Diaphorina citri psyllid: psy3951


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MDNVVFRLELERKSGNTWVPHNANDVQMEFVRIDPFVRTTLKSIAQGKYETVFKIPDVYGVYQFKVIYNRIGYTGISNATQVSVRPLEHTQYERFISSAYPYYASAFSMMFGVFVFSIVFLHYKDDEKSKSD
ccEEEEEEEEEEECccCEEEcccccEEEEEEECcCEEEEEEEEccccEEEEEEEcccCEEEEEEEEEEEEcccccEEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHEEEEEEEECccccccccc
MDNVVFRLELERKSGNTWVPHNANDVQMEFVRIDPFVRTTLKSIAQGKYETVFKIPDVYGVYQFKVIYNRIGYTGISNATQVSVRPLEHTQYERFISSAYPYYASAFSMMFGVFVFSIVFLHYK********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNVVFRLELERKSGNTWVPHNANDVQMEFVRIDPFVRTTLKSIAQGKYETVFKIPDVYGVYQFKVIYNRIGYTGISNATQVSVRPLEHTQYERFISSAYPYYASAFSMMFGVFVFSIVFLHYKDDEKSKSD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.confidentQ6ZLK0
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit Essential subunit of N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.confidentB1H3C9
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit Essential subunit of N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.confidentP39656

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008250 [CC]oligosaccharyltransferase complexprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0034097 [BP]response to cytokine stimulusprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0042110 [BP]T cell activationprobableGO:0009987, GO:0002376, GO:0045321, GO:0001775, GO:0046649, GO:0044763, GO:0008150, GO:0044699
GO:0006487 [BP]protein N-linked glycosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0004576 [MF]oligosaccharyl transferase activityprobableGO:0016758, GO:0016740, GO:0003674, GO:0016757, GO:0003824

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O6F, chain A
Confidence level:probable
Coverage over the Query: 1-73
View the alignment between query and template
View the model in PyMOL