensus        97 ~e~~~~C~~C~~~f~~~s~l~~h~~~~  123 (143)
                      ++-++.|..|.+.|.+......|++..
T Consensus        65 ~~~~~~c~~c~k~~~s~~a~~~hl~Sk   91 (390)
T KOG2785|consen   65 AESVVYCEACNKSFASPKAHENHLKSK   91 (390)
T ss_pred             cccceehHHhhccccChhhHHHHHHHh
Confidence            445788999999999999888887743


No 128
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=56.56  E-value=1.9  Score=22.16  Aligned_cols=10  Identities=20%  Similarity=0.657  Sum_probs=6.5

Q ss_pred             ccCCcchhhh
Q psy3948           8 LKCTFCNIIF   17 (143)
Q Consensus         8 ~~C~~C~~~f   17 (143)
                      ++|+.||..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            4677777754


No 129
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=55.62  E-value=1.2  Score=21.20  Aligned_cols=11  Identities=9%  Similarity=-0.179  Sum_probs=6.7

Q ss_pred             ceecccccccc
Q psy3948         100 AHKCANVIIIA  110 (143)
Q Consensus       100 ~~~C~~C~~~f  110 (143)
                      -|.|..|+..+
T Consensus        28 fy~C~~C~~~w   38 (40)
T smart00440       28 FYVCTKCGHRW   38 (40)
T ss_pred             EEEeCCCCCEe
Confidence            36666666554


No 130
>PRK11823 DNA repair protein RadA; Provisional
Probab=55.61  E-value=6.7  Score=29.41  Aligned_cols=32  Identities=22%  Similarity=0.335  Sum_probs=23.2

Q ss_pred             CCCCCccccCCcchhhhccchhhHHHhhhcccCCCCCC
Q psy3948           1 MFVDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKR   38 (143)
Q Consensus         1 ~~~~~~~~~C~~C~~~f~~~~~~~~~~~~c~~c~~~~~   38 (143)
                      |-..+..|.|..||-.+.+...      .|+.|+.+-.
T Consensus         1 m~~~~~~y~C~~Cg~~~~~~~g------~Cp~C~~w~t   32 (446)
T PRK11823          1 MAKKKTAYVCQECGAESPKWLG------RCPECGAWNT   32 (446)
T ss_pred             CCCCCCeEECCcCCCCCcccCe------eCcCCCCccc
Confidence            4445678999999998755544      4999987654


No 131
>KOG2907|consensus
Probab=55.43  E-value=6.5  Score=23.45  Aligned_cols=39  Identities=15%  Similarity=0.245  Sum_probs=21.9

Q ss_pred             CccCCCCCCCCCChHHHHHHHHH-hcCC-Cceecccccccccc
Q psy3948          72 PLKCSSCNYSCSTKSALSVHQKR-HTGL-KAHKCANVIIIAIM  112 (143)
Q Consensus        72 ~~~c~~c~~~f~~~~~l~~h~~~-h~~e-~~~~C~~C~~~f~~  112 (143)
                      ...|+.|+..=..-..++.  |+ -.|+ .-|.|+.|++.|+.
T Consensus        74 ~~kCpkCghe~m~Y~T~Ql--RSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   74 KHKCPKCGHEEMSYHTLQL--RSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             hccCcccCCchhhhhhhhc--ccccCCceEEEEcCccceeeec
Confidence            3578888854222222221  22 1222 35899999998874


No 132
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=55.37  E-value=11  Score=15.50  Aligned_cols=6  Identities=33%  Similarity=0.744  Sum_probs=2.8

Q ss_pred             ccCCCC
Q psy3948          47 CFICTY   52 (143)
Q Consensus        47 c~~c~~   52 (143)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            444443


No 133
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=52.11  E-value=4.6  Score=19.34  Aligned_cols=11  Identities=18%  Similarity=0.854  Sum_probs=6.6

Q ss_pred             cccCCcchhhh
Q psy3948           7 ILKCTFCNIIF   17 (143)
Q Consensus         7 ~~~C~~C~~~f   17 (143)
                      +-.|++|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            45666666654


No 134
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=51.62  E-value=8.1  Score=22.13  Aligned_cols=32  Identities=9%  Similarity=0.190  Sum_probs=19.0

Q ss_pred             CccCCCCCCCCCChHHHHHHHHHhcCCCceecccccccccch
Q psy3948          72 PLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIIIAIMY  113 (143)
Q Consensus        72 ~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~f~~~  113 (143)
                      .|.|+.|++.-..        +..  .-.|.|..|++.|..-
T Consensus        36 ~y~CpfCgk~~vk--------R~a--~GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         36 KYFCPFCGKHAVK--------RQA--VGIWRCKGCKKTVAGG   67 (90)
T ss_pred             CccCCCCCCCcee--------eee--eEEEEcCCCCCEEeCC
Confidence            5778888643111        122  2368888888887653


No 135
>PRK12496 hypothetical protein; Provisional
Probab=51.09  E-value=12  Score=24.07  Aligned_cols=8  Identities=63%  Similarity=1.261  Sum_probs=3.9

Q ss_pred             cccCCCCC
Q psy3948          30 CKSCKKPK   37 (143)
Q Consensus        30 c~~c~~~~   37 (143)
                      |+.|++.|
T Consensus       130 C~gC~~~~  137 (164)
T PRK12496        130 CKGCKKKY  137 (164)
T ss_pred             CCCCCccc
Confidence            44454444


No 136
>COG1773 Rubredoxin [Energy production and conversion]
Probab=50.77  E-value=8.2  Score=19.89  Aligned_cols=12  Identities=8%  Similarity=0.102  Sum_probs=8.7

Q ss_pred             ceeccccccccc
Q psy3948         100 AHKCANVIIIAI  111 (143)
Q Consensus       100 ~~~C~~C~~~f~  111 (143)
                      .|+|..||.+|-
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            577888887764


No 137
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=49.83  E-value=8.9  Score=23.72  Aligned_cols=15  Identities=13%  Similarity=0.111  Sum_probs=10.1

Q ss_pred             cceeccCCCCccCCc
Q psy3948          43 YNYACFICTYHTRKH   57 (143)
Q Consensus        43 ~~~~c~~c~~~~~~~   57 (143)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            447788888776543


No 138
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=49.49  E-value=8.9  Score=20.34  Aligned_cols=27  Identities=19%  Similarity=0.194  Sum_probs=8.9

Q ss_pred             cccCCCCCCCCCCcceeccCCCCccCCc
Q psy3948          30 CKSCKKPKRPDKSYNYACFICTYHTRKH   57 (143)
Q Consensus        30 c~~c~~~~~~~~~~~~~c~~c~~~~~~~   57 (143)
                      |..|++.|. ...+.+.|..||..+-..
T Consensus        12 C~~C~~~F~-~~~rrhhCr~CG~~vC~~   38 (69)
T PF01363_consen   12 CMICGKKFS-LFRRRHHCRNCGRVVCSS   38 (69)
T ss_dssp             -TTT--B-B-SSS-EEE-TTT--EEECC
T ss_pred             CcCcCCcCC-CceeeEccCCCCCEECCc
Confidence            455555552 223345566666655433


No 139
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=49.27  E-value=14  Score=15.52  Aligned_cols=6  Identities=33%  Similarity=0.728  Sum_probs=2.7

Q ss_pred             ccCCCC
Q psy3948          47 CFICTY   52 (143)
Q Consensus        47 c~~c~~   52 (143)
                      |+.||.
T Consensus        19 C~~CG~   24 (26)
T PF13248_consen   19 CPNCGA   24 (26)
T ss_pred             ChhhCC
Confidence            444443


No 140
>KOG4167|consensus
Probab=49.11  E-value=6.8  Score=31.16  Aligned_cols=28  Identities=4%  Similarity=0.065  Sum_probs=24.6

Q ss_pred             ceecccccccccchHHHHHHHHHHhcCC
Q psy3948         100 AHKCANVIIIAIMYHILEIMLEDIQGRD  127 (143)
Q Consensus       100 ~~~C~~C~~~f~~~s~l~~h~~~~~~~~  127 (143)
                      .|.|.+|++.|-.-..+.-|++.|.-+.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~q~  819 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQQE  819 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHHHH
Confidence            5899999999999889999999888554


No 141
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=49.00  E-value=11  Score=22.01  Aligned_cols=18  Identities=17%  Similarity=0.357  Sum_probs=14.0

Q ss_pred             HhcCCCceecccccccccc
Q psy3948          94 RHTGLKAHKCANVIIIAIM  112 (143)
Q Consensus        94 ~h~~e~~~~C~~C~~~f~~  112 (143)
                      .+.+ +|+.|.+||..|..
T Consensus        74 l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          74 LEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EeCC-CceeCCCCCcEEEE
Confidence            4445 68999999999875


No 142
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=48.96  E-value=19  Score=25.40  Aligned_cols=28  Identities=14%  Similarity=-0.045  Sum_probs=23.7

Q ss_pred             CCceecccccccccchHHHHHHHHHHhc
Q psy3948          98 LKAHKCANVIIIAIMYHILEIMLEDIQG  125 (143)
Q Consensus        98 e~~~~C~~C~~~f~~~s~l~~h~~~~~~  125 (143)
                      ..-|.|..|-+-|.+...|.+|+....-
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~C~~   73 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAKCDI   73 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHhCCC
Confidence            4579999999999999999999886553


No 143
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=48.61  E-value=3  Score=32.89  Aligned_cols=76  Identities=16%  Similarity=0.315  Sum_probs=42.7

Q ss_pred             hcccCCCCCCCCCC----ccee-ccCCCCccCCcchHHHhhhhcCCCCCc-cCCCCCCCCCChHHHHHHHHHhcCCCcee
Q psy3948          29 HCKSCKKPKRPDKS----YNYA-CFICTYHTRKHGDMIGHMRKHTGVKPL-KCSSCNYSCSTKSALSVHQKRHTGLKAHK  102 (143)
Q Consensus        29 ~c~~c~~~~~~~~~----~~~~-c~~c~~~~~~~~~l~~h~~~~~~~~~~-~c~~c~~~f~~~~~l~~h~~~h~~e~~~~  102 (143)
                      .|+.|.+......+    +||. |..||.+|.....+--. |.++.-.+| .|+.|.+.|....+    +|.|.  .|..
T Consensus       103 ~C~~Cl~Ei~dp~~rrY~YPF~~CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~n----RRfHA--Qp~a  175 (750)
T COG0068         103 TCEDCLEEIFDPNSRRYLYPFINCTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLN----RRFHA--QPIA  175 (750)
T ss_pred             hhHHHHHHhcCCCCcceeccccccCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCccc----ccccc--cccc
Confidence            46666543322221    2333 88888888766555332 334444555 47777766655543    23343  3678


Q ss_pred             ccccccccc
Q psy3948         103 CANVIIIAI  111 (143)
Q Consensus       103 C~~C~~~f~  111 (143)
                      |+.||-...
T Consensus       176 Cp~CGP~~~  184 (750)
T COG0068         176 CPKCGPHLF  184 (750)
T ss_pred             CcccCCCeE
Confidence            888887433


No 144
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=47.85  E-value=11  Score=23.31  Aligned_cols=25  Identities=16%  Similarity=-0.079  Sum_probs=20.5

Q ss_pred             eecccccccccchHHHHHHHHHHhcCCC
Q psy3948         101 HKCANVIIIAIMYHILEIMLEDIQGRDH  128 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~~~~~~~~  128 (143)
                      ..|-++|+.|.   .|++|+.+|.+-.|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCCH
Confidence            57999999987   48999999887655


No 145
>PLN02294 cytochrome c oxidase subunit Vb
Probab=47.29  E-value=11  Score=24.27  Aligned_cols=16  Identities=13%  Similarity=0.054  Sum_probs=13.2

Q ss_pred             CCceecccccccccch
Q psy3948          98 LKAHKCANVIIIAIMY  113 (143)
Q Consensus        98 e~~~~C~~C~~~f~~~  113 (143)
                      .+|+.|++||..|...
T Consensus       139 Gkp~RCpeCG~~fkL~  154 (174)
T PLN02294        139 GKSFECPVCTQYFELE  154 (174)
T ss_pred             CCceeCCCCCCEEEEE
Confidence            3688999999999754


No 146
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=47.26  E-value=8.8  Score=18.46  Aligned_cols=15  Identities=13%  Similarity=0.058  Sum_probs=9.5

Q ss_pred             Cceecccccccccch
Q psy3948          99 KAHKCANVIIIAIMY  113 (143)
Q Consensus        99 ~~~~C~~C~~~f~~~  113 (143)
                      .|+.|..|+..|=..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            478999999988754


No 147
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=47.05  E-value=4.1  Score=28.58  Aligned_cols=69  Identities=16%  Similarity=0.292  Sum_probs=25.7

Q ss_pred             hcccCCCCCC------CC--CCcceeccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCCCChHHHHHHHHHhcCCCc
Q psy3948          29 HCKSCKKPKR------PD--KSYNYACFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKRHTGLKA  100 (143)
Q Consensus        29 ~c~~c~~~~~------~~--~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~  100 (143)
                      .|+.||....      ..  +.+-..|..|+..+...              ...|+.|+..-...-.... ..--.+.+.
T Consensus       174 ~CPvCGs~P~~s~l~~~~~~G~R~L~Cs~C~t~W~~~--------------R~~Cp~Cg~~~~~~l~~~~-~e~~~~~rv  238 (290)
T PF04216_consen  174 YCPVCGSPPVLSVLRGGEREGKRYLHCSLCGTEWRFV--------------RIKCPYCGNTDHEKLEYFT-VEGEPAYRV  238 (290)
T ss_dssp             S-TTT---EEEEEEE------EEEEEETTT--EEE----------------TTS-TTT---SS-EEE---------SEEE
T ss_pred             cCCCCCCcCceEEEecCCCCccEEEEcCCCCCeeeec--------------CCCCcCCCCCCCcceeeEe-cCCCCcEEE
Confidence            4666665443      11  23445577776554432              2468888754222211100 011123456


Q ss_pred             eecccccccccc
Q psy3948         101 HKCANVIIIAIM  112 (143)
Q Consensus       101 ~~C~~C~~~f~~  112 (143)
                      +.|..|+...+.
T Consensus       239 e~C~~C~~YlK~  250 (290)
T PF04216_consen  239 EVCESCGSYLKT  250 (290)
T ss_dssp             EEETTTTEEEEE
T ss_pred             EECCcccchHHH
Confidence            788888866544


No 148
>KOG2785|consensus
Probab=46.91  E-value=41  Score=24.74  Aligned_cols=59  Identities=10%  Similarity=0.082  Sum_probs=45.1

Q ss_pred             CCccCCCCCCCCCChHHHHHHHHHhcCC-----------------------Cceeccccc---ccccchHHHHHHHH-HH
Q psy3948          71 KPLKCSSCNYSCSTKSALSVHQKRHTGL-----------------------KAHKCANVI---IIAIMYHILEIMLE-DI  123 (143)
Q Consensus        71 ~~~~c~~c~~~f~~~~~l~~h~~~h~~e-----------------------~~~~C~~C~---~~f~~~s~l~~h~~-~~  123 (143)
                      .|-.|..|++.+.....-..|+..++|=                       +-+.|-.|.   +.|.+....+.|+. +.
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K~  244 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDKG  244 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhcc
Confidence            3567888888888887778887655441                       236788888   89999999999977 77


Q ss_pred             hcCCCc
Q psy3948         124 QGRDHI  129 (143)
Q Consensus       124 ~~~~~~  129 (143)
                      |++.+|
T Consensus       245 HCkl~y  250 (390)
T KOG2785|consen  245 HCKLPY  250 (390)
T ss_pred             CcccCC
Confidence            788887


No 149
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=46.41  E-value=14  Score=26.41  Aligned_cols=14  Identities=21%  Similarity=0.328  Sum_probs=8.5

Q ss_pred             Cceecccccccccc
Q psy3948          99 KAHKCANVIIIAIM  112 (143)
Q Consensus        99 ~~~~C~~C~~~f~~  112 (143)
                      +...|..|+...+.
T Consensus       251 r~e~C~~C~~YlK~  264 (309)
T PRK03564        251 KAESCGDCGTYLKI  264 (309)
T ss_pred             Eeeeccccccccee
Confidence            45677777755443


No 150
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=45.94  E-value=17  Score=19.22  Aligned_cols=7  Identities=29%  Similarity=1.274  Sum_probs=3.3

Q ss_pred             ccCCCCC
Q psy3948          73 LKCSSCN   79 (143)
Q Consensus        73 ~~c~~c~   79 (143)
                      +.|+.|+
T Consensus        47 ~~C~~Cg   53 (69)
T PF07282_consen   47 FTCPNCG   53 (69)
T ss_pred             EEcCCCC
Confidence            4444444


No 151
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=45.92  E-value=12  Score=22.39  Aligned_cols=8  Identities=25%  Similarity=0.700  Sum_probs=3.5

Q ss_pred             eeccCCCC
Q psy3948          45 YACFICTY   52 (143)
Q Consensus        45 ~~c~~c~~   52 (143)
                      ..|..||.
T Consensus        71 ~~C~~Cg~   78 (113)
T PRK12380         71 AWCWDCSQ   78 (113)
T ss_pred             EEcccCCC
Confidence            34444443


No 152
>KOG2893|consensus
Probab=45.46  E-value=6.6  Score=26.78  Aligned_cols=41  Identities=27%  Similarity=0.585  Sum_probs=21.9

Q ss_pred             ccCCCCccCCcchHHHhhhhcCCCCCccCCCCCCCCCChHHHHHH
Q psy3948          47 CFICTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVH   91 (143)
Q Consensus        47 c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f~~~~~l~~h   91 (143)
                      |=+|++.|-.+..|..|++    .+-|.|..|.+.+.+...|..|
T Consensus        13 cwycnrefddekiliqhqk----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhh----hccceeeeehhhhccCCCceee
Confidence            4456666666655555433    2445666665554444444444


No 153
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=44.81  E-value=12  Score=28.20  Aligned_cols=30  Identities=20%  Similarity=0.429  Sum_probs=21.5

Q ss_pred             CCCccccCCcchhhhccchhhHHHhhhcccCCCCCC
Q psy3948           3 VDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKR   38 (143)
Q Consensus         3 ~~~~~~~C~~C~~~f~~~~~~~~~~~~c~~c~~~~~   38 (143)
                      ..+..|.|..||-.+.++..      .|+.|+.+-.
T Consensus         3 ~~~~~y~C~~Cg~~~~~~~g------~Cp~C~~w~t   32 (454)
T TIGR00416         3 KAKSKFVCQHCGADSPKWQG------KCPACHAWNT   32 (454)
T ss_pred             CCCCeEECCcCCCCCccccE------ECcCCCCccc
Confidence            34567999999998755443      4888886543


No 154
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=44.71  E-value=31  Score=16.40  Aligned_cols=10  Identities=10%  Similarity=0.308  Sum_probs=4.6

Q ss_pred             eccccccccc
Q psy3948         102 KCANVIIIAI  111 (143)
Q Consensus       102 ~C~~C~~~f~  111 (143)
                      .|+.||-.|.
T Consensus        15 ~C~~CgM~Y~   24 (41)
T PF13878_consen   15 TCPTCGMLYS   24 (41)
T ss_pred             CCCCCCCEEC
Confidence            4445544433


No 155
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=44.07  E-value=16  Score=21.61  Aligned_cols=22  Identities=18%  Similarity=0.104  Sum_probs=19.4

Q ss_pred             ceecccccccccchHHHHHHHH
Q psy3948         100 AHKCANVIIIAIMYHILEIMLE  121 (143)
Q Consensus       100 ~~~C~~C~~~f~~~s~l~~h~~  121 (143)
                      .+-|.+|.+.|.+...|..|++
T Consensus        55 qhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhc
Confidence            3679999999999999999976


No 156
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=43.18  E-value=8.5  Score=17.95  Aligned_cols=12  Identities=33%  Similarity=0.794  Sum_probs=5.1

Q ss_pred             ccccCCcchhhh
Q psy3948           6 TILKCTFCNIIF   17 (143)
Q Consensus         6 ~~~~C~~C~~~f   17 (143)
                      +.|+|+.||-..
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            456666666543


No 157
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=43.11  E-value=17  Score=17.64  Aligned_cols=11  Identities=9%  Similarity=0.090  Sum_probs=7.4

Q ss_pred             CCceecccccc
Q psy3948          98 LKAHKCANVII  108 (143)
Q Consensus        98 e~~~~C~~C~~  108 (143)
                      ...|.|..|++
T Consensus        35 ~~~~~C~~C~~   45 (46)
T PF12760_consen   35 RGRYRCKACRK   45 (46)
T ss_pred             CCeEECCCCCC
Confidence            45677777764


No 158
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=42.87  E-value=15  Score=22.04  Aligned_cols=11  Identities=18%  Similarity=0.419  Sum_probs=5.0

Q ss_pred             eeccCCCCccC
Q psy3948          45 YACFICTYHTR   55 (143)
Q Consensus        45 ~~c~~c~~~~~   55 (143)
                      ..|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            44555554433


No 159
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=42.60  E-value=21  Score=17.94  Aligned_cols=11  Identities=18%  Similarity=0.138  Sum_probs=5.5

Q ss_pred             eeccCCCCccC
Q psy3948          45 YACFICTYHTR   55 (143)
Q Consensus        45 ~~c~~c~~~~~   55 (143)
                      +.|..||+.+-
T Consensus        19 ~~Cr~Cg~~~C   29 (57)
T cd00065          19 HHCRNCGRIFC   29 (57)
T ss_pred             cccCcCcCCcC
Confidence            34555555544


No 160
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=42.36  E-value=3.9  Score=24.42  Aligned_cols=11  Identities=18%  Similarity=0.259  Sum_probs=4.3

Q ss_pred             eeccCCCCccC
Q psy3948          45 YACFICTYHTR   55 (143)
Q Consensus        45 ~~c~~c~~~~~   55 (143)
                      ..|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            34444444443


No 161
>KOG1842|consensus
Probab=42.10  E-value=16  Score=27.35  Aligned_cols=24  Identities=13%  Similarity=0.054  Sum_probs=13.2

Q ss_pred             eecccccccccchHHHHHHHHHHh
Q psy3948         101 HKCANVIIIAIMYHILEIMLEDIQ  124 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~~~~  124 (143)
                      |.|+.|+..|..-+.|..|+...|
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhc
Confidence            455555555555555555555444


No 162
>KOG1280|consensus
Probab=41.91  E-value=22  Score=25.80  Aligned_cols=32  Identities=6%  Similarity=0.058  Sum_probs=22.3

Q ss_pred             CCceecccccccccchHHHHHHHHHHhcCCCc
Q psy3948          98 LKAHKCANVIIIAIMYHILEIMLEDIQGRDHI  129 (143)
Q Consensus        98 e~~~~C~~C~~~f~~~s~l~~h~~~~~~~~~~  129 (143)
                      +.-|.|+.|+.+-.+...|..|+...|.+-.+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~  108 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEAST  108 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCc
Confidence            34577777777777777777777777655543


No 163
>PF14369 zf-RING_3:  zinc-finger
Probab=41.78  E-value=9.4  Score=17.59  Aligned_cols=10  Identities=30%  Similarity=0.550  Sum_probs=8.2

Q ss_pred             cCCcchhhhc
Q psy3948           9 KCTFCNIIFN   18 (143)
Q Consensus         9 ~C~~C~~~f~   18 (143)
                      .|+.|+.+|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5999998884


No 164
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=41.53  E-value=4.5  Score=23.55  Aligned_cols=13  Identities=15%  Similarity=0.324  Sum_probs=9.4

Q ss_pred             CccccCCcchhhh
Q psy3948           5 HTILKCTFCNIIF   17 (143)
Q Consensus         5 ~~~~~C~~C~~~f   17 (143)
                      ++.|.|+.||..-
T Consensus        20 ~k~FtCp~Cghe~   32 (104)
T COG4888          20 PKTFTCPRCGHEK   32 (104)
T ss_pred             CceEecCccCCee
Confidence            4567888888764


No 165
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=41.43  E-value=12  Score=18.78  Aligned_cols=18  Identities=22%  Similarity=0.364  Sum_probs=11.4

Q ss_pred             CccccCCcchhhhccchh
Q psy3948           5 HTILKCTFCNIIFNKLQD   22 (143)
Q Consensus         5 ~~~~~C~~C~~~f~~~~~   22 (143)
                      ++.+.|-.||..|.....
T Consensus         2 Dk~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             CeeEEcccCCCeEEEehh
Confidence            456677777777655444


No 166
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=41.39  E-value=14  Score=18.32  Aligned_cols=12  Identities=8%  Similarity=-0.042  Sum_probs=8.9

Q ss_pred             eecccccccccc
Q psy3948         101 HKCANVIIIAIM  112 (143)
Q Consensus       101 ~~C~~C~~~f~~  112 (143)
                      |+|..|+.++--
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            788888877643


No 167
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=41.38  E-value=26  Score=18.01  Aligned_cols=6  Identities=33%  Similarity=0.861  Sum_probs=2.8

Q ss_pred             eccCCC
Q psy3948          46 ACFICT   51 (143)
Q Consensus        46 ~c~~c~   51 (143)
                      .|+.|+
T Consensus        23 vCp~Cg   28 (54)
T PF14446_consen   23 VCPECG   28 (54)
T ss_pred             ECCCCC
Confidence            344444


No 168
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=41.37  E-value=12  Score=17.23  Aligned_cols=12  Identities=17%  Similarity=0.041  Sum_probs=6.3

Q ss_pred             ecccccccccch
Q psy3948         102 KCANVIIIAIMY  113 (143)
Q Consensus       102 ~C~~C~~~f~~~  113 (143)
                      .|.+|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            688899888765


No 169
>KOG2482|consensus
Probab=41.20  E-value=18  Score=26.17  Aligned_cols=23  Identities=13%  Similarity=0.060  Sum_probs=20.7

Q ss_pred             ceecccccccccchHHHHHHHHH
Q psy3948         100 AHKCANVIIIAIMYHILEIMLED  122 (143)
Q Consensus       100 ~~~C~~C~~~f~~~s~l~~h~~~  122 (143)
                      .+.|-.|.++|..+..|+.|+++
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            47899999999999999999873


No 170
>KOG2231|consensus
Probab=40.89  E-value=75  Score=25.46  Aligned_cols=22  Identities=18%  Similarity=0.427  Sum_probs=13.2

Q ss_pred             eccCCCCccCCcchHHHhhhhc
Q psy3948          46 ACFICTYHTRKHGDMIGHMRKH   67 (143)
Q Consensus        46 ~c~~c~~~~~~~~~l~~h~~~~   67 (143)
                      .|..|...|.....+..|++.+
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~  205 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFD  205 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccc
Confidence            3666666666666666665543


No 171
>KOG2272|consensus
Probab=40.88  E-value=21  Score=24.64  Aligned_cols=15  Identities=27%  Similarity=0.494  Sum_probs=9.1

Q ss_pred             ccCCcchhhhccchh
Q psy3948           8 LKCTFCNIIFNKLQD   22 (143)
Q Consensus         8 ~~C~~C~~~f~~~~~   22 (143)
                      |+|..|++...+...
T Consensus       164 FkCt~C~keL~sdaR  178 (332)
T KOG2272|consen  164 FKCTTCGKELTSDAR  178 (332)
T ss_pred             eecccccccccchhh
Confidence            457777776655444


No 172
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=40.81  E-value=23  Score=20.16  Aligned_cols=28  Identities=14%  Similarity=0.261  Sum_probs=14.9

Q ss_pred             hcccCCCCCC-CCCCcceeccCCCCccCC
Q psy3948          29 HCKSCKKPKR-PDKSYNYACFICTYHTRK   56 (143)
Q Consensus        29 ~c~~c~~~~~-~~~~~~~~c~~c~~~~~~   56 (143)
                      .|+.|++.-. ..+..++.|.-||..|..
T Consensus        37 ~Cp~C~~~~VkR~a~GIW~C~kCg~~fAG   65 (89)
T COG1997          37 VCPFCGRTTVKRIATGIWKCRKCGAKFAG   65 (89)
T ss_pred             cCCCCCCcceeeeccCeEEcCCCCCeecc
Confidence            4666655421 233345667767666553


No 173
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=40.77  E-value=32  Score=16.89  Aligned_cols=12  Identities=25%  Similarity=0.813  Sum_probs=6.4

Q ss_pred             ceeccCCCCccC
Q psy3948          44 NYACFICTYHTR   55 (143)
Q Consensus        44 ~~~c~~c~~~~~   55 (143)
                      .+.|+.||..+.
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            355666664433


No 174
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=40.33  E-value=12  Score=18.10  Aligned_cols=16  Identities=6%  Similarity=-0.203  Sum_probs=11.9

Q ss_pred             ecccccccccchHHHH
Q psy3948         102 KCANVIIIAIMYHILE  117 (143)
Q Consensus       102 ~C~~C~~~f~~~s~l~  117 (143)
                      .|..|++.|+.+....
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            6888999888875443


No 175
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=40.12  E-value=16  Score=18.39  Aligned_cols=11  Identities=27%  Similarity=0.495  Sum_probs=5.7

Q ss_pred             cccCCcchhhh
Q psy3948           7 ILKCTFCNIIF   17 (143)
Q Consensus         7 ~~~C~~C~~~f   17 (143)
                      .|.|..||+.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            34555555554


No 176
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=39.94  E-value=14  Score=22.74  Aligned_cols=17  Identities=18%  Similarity=0.153  Sum_probs=13.2

Q ss_pred             CCCceecccccccccch
Q psy3948          97 GLKAHKCANVIIIAIMY  113 (143)
Q Consensus        97 ~e~~~~C~~C~~~f~~~  113 (143)
                      |...|.|..|++.|...
T Consensus        50 ~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          50 GHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             cccccccCCcCcceeee
Confidence            35568999999998764


No 177
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.82  E-value=4.4  Score=22.33  Aligned_cols=31  Identities=26%  Similarity=0.462  Sum_probs=17.4

Q ss_pred             cccCCcchhhhccchhhHHH-hhhcccCCCCC
Q psy3948           7 ILKCTFCNIIFNKLQDEELI-MTHCKSCKKPK   37 (143)
Q Consensus         7 ~~~C~~C~~~f~~~~~~~~~-~~~c~~c~~~~   37 (143)
                      .|+|..|+-.|.-.+...+. ..+|+.|+..+
T Consensus        12 ~Y~c~~cg~~~dvvq~~~ddplt~ce~c~a~~   43 (82)
T COG2331          12 SYECTECGNRFDVVQAMTDDPLTTCEECGARL   43 (82)
T ss_pred             EEeecccchHHHHHHhcccCccccChhhChHH
Confidence            57899999877444332111 11566665544


No 178
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=37.98  E-value=14  Score=18.61  Aligned_cols=12  Identities=17%  Similarity=-0.067  Sum_probs=9.2

Q ss_pred             eecccccccccc
Q psy3948         101 HKCANVIIIAIM  112 (143)
Q Consensus       101 ~~C~~C~~~f~~  112 (143)
                      |+|..||+++--
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            778888888763


No 179
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=35.97  E-value=18  Score=16.75  Aligned_cols=12  Identities=17%  Similarity=0.177  Sum_probs=8.7

Q ss_pred             eecccccccccc
Q psy3948         101 HKCANVIIIAIM  112 (143)
Q Consensus       101 ~~C~~C~~~f~~  112 (143)
                      +.|+.||.+|..
T Consensus         2 r~C~~Cg~~Yh~   13 (36)
T PF05191_consen    2 RICPKCGRIYHI   13 (36)
T ss_dssp             EEETTTTEEEET
T ss_pred             cCcCCCCCcccc
Confidence            468888888764


No 181
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=35.68  E-value=5.6  Score=20.26  Aligned_cols=14  Identities=29%  Similarity=0.748  Sum_probs=9.1

Q ss_pred             cCCcchhhhccchh
Q psy3948           9 KCTFCNIIFNKLQD   22 (143)
Q Consensus         9 ~C~~C~~~f~~~~~   22 (143)
                      .||+||..+...-+
T Consensus         2 ~CPyCge~~~~~iD   15 (52)
T PF14255_consen    2 QCPYCGEPIEILID   15 (52)
T ss_pred             CCCCCCCeeEEEEe
Confidence            58888887644333


No 182
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=34.64  E-value=30  Score=15.65  Aligned_cols=10  Identities=20%  Similarity=0.567  Sum_probs=4.7

Q ss_pred             eeccCCCCcc
Q psy3948          45 YACFICTYHT   54 (143)
Q Consensus        45 ~~c~~c~~~~   54 (143)
                      ..|..||..+
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            3455555443


No 183
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=34.47  E-value=23  Score=26.58  Aligned_cols=31  Identities=19%  Similarity=0.394  Sum_probs=21.2

Q ss_pred             CCCCccccCCcchhhhccchhhHHHhhhcccCCCCCC
Q psy3948           2 FVDHTILKCTFCNIIFNKLQDEELIMTHCKSCKKPKR   38 (143)
Q Consensus         2 ~~~~~~~~C~~C~~~f~~~~~~~~~~~~c~~c~~~~~   38 (143)
                      -.....|.|..||-.+.++.-      .|+.|+.+-.
T Consensus         2 aK~~t~f~C~~CG~~s~KW~G------kCp~Cg~Wns   32 (456)
T COG1066           2 AKKKTAFVCQECGYVSPKWLG------KCPACGAWNT   32 (456)
T ss_pred             CCcccEEEcccCCCCCccccc------cCCCCCCccc
Confidence            334477999999998754433      5888886543


No 184
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=34.12  E-value=29  Score=26.21  Aligned_cols=27  Identities=11%  Similarity=0.036  Sum_probs=23.4

Q ss_pred             CCceecccccccccchHHHHHHHHHHh
Q psy3948          98 LKAHKCANVIIIAIMYHILEIMLEDIQ  124 (143)
Q Consensus        98 e~~~~C~~C~~~f~~~s~l~~h~~~~~  124 (143)
                      ..-|.|..|.+-|.+...|.+|+....
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~C~  222 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKKCD  222 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhcCC
Confidence            346999999999999999999987554


No 185
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=33.63  E-value=25  Score=16.11  Aligned_cols=7  Identities=29%  Similarity=0.828  Sum_probs=3.4

Q ss_pred             eeccCCC
Q psy3948          45 YACFICT   51 (143)
Q Consensus        45 ~~c~~c~   51 (143)
                      +.|+.||
T Consensus        23 ~vC~~Cg   29 (34)
T PF14803_consen   23 LVCPACG   29 (34)
T ss_dssp             EEETTTT
T ss_pred             eECCCCC
Confidence            4455554


No 186
>PTZ00064 histone acetyltransferase; Provisional
Probab=33.56  E-value=34  Score=26.24  Aligned_cols=27  Identities=19%  Similarity=0.047  Sum_probs=23.3

Q ss_pred             CceecccccccccchHHHHHHHHHHhc
Q psy3948          99 KAHKCANVIIIAIMYHILEIMLEDIQG  125 (143)
Q Consensus        99 ~~~~C~~C~~~f~~~s~l~~h~~~~~~  125 (143)
                      .-|.|..|-+-|.+...|.+|+....-
T Consensus       279 ~LYICEfCLkY~~s~~~l~rH~~~C~~  305 (552)
T PTZ00064        279 TLHFCEYCLDFFCFEDELIRHLSRCQL  305 (552)
T ss_pred             eEEEccchhhhhCCHHHHHHHHhcCCC
Confidence            458999999999999999999886553


No 187
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.49  E-value=24  Score=18.80  Aligned_cols=10  Identities=20%  Similarity=0.574  Sum_probs=4.4

Q ss_pred             cccCCcchhh
Q psy3948           7 ILKCTFCNII   16 (143)
Q Consensus         7 ~~~C~~C~~~   16 (143)
                      .-+|+.||+.
T Consensus         7 ~v~CP~Cgkp   16 (65)
T COG3024           7 TVPCPTCGKP   16 (65)
T ss_pred             cccCCCCCCc
Confidence            3344444443


No 188
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=33.38  E-value=15  Score=18.66  Aligned_cols=15  Identities=27%  Similarity=0.831  Sum_probs=8.5

Q ss_pred             CCccccCCcchhhhc
Q psy3948           4 DHTILKCTFCNIIFN   18 (143)
Q Consensus         4 ~~~~~~C~~C~~~f~   18 (143)
                      +...+.|.||++.+.
T Consensus        32 ~~~~~rC~YCe~~~~   46 (52)
T PF02748_consen   32 EPIKLRCHYCERIIT   46 (52)
T ss_dssp             TTCEEEETTT--EEE
T ss_pred             CCCEEEeeCCCCEec
Confidence            445677888887653


No 189
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=33.01  E-value=27  Score=21.21  Aligned_cols=10  Identities=30%  Similarity=0.786  Sum_probs=5.5

Q ss_pred             eeccCCCCccC
Q psy3948          45 YACFICTYHTR   55 (143)
Q Consensus        45 ~~c~~c~~~~~   55 (143)
                      +.| .||..|.
T Consensus        71 ~~C-~Cg~~~~   80 (124)
T PRK00762         71 IEC-ECGYEGV   80 (124)
T ss_pred             EEe-eCcCccc
Confidence            456 6665544


No 190
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=32.41  E-value=25  Score=22.31  Aligned_cols=10  Identities=10%  Similarity=0.132  Sum_probs=4.9

Q ss_pred             ceecccccccc
Q psy3948         100 AHKCANVIIIA  110 (143)
Q Consensus       100 ~~~C~~C~~~f  110 (143)
                      +|.|. |+..|
T Consensus       117 ~Y~C~-C~q~~  126 (156)
T COG3091         117 PYRCQ-CQQHY  126 (156)
T ss_pred             eEEee-cCCcc
Confidence            35555 55443


No 191
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=32.22  E-value=34  Score=17.37  Aligned_cols=7  Identities=29%  Similarity=1.103  Sum_probs=3.3

Q ss_pred             ccCCCCC
Q psy3948          73 LKCSSCN   79 (143)
Q Consensus        73 ~~c~~c~   79 (143)
                      ..|+.|+
T Consensus        47 ~~Cp~Cg   53 (56)
T PF02591_consen   47 VFCPNCG   53 (56)
T ss_pred             EECcCCC
Confidence            3455554


No 192
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=32.04  E-value=45  Score=15.65  Aligned_cols=20  Identities=20%  Similarity=0.009  Sum_probs=14.4

Q ss_pred             CceecccccccccchHHHHH
Q psy3948          99 KAHKCANVIIIAIMYHILEI  118 (143)
Q Consensus        99 ~~~~C~~C~~~f~~~s~l~~  118 (143)
                      ..+.|+.|+-++.+...|.+
T Consensus        18 ~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   18 EIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEEECCCCCeEEccHHHHHH
Confidence            34678888888777777765


No 193
>KOG2807|consensus
Probab=31.78  E-value=65  Score=23.33  Aligned_cols=27  Identities=7%  Similarity=-0.103  Sum_probs=21.4

Q ss_pred             CceecccccccccchHHHHHHHHHHhc
Q psy3948          99 KAHKCANVIIIAIMYHILEIMLEDIQG  125 (143)
Q Consensus        99 ~~~~C~~C~~~f~~~s~l~~h~~~~~~  125 (143)
                      -.|.|..|...|-..=+...|-..|-+
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh~C  370 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLHNC  370 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhhcC
Confidence            458999999999888888888766653


No 194
>PLN03239 histone acetyltransferase; Provisional
Probab=31.53  E-value=38  Score=24.70  Aligned_cols=25  Identities=8%  Similarity=-0.215  Sum_probs=22.2

Q ss_pred             CCceecccccccccchHHHHHHHHH
Q psy3948          98 LKAHKCANVIIIAIMYHILEIMLED  122 (143)
Q Consensus        98 e~~~~C~~C~~~f~~~s~l~~h~~~  122 (143)
                      ..-|.|..|.+-|.+...|.+|+..
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHHh
Confidence            4579999999999999999999765


No 195
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=31.52  E-value=15  Score=23.21  Aligned_cols=9  Identities=44%  Similarity=0.899  Sum_probs=6.2

Q ss_pred             cCCcchhhh
Q psy3948           9 KCTFCNIIF   17 (143)
Q Consensus         9 ~C~~C~~~f   17 (143)
                      .||+|+-.-
T Consensus         2 ~CPfC~~~~   10 (156)
T COG1327           2 KCPFCGHED   10 (156)
T ss_pred             CCCCCCCCC
Confidence            478887654


No 196
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=31.03  E-value=20  Score=16.11  Aligned_cols=10  Identities=40%  Similarity=1.059  Sum_probs=5.1

Q ss_pred             cccCCcchhh
Q psy3948           7 ILKCTFCNII   16 (143)
Q Consensus         7 ~~~C~~C~~~   16 (143)
                      .|+|+.||-.
T Consensus         4 ~ykC~~CGni   13 (34)
T cd00974           4 VYKCEICGNI   13 (34)
T ss_pred             EEEcCCCCcE
Confidence            4555555544


No 197
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=29.86  E-value=29  Score=15.55  Aligned_cols=9  Identities=33%  Similarity=0.921  Sum_probs=4.2

Q ss_pred             eeccCCCCc
Q psy3948          45 YACFICTYH   53 (143)
Q Consensus        45 ~~c~~c~~~   53 (143)
                      |+|..||..
T Consensus         8 ykC~~Cgni   16 (34)
T TIGR00319         8 YKCEVCGNI   16 (34)
T ss_pred             EEcCCCCcE
Confidence            444444444


No 198
>KOG2636|consensus
Probab=29.81  E-value=40  Score=25.43  Aligned_cols=29  Identities=10%  Similarity=-0.058  Sum_probs=24.1

Q ss_pred             HHhcCCCceeccccc-ccccchHHHHHHHH
Q psy3948          93 KRHTGLKAHKCANVI-IIAIMYHILEIMLE  121 (143)
Q Consensus        93 ~~h~~e~~~~C~~C~-~~f~~~s~l~~h~~  121 (143)
                      +.|.-..-|.|..|| +++..+..+.+|-.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            566667789999999 88888999999944


No 199
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.48  E-value=44  Score=20.44  Aligned_cols=10  Identities=20%  Similarity=0.411  Sum_probs=4.7

Q ss_pred             eccCCCCccC
Q psy3948          46 ACFICTYHTR   55 (143)
Q Consensus        46 ~c~~c~~~~~   55 (143)
                      -|..||..|+
T Consensus        70 fchncgs~fp   79 (160)
T COG4306          70 FCHNCGSRFP   79 (160)
T ss_pred             hhhcCCCCCC
Confidence            3444554444


No 200
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.34  E-value=24  Score=18.61  Aligned_cols=9  Identities=22%  Similarity=1.091  Sum_probs=5.3

Q ss_pred             cCCcchhhh
Q psy3948           9 KCTFCNIIF   17 (143)
Q Consensus         9 ~C~~C~~~f   17 (143)
                      .|++|+..|
T Consensus        50 ~CPYC~t~y   58 (62)
T COG4391          50 VCPYCSTRY   58 (62)
T ss_pred             ecCccccEE
Confidence            466666554


No 201
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=29.20  E-value=18  Score=16.85  Aligned_cols=15  Identities=20%  Similarity=0.304  Sum_probs=8.3

Q ss_pred             ccCCcchhhhccchh
Q psy3948           8 LKCTFCNIIFNKLQD   22 (143)
Q Consensus         8 ~~C~~C~~~f~~~~~   22 (143)
                      -.|+.|+++|-+.++
T Consensus         3 ~~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    3 GLCPRCGKGFHWASE   17 (36)
T ss_dssp             -C-TTTSSSCS-TTT
T ss_pred             ccCcccCCCcchhhh
Confidence            358888888755544


No 202
>KOG1994|consensus
Probab=29.01  E-value=33  Score=23.34  Aligned_cols=21  Identities=14%  Similarity=-0.259  Sum_probs=19.1

Q ss_pred             CceecccccccccchHHHHHH
Q psy3948          99 KAHKCANVIIIAIMYHILEIM  119 (143)
Q Consensus        99 ~~~~C~~C~~~f~~~s~l~~h  119 (143)
                      -.|-|-.||..|.+.-+|..|
T Consensus       238 eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             cceEEEEeccccCCHHHHHHh
Confidence            458899999999999999988


No 203
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=28.77  E-value=28  Score=17.88  Aligned_cols=9  Identities=33%  Similarity=1.065  Sum_probs=4.6

Q ss_pred             cccCCcchh
Q psy3948           7 ILKCTFCNI   15 (143)
Q Consensus         7 ~~~C~~C~~   15 (143)
                      +.+||.||.
T Consensus         3 LkPCPFCG~   11 (61)
T PF14354_consen    3 LKPCPFCGS   11 (61)
T ss_pred             CcCCCCCCC
Confidence            345555544


No 204
>PF09788 Tmemb_55A:  Transmembrane protein 55A;  InterPro: IPR019178  Members of this family catalyse the hydrolysis of the 4-position phosphate of phosphatidylinositol 4,5-bisphosphate, in the reaction:  1-phosphatidyl-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate.  
Probab=28.74  E-value=16  Score=25.15  Aligned_cols=29  Identities=21%  Similarity=0.455  Sum_probs=13.8

Q ss_pred             ccCCcchhhhccchhhHHHhhhcccCCCC
Q psy3948           8 LKCTFCNIIFNKLQDEELIMTHCKSCKKP   36 (143)
Q Consensus         8 ~~C~~C~~~f~~~~~~~~~~~~c~~c~~~   36 (143)
                      +.|.+|+.+|.+..-..+....|+.|.+.
T Consensus       158 v~CghC~~~Fl~~~~~~~tlARCPHCrKv  186 (256)
T PF09788_consen  158 VICGHCSNTFLFNTLTSNTLARCPHCRKV  186 (256)
T ss_pred             EECCCCCCcEeccCCCCCccccCCCCcee
Confidence            45666666664443222222345555443


No 205
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=28.13  E-value=30  Score=21.51  Aligned_cols=19  Identities=21%  Similarity=0.415  Sum_probs=14.2

Q ss_pred             HhcCCCceecccccccccch
Q psy3948          94 RHTGLKAHKCANVIIIAIMY  113 (143)
Q Consensus        94 ~h~~e~~~~C~~C~~~f~~~  113 (143)
                      .+.+ +|..|++||..|...
T Consensus       107 l~~g-~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  107 LHKG-KPQRCPECGQVFKLK  125 (136)
T ss_dssp             EETT-SEEEETTTEEEEEEE
T ss_pred             EeCC-CccCCCCCCeEEEEE
Confidence            3444 588999999998753


No 206
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=27.62  E-value=28  Score=20.48  Aligned_cols=10  Identities=20%  Similarity=0.331  Sum_probs=6.0

Q ss_pred             ceeccCCCCc
Q psy3948          44 NYACFICTYH   53 (143)
Q Consensus        44 ~~~c~~c~~~   53 (143)
                      +-.|+.||..
T Consensus         2 p~~CpYCg~~   11 (102)
T PF11672_consen    2 PIICPYCGGP   11 (102)
T ss_pred             CcccCCCCCe
Confidence            3457777754


No 207
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=27.60  E-value=45  Score=25.01  Aligned_cols=28  Identities=18%  Similarity=0.526  Sum_probs=13.6

Q ss_pred             cccCCCCCCCCCCcceeccCCCCccCCc
Q psy3948          30 CKSCKKPKRPDKSYNYACFICTYHTRKH   57 (143)
Q Consensus        30 c~~c~~~~~~~~~~~~~c~~c~~~~~~~   57 (143)
                      |+.|+.+-...+..-|.|+-||..++..
T Consensus       353 Cp~Cg~~m~S~G~~g~rC~kCg~~~~~~  380 (421)
T COG1571         353 CPRCGGRMKSAGRNGFRCKKCGTRARET  380 (421)
T ss_pred             CCccCCchhhcCCCCcccccccccCCcc
Confidence            4444443332222246666666665544


No 208
>KOG4684|consensus
Probab=27.56  E-value=28  Score=23.44  Aligned_cols=29  Identities=28%  Similarity=0.591  Sum_probs=19.5

Q ss_pred             ccCCcchhhhccchhhHHHhhhcccCCCCC
Q psy3948           8 LKCTFCNIIFNKLQDEELIMTHCKSCKKPK   37 (143)
Q Consensus         8 ~~C~~C~~~f~~~~~~~~~~~~c~~c~~~~   37 (143)
                      .+|.+|+.+|.+...+. ....|+-|.+..
T Consensus       171 V~CgHC~~tFLfnt~tn-aLArCPHCrKvS  199 (275)
T KOG4684|consen  171 VKCGHCNETFLFNTLTN-ALARCPHCRKVS  199 (275)
T ss_pred             EEecCccceeehhhHHH-HHhcCCcccchh
Confidence            47999999997665543 333577776654


No 209
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=26.61  E-value=58  Score=23.31  Aligned_cols=14  Identities=21%  Similarity=0.247  Sum_probs=9.0

Q ss_pred             Cceecccccccccc
Q psy3948          99 KAHKCANVIIIAIM  112 (143)
Q Consensus        99 ~~~~C~~C~~~f~~  112 (143)
                      +...|..|+...+.
T Consensus       251 r~e~C~~C~~YlK~  264 (305)
T TIGR01562       251 KAETCDSCQGYLKI  264 (305)
T ss_pred             EEeeccccccchhh
Confidence            45678888755443


No 210
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=26.45  E-value=81  Score=20.98  Aligned_cols=12  Identities=8%  Similarity=0.238  Sum_probs=7.8

Q ss_pred             Cceecccccccc
Q psy3948          99 KAHKCANVIIIA  110 (143)
Q Consensus        99 ~~~~C~~C~~~f  110 (143)
                      .-+.|..||..+
T Consensus        29 ~lvrC~eCG~V~   40 (201)
T COG1326          29 PLVRCEECGTVH   40 (201)
T ss_pred             eEEEccCCCcEe
Confidence            346777777665


No 211
>PHA02998 RNA polymerase subunit; Provisional
Probab=26.41  E-value=12  Score=24.42  Aligned_cols=12  Identities=17%  Similarity=0.204  Sum_probs=8.8

Q ss_pred             ceeccccccccc
Q psy3948         100 AHKCANVIIIAI  111 (143)
Q Consensus       100 ~~~C~~C~~~f~  111 (143)
                      -|.|..||..|.
T Consensus       171 FYkC~~CG~~wk  182 (195)
T PHA02998        171 RHACRDCKKHFK  182 (195)
T ss_pred             EEEcCCCCCccC
Confidence            378888887765


No 212
>KOG0717|consensus
Probab=26.25  E-value=48  Score=25.22  Aligned_cols=21  Identities=10%  Similarity=-0.186  Sum_probs=18.9

Q ss_pred             eecccccccccchHHHHHHHH
Q psy3948         101 HKCANVIIIAIMYHILEIMLE  121 (143)
Q Consensus       101 ~~C~~C~~~f~~~s~l~~h~~  121 (143)
                      +-|..|.+.|.+...|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            679999999999999999954


No 213
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=25.84  E-value=49  Score=15.87  Aligned_cols=22  Identities=36%  Similarity=0.824  Sum_probs=10.4

Q ss_pred             hcccCCCCCCCCCCcceeccCC
Q psy3948          29 HCKSCKKPKRPDKSYNYACFIC   50 (143)
Q Consensus        29 ~c~~c~~~~~~~~~~~~~c~~c   50 (143)
                      .|+.|+.+.-..++....|..|
T Consensus        19 ~Cp~C~~PL~~~k~g~~~Cv~C   40 (41)
T PF06677_consen   19 HCPDCGTPLMRDKDGKIYCVSC   40 (41)
T ss_pred             ccCCCCCeeEEecCCCEECCCC
Confidence            5666654443223333445554


No 214
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=25.57  E-value=72  Score=15.98  Aligned_cols=12  Identities=8%  Similarity=-0.363  Sum_probs=5.8

Q ss_pred             ecccccccccch
Q psy3948         102 KCANVIIIAIMY  113 (143)
Q Consensus       102 ~C~~C~~~f~~~  113 (143)
                      .|+.|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            788888887753


No 215
>KOG2071|consensus
Probab=25.24  E-value=53  Score=25.70  Aligned_cols=28  Identities=4%  Similarity=-0.145  Sum_probs=23.9

Q ss_pred             CCCceecccccccccchHHHHHHHHHHh
Q psy3948          97 GLKAHKCANVIIIAIMYHILEIMLEDIQ  124 (143)
Q Consensus        97 ~e~~~~C~~C~~~f~~~s~l~~h~~~~~  124 (143)
                      ...|..|..||..|-......+|+..|-
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            4567899999999999999998887776


No 216
>KOG4118|consensus
Probab=25.01  E-value=35  Score=18.24  Aligned_cols=30  Identities=13%  Similarity=0.279  Sum_probs=24.4

Q ss_pred             ceecccccccccchHHHHHHHHHHhcCCCc
Q psy3948         100 AHKCANVIIIAIMYHILEIMLEDIQGRDHI  129 (143)
Q Consensus       100 ~~~C~~C~~~f~~~s~l~~h~~~~~~~~~~  129 (143)
                      .|.|..|...-...-.+..|...-|...++
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHpk~~~   67 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHPKEPL   67 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCCCCCC
Confidence            478999998888888899998877766654


No 217
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=24.95  E-value=18  Score=21.66  Aligned_cols=12  Identities=8%  Similarity=-0.089  Sum_probs=6.5

Q ss_pred             CCCceecccccc
Q psy3948          97 GLKAHKCANVII  108 (143)
Q Consensus        97 ~e~~~~C~~C~~  108 (143)
                      ++..|.|..|-+
T Consensus        91 ~~~~WlC~vC~k  102 (118)
T PF02318_consen   91 KEPIWLCKVCQK  102 (118)
T ss_dssp             SSCCEEEHHHHH
T ss_pred             CCCCEEChhhHH
Confidence            344566666543


No 218
>KOG4167|consensus
Probab=24.90  E-value=14  Score=29.56  Aligned_cols=25  Identities=24%  Similarity=0.327  Sum_probs=15.2

Q ss_pred             ceeccCCCCccCCcchHHHhhhhcC
Q psy3948          44 NYACFICTYHTRKHGDMIGHMRKHT   68 (143)
Q Consensus        44 ~~~c~~c~~~~~~~~~l~~h~~~~~   68 (143)
                      .|.|.+|++.|....++..|+++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4666666666665555666665554


No 219
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=24.42  E-value=33  Score=19.16  Aligned_cols=10  Identities=40%  Similarity=1.281  Sum_probs=3.4

Q ss_pred             CccccCCcch
Q psy3948           5 HTILKCTFCN   14 (143)
Q Consensus         5 ~~~~~C~~C~   14 (143)
                      .+.|.|+.||
T Consensus        20 ~~~F~CPfC~   29 (81)
T PF05129_consen   20 PKVFDCPFCN   29 (81)
T ss_dssp             SS----TTT-
T ss_pred             CceEcCCcCC
Confidence            3567788888


No 220
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=24.14  E-value=13  Score=27.01  Aligned_cols=17  Identities=24%  Similarity=0.425  Sum_probs=9.0

Q ss_pred             ccccCCcchhhhccchh
Q psy3948           6 TILKCTFCNIIFNKLQD   22 (143)
Q Consensus         6 ~~~~C~~C~~~f~~~~~   22 (143)
                      +.+.|..|+.++.....
T Consensus       251 kav~C~~C~yt~~~~~~  267 (344)
T PF09332_consen  251 KAVTCKQCKYTAFKPSD  267 (344)
T ss_dssp             EEEEETTT--EESS--H
T ss_pred             EEEEcCCCCCcccCcch
Confidence            45678888877655554


No 221
>KOG4173|consensus
Probab=23.59  E-value=40  Score=22.65  Aligned_cols=77  Identities=19%  Similarity=0.279  Sum_probs=46.0

Q ss_pred             eeccC--CCCccCCcchHHHhhhhcCCCCCccCCCCCCCCCChHHHHHHHHH-h---------cCCCceec--ccccccc
Q psy3948          45 YACFI--CTYHTRKHGDMIGHMRKHTGVKPLKCSSCNYSCSTKSALSVHQKR-H---------TGLKAHKC--ANVIIIA  110 (143)
Q Consensus        45 ~~c~~--c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~-h---------~~e~~~~C--~~C~~~f  110 (143)
                      +.|++  |-..+.....+..|-....+.   .|..|.+.|.+.--|..|..- |         -|..-|+|  ..|+..|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            34444  445555555555553332221   677787877777777776541 2         13334777  4588888


Q ss_pred             cchHHHHHHHHHHh
Q psy3948         111 IMYHILEIMLEDIQ  124 (143)
Q Consensus       111 ~~~s~l~~h~~~~~  124 (143)
                      .+.-+-..|+-..|
T Consensus       157 kT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  157 KTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhHHHHhc
Confidence            88888888865444


No 222
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=23.59  E-value=36  Score=25.03  Aligned_cols=25  Identities=20%  Similarity=0.506  Sum_probs=16.0

Q ss_pred             ccCCcchhhhccchhhHHHhhhcccCCCCCC
Q psy3948           8 LKCTFCNIIFNKLQDEELIMTHCKSCKKPKR   38 (143)
Q Consensus         8 ~~C~~C~~~f~~~~~~~~~~~~c~~c~~~~~   38 (143)
                      |.|..||-.+.+...      .|+.|+.+-.
T Consensus         1 ~~c~~cg~~~~~~~g------~cp~c~~w~~   25 (372)
T cd01121           1 YVCSECGYVSPKWLG------KCPECGEWNT   25 (372)
T ss_pred             CCCCCCCCCCCCccE------ECcCCCCcee
Confidence            678888887644433      4777776543


No 223
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=23.31  E-value=45  Score=21.77  Aligned_cols=22  Identities=27%  Similarity=0.540  Sum_probs=11.0

Q ss_pred             hcccCCCCCCCCCCcceeccCCCCc
Q psy3948          29 HCKSCKKPKRPDKSYNYACFICTYH   53 (143)
Q Consensus        29 ~c~~c~~~~~~~~~~~~~c~~c~~~   53 (143)
                      .|..|.+.|.   ...-.|+.||..
T Consensus       141 rC~GC~~~f~---~~~~~Cp~CG~~  162 (177)
T COG1439         141 RCHGCKRIFP---EPKDFCPICGSP  162 (177)
T ss_pred             EEecCceecC---CCCCcCCCCCCc
Confidence            4666666554   122335666544


No 224
>KOG1701|consensus
Probab=23.26  E-value=15  Score=27.38  Aligned_cols=12  Identities=17%  Similarity=0.371  Sum_probs=9.5

Q ss_pred             ceeccccccccc
Q psy3948         100 AHKCANVIIIAI  111 (143)
Q Consensus       100 ~~~C~~C~~~f~  111 (143)
                      -|.|..||...+
T Consensus       427 CY~CEDCg~~LS  438 (468)
T KOG1701|consen  427 CYKCEDCGLLLS  438 (468)
T ss_pred             ceehhhcCcccc
Confidence            488999997765


No 225
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=23.15  E-value=21  Score=21.35  Aligned_cols=12  Identities=17%  Similarity=-0.067  Sum_probs=9.8

Q ss_pred             ceeccccccccc
Q psy3948         100 AHKCANVIIIAI  111 (143)
Q Consensus       100 ~~~C~~C~~~f~  111 (143)
                      -|.|..||..+.
T Consensus       100 Fy~C~~Cg~~wr  111 (113)
T COG1594         100 FYKCTRCGYRWR  111 (113)
T ss_pred             EEEecccCCEee
Confidence            489999998765


No 226
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=22.97  E-value=63  Score=23.67  Aligned_cols=28  Identities=11%  Similarity=-0.046  Sum_probs=23.4

Q ss_pred             HHhcCCCceeccccc-ccccchHHHHHHH
Q psy3948          93 KRHTGLKAHKCANVI-IIAIMYHILEIML  120 (143)
Q Consensus        93 ~~h~~e~~~~C~~C~-~~f~~~s~l~~h~  120 (143)
                      +.|.-.+.|.|..|| +.+..+..+.+|-
T Consensus       367 klhgLd~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         367 KLHGLDIEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             HhcCCCcceeeeecccccccchHHHHhhh
Confidence            567677889999999 8888899998883


No 227
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=22.71  E-value=63  Score=19.99  Aligned_cols=25  Identities=32%  Similarity=0.741  Sum_probs=16.8

Q ss_pred             hcccCCCCCCCCCCcceeccCCCCcc
Q psy3948          29 HCKSCKKPKRPDKSYNYACFICTYHT   54 (143)
Q Consensus        29 ~c~~c~~~~~~~~~~~~~c~~c~~~~   54 (143)
                      +|+.|+.+.-- +.-.-.|++|+...
T Consensus        30 hCp~Cg~PLF~-KdG~v~CPvC~~~~   54 (131)
T COG1645          30 HCPKCGTPLFR-KDGEVFCPVCGYRE   54 (131)
T ss_pred             hCcccCCccee-eCCeEECCCCCceE
Confidence            79999976543 33334599999544


No 228
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=22.27  E-value=46  Score=22.68  Aligned_cols=16  Identities=13%  Similarity=0.100  Sum_probs=13.2

Q ss_pred             CCceecccccccccch
Q psy3948          98 LKAHKCANVIIIAIMY  113 (143)
Q Consensus        98 e~~~~C~~C~~~f~~~  113 (143)
                      .++..|++||..|...
T Consensus       179 GkpqRCpECGqVFKLV  194 (268)
T PTZ00043        179 GFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCccCCCCCcEEEEE
Confidence            3578999999999864


No 229
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=22.27  E-value=51  Score=19.57  Aligned_cols=26  Identities=15%  Similarity=0.374  Sum_probs=13.6

Q ss_pred             cccCCCCCCCCCCcceeccCCCCccC
Q psy3948          30 CKSCKKPKRPDKSYNYACFICTYHTR   55 (143)
Q Consensus        30 c~~c~~~~~~~~~~~~~c~~c~~~~~   55 (143)
                      |+.|...|.....-.+.|+.|+..+.
T Consensus         6 cp~c~sEytYed~~~~~cpec~~ew~   31 (112)
T COG2824           6 CPKCNSEYTYEDGGQLICPECAHEWN   31 (112)
T ss_pred             CCccCCceEEecCceEeCchhccccc
Confidence            44444444433333566777766655


No 230
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=21.83  E-value=67  Score=25.67  Aligned_cols=11  Identities=27%  Similarity=0.392  Sum_probs=6.1

Q ss_pred             ccCCCCccCCc
Q psy3948          47 CFICTYHTRKH   57 (143)
Q Consensus        47 c~~c~~~~~~~   57 (143)
                      |+.||......
T Consensus        44 C~~CG~~~~~~   54 (645)
T PRK14559         44 CPNCGAETGTI   54 (645)
T ss_pred             ccccCCcccch
Confidence            66666554443


No 231
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=21.75  E-value=11  Score=16.37  Aligned_cols=9  Identities=33%  Similarity=0.630  Sum_probs=3.0

Q ss_pred             cCCcchhhh
Q psy3948           9 KCTFCNIIF   17 (143)
Q Consensus         9 ~C~~C~~~f   17 (143)
                      +|+.|+...
T Consensus         3 ~C~rC~~~~   11 (30)
T PF06827_consen    3 KCPRCWNYI   11 (30)
T ss_dssp             B-TTT--BB
T ss_pred             cCccCCCcc
Confidence            455555543


No 232
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=20.74  E-value=33  Score=28.13  Aligned_cols=9  Identities=22%  Similarity=0.589  Sum_probs=0.0

Q ss_pred             ccCCcchhh
Q psy3948           8 LKCTFCNII   16 (143)
Q Consensus         8 ~~C~~C~~~   16 (143)
                      ..|+.||..
T Consensus       656 r~Cp~Cg~~  664 (900)
T PF03833_consen  656 RRCPKCGKE  664 (900)
T ss_dssp             ---------
T ss_pred             ccCcccCCc
Confidence            356666654


No 233
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=20.66  E-value=49  Score=27.14  Aligned_cols=29  Identities=28%  Similarity=0.510  Sum_probs=15.1

Q ss_pred             ccCCcchhhhccchh--hHHHhhhcccCCCCC
Q psy3948           8 LKCTFCNIIFNKLQD--EELIMTHCKSCKKPK   37 (143)
Q Consensus         8 ~~C~~C~~~f~~~~~--~~~~~~~c~~c~~~~   37 (143)
                      -.|..|++.|.+...  ..|.| .|..||..|
T Consensus       461 dtC~~C~kkFfSlsK~L~~RKH-HCRkCGrVF  491 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPLGTRAH-HCRSCGIRL  491 (1374)
T ss_pred             CcccCcCCcccccccccccccc-cccCCcccc
Confidence            457777777754321  11111 366666665


No 234
>PHA02942 putative transposase; Provisional
Probab=20.53  E-value=92  Score=23.07  Aligned_cols=10  Identities=40%  Similarity=1.115  Sum_probs=6.3

Q ss_pred             CccCCCCCCC
Q psy3948          72 PLKCSSCNYS   81 (143)
Q Consensus        72 ~~~c~~c~~~   81 (143)
                      .|.|+.||..
T Consensus       342 ~f~C~~CG~~  351 (383)
T PHA02942        342 YFHCPSCGYE  351 (383)
T ss_pred             EEECCCCCCE
Confidence            4677777643


No 235
>PRK12722 transcriptional activator FlhC; Provisional
Probab=20.37  E-value=73  Score=21.04  Aligned_cols=10  Identities=20%  Similarity=0.504  Sum_probs=4.7

Q ss_pred             hcccCCCCCC
Q psy3948          29 HCKSCKKPKR   38 (143)
Q Consensus        29 ~c~~c~~~~~   38 (143)
                      .|..|+..|.
T Consensus       136 ~C~~Cgg~fv  145 (187)
T PRK12722        136 SCNCCGGHFV  145 (187)
T ss_pred             cCCCCCCCee
Confidence            3555554443


No 236
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=20.28  E-value=53  Score=15.36  Aligned_cols=10  Identities=20%  Similarity=-0.024  Sum_probs=5.5

Q ss_pred             eecccccccc
Q psy3948         101 HKCANVIIIA  110 (143)
Q Consensus       101 ~~C~~C~~~f  110 (143)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            5566665543


No 237
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=20.02  E-value=1.2e+02  Score=19.90  Aligned_cols=32  Identities=16%  Similarity=0.253  Sum_probs=17.7

Q ss_pred             CCCCccCCCCCCCCCChHHHHHHHHHhcCCCceeccccccc
Q psy3948          69 GVKPLKCSSCNYSCSTKSALSVHQKRHTGLKAHKCANVIII  109 (143)
Q Consensus        69 ~~~~~~c~~c~~~f~~~~~l~~h~~~h~~e~~~~C~~C~~~  109 (143)
                      ...-|.|+.|...++...+.      ..   -|.|+.||..
T Consensus       110 ~~~~y~C~~~~~r~sfdeA~------~~---~F~Cp~Cg~~  141 (176)
T COG1675         110 ENNYYVCPNCHVKYSFDEAM------EL---GFTCPKCGED  141 (176)
T ss_pred             cCCceeCCCCCCcccHHHHH------Hh---CCCCCCCCch
Confidence            34457777666555443221      11   1778888765


Done!