Query         psy3964
Match_columns 65
No_of_seqs    118 out of 1071
Neff          6.1 
Searched_HMMs 46136
Date          Fri Aug 16 21:49:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3964.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3964hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00203 cathepsin L protease;  99.9 3.1E-24 6.7E-29  152.3   7.8   60    6-65    281-340 (348)
  2 cd02698 Peptidase_C1A_Cathepsi  99.9 3.8E-24 8.2E-29  143.8   7.7   58    7-64    174-237 (239)
  3 cd02620 Peptidase_C1A_Cathepsi  99.9 9.2E-24   2E-28  141.7   7.1   56    7-62    180-235 (236)
  4 KOG1542|consensus               99.9 3.2E-24 6.9E-29  153.1   4.9   59    6-64    311-370 (372)
  5 cd02621 Peptidase_C1A_Cathepsi  99.9 1.2E-23 2.5E-28  141.2   6.9   54   10-63    185-240 (243)
  6 PF00112 Peptidase_C1:  Papain   99.9 3.8E-23 8.2E-28  133.3   6.7   59    6-64    160-219 (219)
  7 cd02248 Peptidase_C1A Peptidas  99.9 3.8E-23 8.2E-28  134.0   6.6   56    8-63    155-210 (210)
  8 PTZ00200 cysteine proteinase;   99.9 1.2E-22 2.7E-27  148.2   6.9   58    8-65    383-445 (448)
  9 PTZ00021 falcipain-2; Provisio  99.9 2.6E-22 5.6E-27  147.9   7.1   59    7-65    416-488 (489)
 10 KOG1543|consensus               99.9 2.9E-22 6.3E-27  141.0   6.2   59    6-64    263-323 (325)
 11 smart00645 Pept_C1 Papain fami  99.9 1.4E-21   3E-26  126.4   7.0   55    6-60    114-170 (174)
 12 PTZ00364 dipeptidyl-peptidase   99.8 3.3E-21 7.1E-26  143.6   7.3   55    9-63    400-457 (548)
 13 PTZ00049 cathepsin C-like prot  99.8 3.8E-21 8.3E-26  145.9   6.9   55   10-64    617-675 (693)
 14 PTZ00462 Serine-repeat antigen  99.8 6.5E-20 1.4E-24  143.0   6.8   59    6-64    716-780 (1004)
 15 cd02619 Peptidase_C1 C1 Peptid  99.7 1.3E-17 2.7E-22  107.6   5.8   47    5-51    165-213 (223)
 16 KOG1544|consensus               99.6 3.4E-15 7.3E-20  107.6   4.6   55    6-60    396-455 (470)
 17 cd00585 Peptidase_C1B Peptidas  99.5 1.4E-14   3E-19  105.9   4.6   43    7-49    354-398 (437)
 18 COG4870 Cysteine protease [Pos  99.3   3E-12 6.5E-17   92.2   4.9   42    9-50    262-313 (372)
 19 PF03051 Peptidase_C1_2:  Pepti  99.1 1.2E-10 2.6E-15   85.4   4.9   41    9-49    357-399 (438)
 20 COG3579 PepC Aminopeptidase C   98.3 1.2E-07 2.5E-12   69.1   0.3   40   10-49    360-401 (444)
 21 KOG4128|consensus               95.2  0.0011 2.4E-08   48.7  -3.5   39   11-49    371-413 (457)
 22 PF05543 Peptidase_C47:  Stapho  88.6     1.1 2.4E-05   29.9   4.3   39    7-50    115-154 (175)
 23 PF13529 Peptidase_C39_2:  Pept  86.7    0.79 1.7E-05   26.8   2.6   24    9-35    121-144 (144)
 24 cd00044 CysPc Calpains, domain  51.6      24 0.00052   24.5   3.5   28   10-37    234-263 (315)
 25 cd03581 NTR_Sfrp3_like NTR dom  46.3      18  0.0004   21.9   2.0   38    3-40     55-92  (111)
 26 COG4990 Uncharacterized protei  45.2      16 0.00035   24.8   1.7   22   11-36    147-168 (195)
 27 PF14399 Transpep_BrtH:  NlpC/p  40.4      36 0.00078   23.0   2.9   23   10-33    111-133 (317)
 28 PF09778 Guanylate_cyc_2:  Guan  38.6      52  0.0011   22.5   3.4   24    8-33    157-180 (212)
 29 PF00648 Peptidase_C2:  Calpain  34.9      52  0.0011   22.4   3.0   28   10-37    212-243 (298)
 30 cd02549 Peptidase_C39A A sub-f  30.3      53  0.0011   19.2   2.2   12   10-21     92-103 (141)
 31 PF08151 FerI:  FerI (NUC094) d  29.0 1.2E+02  0.0025   17.3   4.1   21   29-49     18-39  (72)
 32 PF01640 Peptidase_C10:  Peptid  25.8 1.8E+02  0.0038   18.9   4.2   30   12-46    163-192 (192)
 33 PHA02885 putative interleukin   24.4 1.2E+02  0.0026   19.1   3.0   15   21-35     57-71  (135)
 34 smart00230 CysPc Calpain-like   21.9 1.3E+02  0.0029   21.1   3.2   28   10-37    226-255 (318)

No 1  
>PTZ00203 cathepsin L protease; Provisional
Probab=99.91  E-value=3.1e-24  Score=152.32  Aligned_cols=60  Identities=38%  Similarity=0.774  Sum_probs=53.8

Q ss_pred             CCCCCCCeEEEEEEEeccCCeeEEEEEcCCCCCCCCCeEEEEeccCCeeeeccccEEEEC
Q psy3964           6 NSPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTYVTM   65 (65)
Q Consensus         6 ~~~~~~~Hav~ivG~g~~~~~~yW~i~NSwg~~WG~~Gy~~i~~~~~~cgi~~~~~~p~v   65 (65)
                      |+...+||||+|||||.+++.+|||||||||++||++|||||.|+.|.|+|+.++....|
T Consensus       281 c~~~~~nHaVliVGYG~~~g~~YWiikNSWG~~WGe~GY~ri~rg~n~Cgi~~~~~~~~~  340 (348)
T PTZ00203        281 CIGEQLNHGVLLVGYNMTGEVPYWVIKNSWGEDWGEKGYVRVTMGVNACLLTGYPVSVHV  340 (348)
T ss_pred             cCCCCCCeEEEEEEEecCCCceEEEEEcCCCCCcCcCceEEEEcCCCcccccceEEEEec
Confidence            445568999999999998899999999999999999999999999999999988776543


No 2  
>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity. It can also act as a carboxydipeptidase, like cathepsin B, but has been shown to preferentially cleave substrates through a monopeptidyl carboxypeptidase pathway. The propeptide region of cathepsin X, the shortest among papain-like peptidases, is covalently attached to the active site cysteine in the inactive form of the enzyme. Little is known about the biological function of cathepsin X. Some studies point to a role in early tumorigenesis. A more recent study indicates that cathepsin X expression is restricted to immune cells suggesting a role in phagocytosis and the regulation of the immune response.
Probab=99.91  E-value=3.8e-24  Score=143.83  Aligned_cols=58  Identities=24%  Similarity=0.604  Sum_probs=53.6

Q ss_pred             CCCCCCeEEEEEEEeccC-CeeEEEEEcCCCCCCCCCeEEEEeccC-----CeeeeccccEEEE
Q psy3964           7 SPDGLDHAVLAVGYGELD-GKPYWQVKNSWSTYWGNQGYVLMSIKD-----NNCGVMTAPTYVT   64 (65)
Q Consensus         7 ~~~~~~Hav~ivG~g~~~-~~~yW~i~NSwg~~WG~~Gy~~i~~~~-----~~cgi~~~~~~p~   64 (65)
                      +...++|||+|||||.++ +.+|||||||||++||++|||||.|+.     |+|+|++.++|+.
T Consensus       174 ~~~~~~HaV~IVGyG~~~~g~~YWiikNSWG~~WGe~Gy~~i~rg~~~~~~~~~~i~~~~~~~~  237 (239)
T cd02698         174 QDPLINHIISVAGWGVDENGVEYWIVRNSWGEPWGERGWFRIVTSSYKGARYNLAIEEDCAWAD  237 (239)
T ss_pred             CCCcCCeEEEEEEEEecCCCCEEEEEEcCCCcccCcCceEEEEccCCcccccccccccceEEEe
Confidence            345689999999999876 899999999999999999999999998     9999999999985


No 3  
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag). Cathepsin B is a lysosomal papain-like cysteine peptidase which is expressed in all tissues and functions primarily as an exopeptidase through its carboxydipeptidyl activity. Together with other cathepsins, it is involved in the degradation of proteins, proenzyme activation, Ag processing, metabolism and apoptosis. Cathepsin B has been implicated in a number of human diseases such as cancer, rheumatoid arthritis, osteoporosis and Alzheimer's disease. The unique carboxydipeptidyl activity of cathepsin B is attributed to the presence of an occluding loop in its active site which favors the binding of the C-termini of substrate proteins. Some members of this group do not possess the occluding loop. TIN-Ag is an extracellular matrix basement protein which was originally identified as a target Ag involved in anti-tubular basement membrane
Probab=99.90  E-value=9.2e-24  Score=141.74  Aligned_cols=56  Identities=36%  Similarity=0.745  Sum_probs=50.9

Q ss_pred             CCCCCCeEEEEEEEeccCCeeEEEEEcCCCCCCCCCeEEEEeccCCeeeeccccEE
Q psy3964           7 SPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTY   62 (65)
Q Consensus         7 ~~~~~~Hav~ivG~g~~~~~~yW~i~NSwg~~WG~~Gy~~i~~~~~~cgi~~~~~~   62 (65)
                      +....+|||+|||||.+++++|||||||||++||++|||||+|+.|.|+|++.+..
T Consensus       180 ~~~~~~HaV~iVGyg~~~g~~YWivrNSWG~~WGe~Gy~ri~~~~~~cgi~~~~~~  235 (236)
T cd02620         180 GKQLGGHAVKIIGWGVENGVPYWLAANSWGTDWGENGYFRILRGSNECGIESEVVA  235 (236)
T ss_pred             CCCcCCeEEEEEEEeccCCeeEEEEEeCCCCCCCCCcEEEEEccCcccccccceec
Confidence            34457899999999988899999999999999999999999999999999988763


No 4  
>KOG1542|consensus
Probab=99.90  E-value=3.2e-24  Score=153.08  Aligned_cols=59  Identities=47%  Similarity=0.912  Sum_probs=54.5

Q ss_pred             CCCCCCCeEEEEEEEeccC-CeeEEEEEcCCCCCCCCCeEEEEeccCCeeeeccccEEEE
Q psy3964           6 NSPDGLDHAVLAVGYGELD-GKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTYVT   64 (65)
Q Consensus         6 ~~~~~~~Hav~ivG~g~~~-~~~yW~i~NSwg~~WG~~Gy~~i~~~~~~cgi~~~~~~p~   64 (65)
                      |++..+||+|||||||... .+||||||||||++||++||+|+.||.|.|||+++++-+.
T Consensus       311 Cs~~~~~HaVLlvGyG~~g~~~PYWIVKNSWG~~WGE~GY~~l~RG~N~CGi~~mvss~~  370 (372)
T KOG1542|consen  311 CSPKLLNHAVLLVGYGSSGYEKPYWIVKNSWGTSWGEKGYYKLCRGSNACGIADMVSSAA  370 (372)
T ss_pred             CCccccCceEEEEeecCCCCCCceEEEECCccccccccceEEEeccccccccccchhhhh
Confidence            6666799999999999887 8999999999999999999999999999999999887654


No 5  
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access. Each subunit of the tetramer is composed of three peptides: the heavy and light chains, which together adopts the papain fold and forms the catalytic domain; and the residual propeptide region, which forms a beta barrel and points towards the substrate's N-terminus. The subunit composition is the result of the unique characteristic of procathepsin C maturation involving the cleavage of the catalytic domain and the non-autocatalytic excision of an activation peptide within its propeptide region. By removing N-terminal dipeptide extensions, cathepsin C activates granule serine peptidases (granzymes) involved in cell-mediated apoptosis, inflammation and tissue remodelling. Loss-of-function mutations in cathepsin C are assoc
Probab=99.89  E-value=1.2e-23  Score=141.23  Aligned_cols=54  Identities=43%  Similarity=0.946  Sum_probs=50.4

Q ss_pred             CCCeEEEEEEEeccC--CeeEEEEEcCCCCCCCCCeEEEEeccCCeeeeccccEEE
Q psy3964          10 GLDHAVLAVGYGELD--GKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTYV   63 (65)
Q Consensus        10 ~~~Hav~ivG~g~~~--~~~yW~i~NSwg~~WG~~Gy~~i~~~~~~cgi~~~~~~p   63 (65)
                      ..+|||+|||||.+.  +.+|||||||||+.||++|||||.|+.|.|+|++.+.++
T Consensus       185 ~~~HaV~iVGyg~~~~~g~~YWiirNSWG~~WGe~Gy~~i~~~~~~cgi~~~~~~~  240 (243)
T cd02621         185 LTNHAVLLVGWGEDEIKGEKYWIVKNSWGSSWGEKGYFKIRRGTNECGIESQAVFA  240 (243)
T ss_pred             cCCeEEEEEEeeccCCCCCcEEEEEcCCCCCCCcCCeEEEecCCcccCcccceEee
Confidence            579999999999876  899999999999999999999999999999999998764


No 6  
>PF00112 Peptidase_C1:  Papain family cysteine protease This is family C1 in the peptidase classification. ;  InterPro: IPR000668 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of proteins belong to the peptidase family C1, sub-family C1A (papain family, clan CA). It includes proteins classed as non-peptidase homologs. These are have either been shown experimentally to lack peptidase activity or lack one or more of the active site residues.  The papain family has a wide variety of activities, including broad-range (papain) and narrow-range endo-peptidases, aminopeptidases, dipeptidyl peptidases and enzymes with both exo- and endo-peptidase activity []. Members of the papain family are widespread, found in baculovirus [], eubacteria, yeast, and practically all protozoa, plants and mammals []. The proteins are typically lysosomal or secreted, and proteolytic cleavage of the propeptide is required for enzyme activation, although bleomycin hydrolase is cytosolic in fungi and mammals []. Papain-like cysteine proteinases are essentially synthesised as inactive proenzymes (zymogens) with N-terminal propeptide regions. The activation process of these enzymes includes the removal of propeptide regions. The propeptide regions serve a variety of functions in vivo and in vitro. The pro-region is required for the proper folding of the newly synthesised enzyme, the inactivation of the peptidase domain and stabilisation of the enzyme against denaturing at neutral to alkaline pH conditions. Amino acid residues within the pro-region mediate their membrane association, and play a role in the transport of the proenzyme to lysosomes. Among the most notable features of propeptides is their ability to inhibit the activity of their cognate enzymes and that certain propeptides exhibit high selectivity for inhibition of the peptidases from which they originate [].  The catalytic residues of papain are Cys-25 and His-159, other important residues being Gln-19, which helps form the 'oxyanion hole', and Asn-175, which orientates the imidazole ring of His-159. ; GO: 0008234 cysteine-type peptidase activity, 0006508 proteolysis; PDB: 3MOR_B 3HHI_B 1S4V_A 3F75_A 1MEG_A 1PCI_C 1PPO_A 3HD3_B 1F29_A 1EWL_A ....
Probab=99.89  E-value=3.8e-23  Score=133.27  Aligned_cols=59  Identities=46%  Similarity=0.887  Sum_probs=53.6

Q ss_pred             CCCCCCCeEEEEEEEeccCCeeEEEEEcCCCCCCCCCeEEEEeccCC-eeeeccccEEEE
Q psy3964           6 NSPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDN-NCGVMTAPTYVT   64 (65)
Q Consensus         6 ~~~~~~~Hav~ivG~g~~~~~~yW~i~NSwg~~WG~~Gy~~i~~~~~-~cgi~~~~~~p~   64 (65)
                      +.+...+|||+||||+.+.+++||++|||||++||++||++|+++.+ .|+|+..++||+
T Consensus       160 ~~~~~~~Hav~iVGy~~~~~~~~wiv~NSWG~~WG~~Gy~~i~~~~~~~c~i~~~~~~~~  219 (219)
T PF00112_consen  160 CSNESGGHAVLIVGYDDENGKGYWIVKNSWGTDWGDNGYFRISYDYNNECGIESQAVYPI  219 (219)
T ss_dssp             SSSSSEEEEEEEEEEEEETTEEEEEEE-SBTTTSTBTTEEEEESSSSSGGGTTSSEEEEE
T ss_pred             cccccccccccccccccccceeeEeeehhhCCccCCCeEEEEeeCCCCcCccCceeeecC
Confidence            33457899999999999999999999999999999999999999886 999999999996


No 7  
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W). Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to h
Probab=99.89  E-value=3.8e-23  Score=134.04  Aligned_cols=56  Identities=46%  Similarity=0.973  Sum_probs=52.0

Q ss_pred             CCCCCeEEEEEEEeccCCeeEEEEEcCCCCCCCCCeEEEEeccCCeeeeccccEEE
Q psy3964           8 PDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTYV   63 (65)
Q Consensus         8 ~~~~~Hav~ivG~g~~~~~~yW~i~NSwg~~WG~~Gy~~i~~~~~~cgi~~~~~~p   63 (65)
                      ....+|||+|||||.+.+.+|||||||||++||++||+||+++.+.|+|+..+.||
T Consensus       155 ~~~~~Hav~iVGy~~~~~~~ywiv~NSWG~~WG~~Gy~~i~~~~~~cgi~~~~~~~  210 (210)
T cd02248         155 NTNLNHAVLLVGYGTENGVDYWIVKNSWGTSWGEKGYIRIARGSNLCGIASYASYP  210 (210)
T ss_pred             CCcCCEEEEEEEEeecCCceEEEEEcCCCCccccCcEEEEEcCCCccCceeeeecC
Confidence            45678999999999988899999999999999999999999999999999888776


No 8  
>PTZ00200 cysteine proteinase; Provisional
Probab=99.87  E-value=1.2e-22  Score=148.16  Aligned_cols=58  Identities=40%  Similarity=0.786  Sum_probs=51.9

Q ss_pred             CCCCCeEEEEEEEecc--CCeeEEEEEcCCCCCCCCCeEEEEecc---CCeeeeccccEEEEC
Q psy3964           8 PDGLDHAVLAVGYGEL--DGKPYWQVKNSWSTYWGNQGYVLMSIK---DNNCGVMTAPTYVTM   65 (65)
Q Consensus         8 ~~~~~Hav~ivG~g~~--~~~~yW~i~NSwg~~WG~~Gy~~i~~~---~~~cgi~~~~~~p~v   65 (65)
                      +..++|||+|||||.+  ++.+|||||||||++||++|||||.|+   .|.|||++.+.||++
T Consensus       383 ~~~~nHaV~lVGyG~d~~~g~~YWIIkNSWG~~WGe~GY~ri~r~~~g~n~CGI~~~~~~P~~  445 (448)
T PTZ00200        383 GKSLNHAVLLVGEGYDEKTKKRYWIIKNSWGTDWGENGYMRLERTNEGTDKCGILTVGLTPVF  445 (448)
T ss_pred             CCCCcEEEEEEEecccCCCCCceEEEEcCCCCCcccCeeEEEEeCCCCCCcCCccccceeeEE
Confidence            3458999999999953  578999999999999999999999985   589999999999974


No 9  
>PTZ00021 falcipain-2; Provisional
Probab=99.87  E-value=2.6e-22  Score=147.90  Aligned_cols=59  Identities=29%  Similarity=0.685  Sum_probs=51.7

Q ss_pred             CCCCCCeEEEEEEEeccC----------CeeEEEEEcCCCCCCCCCeEEEEeccC----CeeeeccccEEEEC
Q psy3964           7 SPDGLDHAVLAVGYGELD----------GKPYWQVKNSWSTYWGNQGYVLMSIKD----NNCGVMTAPTYVTM   65 (65)
Q Consensus         7 ~~~~~~Hav~ivG~g~~~----------~~~yW~i~NSwg~~WG~~Gy~~i~~~~----~~cgi~~~~~~p~v   65 (65)
                      |+..++|||+|||||.++          +.+|||||||||++||++|||||.|+.    +.|||.+.+.||++
T Consensus       416 C~~~~nHAVlIVGYG~e~~~~~~~~~~~~~~YWIVKNSWGt~WGE~GY~rI~r~~~g~~n~CGI~t~a~yP~~  488 (489)
T PTZ00021        416 CGEEPNHAVILVGYGMEEIYNSDTKKMEKRYYYIIKNSWGESWGEKGFIRIETDENGLMKTCSLGTEAYVPLI  488 (489)
T ss_pred             CCCccceEEEEEEecCcCCcccccccCCCCCEEEEECCCCCCcccCeEEEEEcCCCCCCCCCCCcccceeEec
Confidence            345689999999999753          257999999999999999999999975    58999999999985


No 10 
>KOG1543|consensus
Probab=99.86  E-value=2.9e-22  Score=141.04  Aligned_cols=59  Identities=47%  Similarity=0.915  Sum_probs=53.1

Q ss_pred             CCCC-CCCeEEEEEEEeccCCeeEEEEEcCCCCCCCCCeEEEEeccCCeeeeccccEE-EE
Q psy3964           6 NSPD-GLDHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTY-VT   64 (65)
Q Consensus         6 ~~~~-~~~Hav~ivG~g~~~~~~yW~i~NSwg~~WG~~Gy~~i~~~~~~cgi~~~~~~-p~   64 (65)
                      ++.. .++|||+|||||..++.+|||+|||||+.||++|||||.|+.+.|+|+..+.| |+
T Consensus       263 ~~~~~~~~Hav~iVGyG~~~~~~YWivkNSWG~~WGe~Gy~ri~r~~~~~~I~~~~~~~p~  323 (325)
T KOG1543|consen  263 KGDDKEGDHAVLIVGYGTGDGVDYWIVKNSWGTDWGEKGYFRIARGVNKCGIASEASYGPI  323 (325)
T ss_pred             CCCCCCCCceEEEEEEcCCCCceeEEEEcCCCCCcccCceEEEecCCCchhhhcccccCCC
Confidence            3444 59999999999996678999999999999999999999999999999999888 54


No 11 
>smart00645 Pept_C1 Papain family cysteine protease.
Probab=99.86  E-value=1.4e-21  Score=126.43  Aligned_cols=55  Identities=49%  Similarity=0.973  Sum_probs=48.1

Q ss_pred             CCCCCCCeEEEEEEEecc-CCeeEEEEEcCCCCCCCCCeEEEEeccC-Ceeeecccc
Q psy3964           6 NSPDGLDHAVLAVGYGEL-DGKPYWQVKNSWSTYWGNQGYVLMSIKD-NNCGVMTAP   60 (65)
Q Consensus         6 ~~~~~~~Hav~ivG~g~~-~~~~yW~i~NSwg~~WG~~Gy~~i~~~~-~~cgi~~~~   60 (65)
                      |+....+|+|+|||||.+ ++++|||+|||||+.||++|||||.++. +.|+|+...
T Consensus       114 ~~~~~~~Hav~ivGyg~~~~g~~yWii~NSwG~~WG~~G~~~i~~~~~~~c~i~~~~  170 (174)
T smart00645      114 CGSGTLDHAVLIVGYGTEENGKDYWIVKNSWGTDWGENGYFRIARGKNNECGIEASV  170 (174)
T ss_pred             CCCCcccEEEEEEEEeecCCCeeEEEEECCCCCCcccCeEEEEEcCCCCccCceeee
Confidence            333447999999999987 7899999999999999999999999987 999996544


No 12 
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional
Probab=99.84  E-value=3.3e-21  Score=143.58  Aligned_cols=55  Identities=24%  Similarity=0.589  Sum_probs=50.4

Q ss_pred             CCCCeEEEEEEEec-cCCeeEEEEEcCCCC--CCCCCeEEEEeccCCeeeeccccEEE
Q psy3964           9 DGLDHAVLAVGYGE-LDGKPYWQVKNSWST--YWGNQGYVLMSIKDNNCGVMTAPTYV   63 (65)
Q Consensus         9 ~~~~Hav~ivG~g~-~~~~~yW~i~NSwg~--~WG~~Gy~~i~~~~~~cgi~~~~~~p   63 (65)
                      ..+||||+|||||. +++.+|||||||||+  +|||+|||||.|+.|+|||++.+...
T Consensus       400 ~~~nHAVlIVGYG~de~G~~YWIVKNSWGt~~~WGE~GYfRI~RG~N~CGIes~~v~~  457 (548)
T PTZ00364        400 SNVNHTVLIIGWGTDENGGDYWLVLDPWGSRRSWCDGGTRKIARGVNAYNIESEVVVM  457 (548)
T ss_pred             ccCCeEEEEEEecccCCCceEEEEECCCCCCCCcccCCeEEEEcCCCcccccceeeee
Confidence            46899999999997 468899999999999  99999999999999999999998743


No 13 
>PTZ00049 cathepsin C-like protein; Provisional
Probab=99.84  E-value=3.8e-21  Score=145.94  Aligned_cols=55  Identities=33%  Similarity=0.799  Sum_probs=50.3

Q ss_pred             CCCeEEEEEEEecc--CC--eeEEEEEcCCCCCCCCCeEEEEeccCCeeeeccccEEEE
Q psy3964          10 GLDHAVLAVGYGEL--DG--KPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAPTYVT   64 (65)
Q Consensus        10 ~~~Hav~ivG~g~~--~~--~~yW~i~NSwg~~WG~~Gy~~i~~~~~~cgi~~~~~~p~   64 (65)
                      .++|||+|||||.+  ++  .+|||||||||+.||++|||||.|+.|.|||++++.|+.
T Consensus       617 ~~NHAVlIVGwG~d~enG~~~~YWIVRNSWGt~WGenGYfKI~RG~N~CGIEs~a~~~~  675 (693)
T PTZ00049        617 KVNHAIVLVGWGEEEINGKLYKYWIGRNSWGKNWGKEGYFKIIRGKNFSGIESQSLFIE  675 (693)
T ss_pred             cCceEEEEEEeccccCCCcccCEEEEECCCCCCcccCceEEEEcCCCccCCccceeEEe
Confidence            57999999999975  35  379999999999999999999999999999999999875


No 14 
>PTZ00462 Serine-repeat antigen protein; Provisional
Probab=99.80  E-value=6.5e-20  Score=142.97  Aligned_cols=59  Identities=39%  Similarity=0.818  Sum_probs=50.8

Q ss_pred             CCCCCCCeEEEEEEEecc-----CCeeEEEEEcCCCCCCCCCeEEEEec-cCCeeeeccccEEEE
Q psy3964           6 NSPDGLDHAVLAVGYGEL-----DGKPYWQVKNSWSTYWGNQGYVLMSI-KDNNCGVMTAPTYVT   64 (65)
Q Consensus         6 ~~~~~~~Hav~ivG~g~~-----~~~~yW~i~NSwg~~WG~~Gy~~i~~-~~~~cgi~~~~~~p~   64 (65)
                      |+...++|||+|||||.+     ++++|||||||||+.||++|||||.| +.+.|++.....+|+
T Consensus       716 Cgs~~~nHAVlIVGYGt~in~eg~gk~YWIVRNSWGt~WGEnGYFKI~r~g~n~CGin~i~t~~~  780 (1004)
T PTZ00462        716 CGDDTADHAVNIVGYGNYINDEDEKKSYWIVRNSWGKYWGDEGYFKVDMYGPSHCEDNFIHSVVI  780 (1004)
T ss_pred             CCCCcCCceEEEEEecccccccCCCCceEEEEcCCCCCcCCCeEEEEEeCCCCCCccchheeeee
Confidence            444568999999999964     25799999999999999999999998 789999987777665


No 15 
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase). Papain-like enzymes are mostly endopeptidases with some exceptions like cathepsins B, C, H and X, which are exopeptidases. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds while mammalian CPs are primarily lysosomal enzymes responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. Bleomycin hydrolase (BH) is a CP that detoxifies bleomycin by hydrolysis of an amide group. It acts as a carboxypeptidase on its C-terminus to convert itself into an aminopeptidase and peptide ligase. BH is found in all tissues in mammals as well as in many other eukaryotes. It forms a hexameric ring barrel str
Probab=99.72  E-value=1.3e-17  Score=107.55  Aligned_cols=47  Identities=45%  Similarity=0.697  Sum_probs=41.6

Q ss_pred             CCCCCCCCeEEEEEEEeccC--CeeEEEEEcCCCCCCCCCeEEEEeccC
Q psy3964           5 HNSPDGLDHAVLAVGYGELD--GKPYWQVKNSWSTYWGNQGYVLMSIKD   51 (65)
Q Consensus         5 ~~~~~~~~Hav~ivG~g~~~--~~~yW~i~NSwg~~WG~~Gy~~i~~~~   51 (65)
                      .++....+|||+|||||.+.  +++||++|||||+.||++||+|+++..
T Consensus       165 ~~~~~~~~Hav~ivGy~~~~~~~~~~~i~~NSwG~~wg~~Gy~~i~~~~  213 (223)
T cd02619         165 YEDGDLGGHAVVIVGYDDNYVEGKGAFIVKNSWGTDWGDNGYGRISYED  213 (223)
T ss_pred             cCCCccCCeEEEEEeecCCCCCCCCEEEEEeCCCCccccCCEEEEehhh
Confidence            34556789999999999876  889999999999999999999999863


No 16 
>KOG1544|consensus
Probab=99.56  E-value=3.4e-15  Score=107.56  Aligned_cols=55  Identities=29%  Similarity=0.593  Sum_probs=47.6

Q ss_pred             CCCCCCCeEEEEEEEeccC-----CeeEEEEEcCCCCCCCCCeEEEEeccCCeeeecccc
Q psy3964           6 NSPDGLDHAVLAVGYGELD-----GKPYWQVKNSWSTYWGNQGYVLMSIKDNNCGVMTAP   60 (65)
Q Consensus         6 ~~~~~~~Hav~ivG~g~~~-----~~~yW~i~NSwg~~WG~~Gy~~i~~~~~~cgi~~~~   60 (65)
                      ..-....|+|.|+|||++.     ..+||+..||||+.|||+||||+.||.|+|.|++..
T Consensus       396 ~yr~~gtHsVk~tGWG~~~~~~G~~~KyW~aANSWG~~WGE~GYFriLRGvNecdIEsfv  455 (470)
T KOG1544|consen  396 RYRRHGTHSVKITGWGEETLPDGRTLKYWTAANSWGPAWGERGYFRILRGVNECDIESFV  455 (470)
T ss_pred             hhhhcccceEEEeecccccCCCCCeeEEEEeecccccccccCceEEEeccccchhhhHhh
Confidence            3344567999999999763     467999999999999999999999999999998754


No 17 
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC). The proteins of this subfamily contain a large insert relative to the C1A peptidase (papain) subfamily. BH is a cysteine peptidase that detoxifies bleomycin by hydrolysis of an amide group. It acts as a carboxypeptidase on its C-terminus to convert itself into an aminopeptidase and peptide ligase. BH is found in all tissues in mammals as well as in many other eukaryotes. Bleomycin, a glycopeptide derived from the fungus Streptomyces verticullus, is an effective anticancer drug due to its ability to induce DNA strand breaks. Human BH is the major cause of tumor cell resistance to bleomycin chemotherapy, and is also genetically linked to Alzheimer's disease. In addition to its peptidase activity, the yeast BH (Gal6) binds DNA and acts as a repressor in the Gal4 regulatory system. BH forms a hexameric ring barrel structure w
Probab=99.51  E-value=1.4e-14  Score=105.93  Aligned_cols=43  Identities=35%  Similarity=0.627  Sum_probs=37.8

Q ss_pred             CCCCCCeEEEEEEEeccC-Ce-eEEEEEcCCCCCCCCCeEEEEec
Q psy3964           7 SPDGLDHAVLAVGYGELD-GK-PYWQVKNSWSTYWGNQGYVLMSI   49 (65)
Q Consensus         7 ~~~~~~Hav~ivG~g~~~-~~-~yW~i~NSwg~~WG~~Gy~~i~~   49 (65)
                      +.+.++|||+||||+.++ ++ .||+||||||+.||++||++|++
T Consensus       354 ~es~~tHAM~ivGv~~D~~g~p~yw~VkNSWG~~~G~~Gy~~ms~  398 (437)
T cd00585         354 GESLMTHAMVLTGVDLDEDGKPVKWKVENSWGEKVGKKGYFVMSD  398 (437)
T ss_pred             cCCcCCeEEEEEEEEecCCCCcceEEEEcccCCCCCCCcceehhH
Confidence            344679999999999864 76 59999999999999999999986


No 18 
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones]
Probab=99.30  E-value=3e-12  Score=92.25  Aligned_cols=42  Identities=43%  Similarity=0.814  Sum_probs=36.2

Q ss_pred             CCCCeEEEEEEEeccC----------CeeEEEEEcCCCCCCCCCeEEEEecc
Q psy3964           9 DGLDHAVLAVGYGELD----------GKPYWQVKNSWSTYWGNQGYVLMSIK   50 (65)
Q Consensus         9 ~~~~Hav~ivG~g~~~----------~~~yW~i~NSwg~~WG~~Gy~~i~~~   50 (65)
                      +..+|||+||||+..-          +..-||||||||+.||++||++++..
T Consensus       262 ~~~gHAv~iVGyDDs~~~n~~~~~~~g~GAfiikNSWGt~wG~~GYfwisY~  313 (372)
T COG4870         262 ENWGHAVLIVGYDDSFDINNFKYGPPGDGAFIIKNSWGTNWGENGYFWISYY  313 (372)
T ss_pred             ccccceEEEEeccccccccccccCCCCCceEEEECccccccccCceEEEEee
Confidence            6778999999998541          34489999999999999999999974


No 19 
>PF03051 Peptidase_C1_2:  Peptidase C1-like family This family is a subfamily of the Prosite entry;  InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of proteins belong to MEROPS peptidase family C1, sub-family C1B (bleomycin hydrolase, clan CA). This family contains prokaryotic and eukaryotic aminopeptidases and bleomycin hydrolases.; GO: 0004197 cysteine-type endopeptidase activity, 0006508 proteolysis; PDB: 3PW3_F 2CB5_A 1CB5_C 2DZZ_A 2E02_A 2E01_A 2E03_A 1A6R_A 1GCB_A 3GCB_A ....
Probab=99.10  E-value=1.2e-10  Score=85.40  Aligned_cols=41  Identities=41%  Similarity=0.721  Sum_probs=33.9

Q ss_pred             CCCCeEEEEEEEec-cCCe-eEEEEEcCCCCCCCCCeEEEEec
Q psy3964           9 DGLDHAVLAVGYGE-LDGK-PYWQVKNSWSTYWGNQGYVLMSI   49 (65)
Q Consensus         9 ~~~~Hav~ivG~g~-~~~~-~yW~i~NSwg~~WG~~Gy~~i~~   49 (65)
                      +..+|||+|||... ++++ .+|+|+||||++.|.+||+.|+.
T Consensus       357 S~~tHAM~itGv~~D~~g~p~~wkVeNSWG~~~g~kGy~~msd  399 (438)
T PF03051_consen  357 STMTHAMVITGVDLDEDGKPVRWKVENSWGTDNGDKGYFYMSD  399 (438)
T ss_dssp             S--EEEEEEEEEEE-TTSSEEEEEEE-SBTTTSTBTTEEEEEH
T ss_pred             CCCceeEEEEEEEeccCCCeeEEEEEcCCCCCCCCCcEEEECH
Confidence            46789999999997 4566 48999999999999999999985


No 20 
>COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism]
Probab=98.33  E-value=1.2e-07  Score=69.08  Aligned_cols=40  Identities=35%  Similarity=0.678  Sum_probs=34.6

Q ss_pred             CCCeEEEEEEEecc-CCeeE-EEEEcCCCCCCCCCeEEEEec
Q psy3964          10 GLDHAVLAVGYGEL-DGKPY-WQVKNSWSTYWGNQGYVLMSI   49 (65)
Q Consensus        10 ~~~Hav~ivG~g~~-~~~~y-W~i~NSwg~~WG~~Gy~~i~~   49 (65)
                      -+.|||+|+|.+.+ ++.+. |.|+||||.+-|.+|||.++.
T Consensus       360 LmTHAMvlTGvd~d~~g~p~rwkVENSWG~d~G~~GyfvaSd  401 (444)
T COG3579         360 LMTHAMVLTGVDLDETGNPLRWKVENSWGKDVGKKGYFVASD  401 (444)
T ss_pred             HHHHHHHhhccccccCCCceeeEeecccccccCCCceEeehH
Confidence            36799999999965 45665 999999999999999999874


No 21 
>KOG4128|consensus
Probab=95.19  E-value=0.0011  Score=48.65  Aligned_cols=39  Identities=31%  Similarity=0.466  Sum_probs=31.6

Q ss_pred             CCeEEEEEEEecc-C---CeeEEEEEcCCCCCCCCCeEEEEec
Q psy3964          11 LDHAVLAVGYGEL-D---GKPYWQVKNSWSTYWGNQGYVLMSI   49 (65)
Q Consensus        11 ~~Hav~ivG~g~~-~---~~~yW~i~NSwg~~WG~~Gy~~i~~   49 (65)
                      .+|||++++.+.. .   +-.-|.|+||||.+-|.+|+.+|..
T Consensus       371 mthAml~T~v~~kd~~~g~~~~~rVenswgkd~gkkg~~~mt~  413 (457)
T KOG4128|consen  371 MTHAMLLTSVGLKDPATGGLNEHRVENSWGKDLGKKGVNKMTA  413 (457)
T ss_pred             HHHHHHhhhccccCcccCCchhhhhhchhhhhccccchhhhhH
Confidence            5799999999942 2   2234999999999999999988763


No 22 
>PF05543 Peptidase_C47:  Staphopain peptidase C47;  InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to the peptidase family C47 (staphopain family, clan CA). The type example are the staphopains, which are one of four major families of proteinases secreted by the Gram-positive Staphylococcus aureus. These staphylococcal cysteine proteases are secreted as preproenzymes that are proteolytically cleaved to generate the mature enzyme [, , ].; GO: 0008234 cysteine-type peptidase activity, 0006508 proteolysis; PDB: 1X9Y_D 1Y4H_B 1PXV_B 1CV8_A.
Probab=88.56  E-value=1.1  Score=29.93  Aligned_cols=39  Identities=26%  Similarity=0.438  Sum_probs=24.6

Q ss_pred             CCCCCCeEEEEEEEec-cCCeeEEEEEcCCCCCCCCCeEEEEecc
Q psy3964           7 SPDGLDHAVLAVGYGE-LDGKPYWQVKNSWSTYWGNQGYVLMSIK   50 (65)
Q Consensus         7 ~~~~~~Hav~ivG~g~-~~~~~yW~i~NSwg~~WG~~Gy~~i~~~   50 (65)
                      +.....||++|+||.. .++.++..+=|=|-.     +++.++..
T Consensus       115 ~~~~~gHAlavvGya~~~~g~~~y~~WNPW~~-----~~~~~sa~  154 (175)
T PF05543_consen  115 NGPHAGHALAVVGYAKPNNGQKTYYFWNPWWN-----DVMIQSAK  154 (175)
T ss_dssp             TTB--EEEEEEEEEEEETTSEEEEEEE-TT-S-----S-EEEETT
T ss_pred             CCCccceeEEEEeeeecCCCCeEEEEeCCccC-----CcEEEecC
Confidence            4446789999999986 457889888886633     45555544


No 23 
>PF13529 Peptidase_C39_2:  Peptidase_C39 like family; PDB: 3ERV_A.
Probab=86.72  E-value=0.79  Score=26.79  Aligned_cols=24  Identities=33%  Similarity=0.580  Sum_probs=14.9

Q ss_pred             CCCCeEEEEEEEeccCCeeEEEEEcCC
Q psy3964           9 DGLDHAVLAVGYGELDGKPYWQVKNSW   35 (65)
Q Consensus         9 ~~~~Hav~ivG~g~~~~~~yW~i~NSw   35 (65)
                      ....|.|+|+||..+.   ++++..+|
T Consensus       121 ~~~~H~vvi~Gy~~~~---~~~v~DP~  144 (144)
T PF13529_consen  121 TYGGHYVVIIGYDEDG---YVYVNDPW  144 (144)
T ss_dssp             -TTEEEEEEEEE-SSE----EEEE-TT
T ss_pred             CcCCEEEEEEEEeCCC---EEEEeCCC
Confidence            3568999999998643   56665554


No 24 
>cd00044 CysPc Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like. Functions in cytoskeletal remodeling processes, cell differentiation, apoptosis and signal transduction.
Probab=51.57  E-value=24  Score=24.51  Aligned_cols=28  Identities=21%  Similarity=0.404  Sum_probs=23.5

Q ss_pred             CCCeEEEEEEEeccC--CeeEEEEEcCCCC
Q psy3964          10 GLDHAVLAVGYGELD--GKPYWQVKNSWST   37 (65)
Q Consensus        10 ~~~Hav~ivG~g~~~--~~~yW~i~NSwg~   37 (65)
                      ..+||-.|+++-..+  +..+-.++|-||.
T Consensus       234 ~~~HaY~Vl~~~~~~~~~~~lv~lrNPWg~  263 (315)
T cd00044         234 VKGHAYSVLDVREVQEEGLRLLRLRNPWGV  263 (315)
T ss_pred             ccCcceEEeEEEEEccCceEEEEecCCccC
Confidence            458999999998655  7888999999994


No 25 
>cd03581 NTR_Sfrp3_like NTR domain, Secreted frizzled-related protein (Sfrp) 3-like subfamily; composed of proteins similar to human Sfrp3 and Sfrp4. Sfrps are soluble proteins containing an NTR domain C-terminal to a cysteine-rich Frizzled domain. They show diverse functions and are thought to work in Wnt signaling indirectly, as modulators or antagonists by binding Wnt ligands, and directly, via the Wnt receptor, Frizzled. They participate in regulating the patterning along the anteroposterior axis in vertebrates. Human Sfrp3 may suppress the growth and invasiveness of androgen-independent prostate cancer cells.
Probab=46.35  E-value=18  Score=21.93  Aligned_cols=38  Identities=16%  Similarity=0.261  Sum_probs=26.1

Q ss_pred             CCCCCCCCCCeEEEEEEEeccCCeeEEEEEcCCCCCCC
Q psy3964           3 KGHNSPDGLDHAVLAVGYGELDGKPYWQVKNSWSTYWG   40 (65)
Q Consensus         3 ~~~~~~~~~~Hav~ivG~g~~~~~~yW~i~NSwg~~WG   40 (65)
                      .|.|-....+..-+|.|........|.+-++||=..|-
T Consensus        55 ~C~cp~l~~gk~YLImG~~~~~~~~~~ld~~S~Ve~W~   92 (111)
T cd03581          55 GCLCPPLTPNEEYIIMGYEDEERSRLLLVEGSLAEKWK   92 (111)
T ss_pred             CCCCccccCCCEEEEEecCCCCcceEEeCCceEEEEhh
Confidence            46666666888999999953334556777788766553


No 26 
>COG4990 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.23  E-value=16  Score=24.84  Aligned_cols=22  Identities=23%  Similarity=0.386  Sum_probs=15.1

Q ss_pred             CCeEEEEEEEeccCCeeEEEEEcCCC
Q psy3964          11 LDHAVLAVGYGELDGKPYWQVKNSWS   36 (65)
Q Consensus        11 ~~Hav~ivG~g~~~~~~yW~i~NSwg   36 (65)
                      .-|+|+|+||+..    +...-+.||
T Consensus       147 s~H~v~itgyDk~----n~yynDpyG  168 (195)
T COG4990         147 SIHSVLITGYDKY----NIYYNDPYG  168 (195)
T ss_pred             ceeeeEeeccccc----ceEeccccc
Confidence            4599999999854    444455553


No 27 
>PF14399 Transpep_BrtH:  NlpC/p60-like transpeptidase
Probab=40.40  E-value=36  Score=23.05  Aligned_cols=23  Identities=22%  Similarity=0.476  Sum_probs=16.7

Q ss_pred             CCCeEEEEEEEeccCCeeEEEEEc
Q psy3964          10 GLDHAVLAVGYGELDGKPYWQVKN   33 (65)
Q Consensus        10 ~~~Hav~ivG~g~~~~~~yW~i~N   33 (65)
                      ..+|.++|+||+.++ ..|.++..
T Consensus       111 ~~~H~i~v~G~d~~~-~~~~v~D~  133 (317)
T PF14399_consen  111 HADHYIVVYGYDEEE-DVFYVSDP  133 (317)
T ss_pred             cCCcEEEEEEEeCCC-CEEEEEcC
Confidence            468999999998653 44666654


No 28 
>PF09778 Guanylate_cyc_2:  Guanylylate cyclase;  InterPro: IPR018616  Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate. 
Probab=38.59  E-value=52  Score=22.55  Aligned_cols=24  Identities=25%  Similarity=0.462  Sum_probs=16.4

Q ss_pred             CCCCCeEEEEEEEeccCCeeEEEEEc
Q psy3964           8 PDGLDHAVLAVGYGELDGKPYWQVKN   33 (65)
Q Consensus         8 ~~~~~Hav~ivG~g~~~~~~yW~i~N   33 (65)
                      +.-..|.|+|+||..+.+  -..++|
T Consensus       157 ~~Y~GHYVVlcGyd~~~~--~~~yrd  180 (212)
T PF09778_consen  157 PDYQGHYVVLCGYDAATK--EFEYRD  180 (212)
T ss_pred             CCccEEEEEEEeecCCCC--eEEEeC
Confidence            445679999999987542  244444


No 29 
>PF00648 Peptidase_C2:  Calpain family cysteine protease This is family C2 in the peptidase classification. ;  InterPro: IPR001300 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to the MEROPS peptidase family C2 (calpain family, clan CA). A type example is calpain, which is an intracellular protease involved in many important cellular functions that are regulated by calcium []. The protein is a complex of 2 polypeptide chains (light and heavy), with three known forms in mammals [, ]: a highly calcium-sensitive (i.e., micro-molar range) form known as mu-calpain, mu-CANP or calpain I; a form sensitive to calcium in the milli-molar range, known as m-calpain, m-CANP or calpain II; and a third form, known as p94, which is found in skeletal muscle only [].  All forms have identical light but different heavy chains. Both mu- and m-calpain are heterodimers containing an identical 28kDa subunit and an 80kDa subunit that shares 55-65% sequence homology between the two proteases [, ]. The crystallographic structure of m-calpain reveals six "domains" in the 80kDa subunit:    A 19-amino acid NH2-terminal sequence; Active site domain IIa; Active site domain IIb.  Domain 2 shows low levels of sequence similarity to papain; although the catalytic His has not been located by biochemical means, it is likely that calpain and papain are related [].  Domain III; An 18-amino acid extended sequence linking domain III to domain IV; Domain IV, which resembles the penta EF-hand family of polypeptides, binds calcium and regulates activity []. />]. Ca2+-binding causes a rearrangement of the protein backbone, the net effect of which is that a Trp side chain, which acts as a wedge between catalytic domains IIa and IIb in the apo state, moves away from the active site cleft allowing for the proper formation of the catalytic triad [].   Calpain-like mRNAs have been identified in other organisms including bacteria, but the molecules encoded by these mRNAs have not been isolated, so little is known about their properties. How calpain activity is regulated in these organisms cells is still unclear In metazoans, the activity of calpain is controlled by a single proteinase inhibitor, calpastatin (IPR001259 from INTERPRO). The calpastatin gene can produce eight or more calpastatin polypeptides ranging from 17 to 85 kDa by use of different promoters and alternative splicing events. The physiological significance of these different calpastatins is unclear, although all bind to three different places on the calpain molecule; binding to at least two of the sites is Ca2+ dependent. The calpains ostensibly participate in a variety of cellular processes including remodelling of cytoskeletal/membrane attachments, different signal transduction pathways, and apoptosis. Deregulated calpain activity following loss of Ca2+ homeostasis results in tissue damage in response to events such as myocardial infarcts, stroke, and brain trauma [].  Calpains are a family of cytosolic cysteine proteinases (see PDOC00126 from PROSITEDOC). Members of the calpain family are believed to function in various biological processes, including integrin-mediated cell migration, cytoskeletal remodeling, cell differentiation and apoptosis [, ]. The calpain family includes numerous members from C. elegans to mammals and with homologues in yeast and bacteria. The best characterised members are the m- and mu-calpains, both proteins are heterodimer composed of a large catalytic subunit and a small regulatory subunit. The large subunit comprises four domains (dI-dIV) while the small subunit has two domains (dV-dVI). Domain dI is a short region cleaved by autolysis, dII is the catalytic core, dIII is a C2-like domain, dIV consists of five calcium binding EF-hand motifs []. The crystal structure of calpain has been solved [, ]. The catalytic region consists of two distinct structural domains (dIIa and dIIb). dIIa contains a central helix flanked on three faces by a cluster of alpha-helices and is entirely unrelated to the corresponding domain in the typical thiol proteinases. The fold of dIIb is similar to the corresponding domain in other cysteine proteinases and contains two three-stranded anti-parallel beta-sheets. The catalytic triad residues (C,H,N) are located in dIIa and dIIb. The activation of the domain is dependent on the binding of two calcium atoms in two non EF-hand calcium binding sites located in the catalytic core, one close to the Cys active site in dIIa and one at the end of dIIb. Calcium-binding induced conformational changes in the catalytic domain which align the active site [][]. The profile covers the whole catalytic domain.; GO: 0004198 calcium-dependent cysteine-type endopeptidase activity, 0006508 proteolysis, 0005622 intracellular; PDB: 2NQA_A 1KFU_L 1KFX_L 1QXP_B 2R9C_A 1TL9_A 2G8E_A 1KXR_B 2G8J_A 2NQG_A ....
Probab=34.90  E-value=52  Score=22.43  Aligned_cols=28  Identities=21%  Similarity=0.455  Sum_probs=19.1

Q ss_pred             CCCeEEEEEEEeccCC----eeEEEEEcCCCC
Q psy3964          10 GLDHAVLAVGYGELDG----KPYWQVKNSWST   37 (65)
Q Consensus        10 ~~~Hav~ivG~g~~~~----~~yW~i~NSwg~   37 (65)
                      ..+||..|+++-..++    ..+-.++|-||.
T Consensus       212 ~~~HaY~Vl~~~~~~~~~~~~~lv~LrNPwg~  243 (298)
T PF00648_consen  212 VPGHAYAVLDVREVNGNGEGHRLVKLRNPWGS  243 (298)
T ss_dssp             BTTS-EEEEEEEEEEETTEEEEEEEEE-TTSS
T ss_pred             ccceeEEEEEEEeeccccceeEEEEEcCCCcc
Confidence            3689999999975332    456788999984


No 30 
>cd02549 Peptidase_C39A A sub-family of peptidase family C39. Peptidase family C39 mostly contains bacteriocin-processing endopeptidases from bacteria. The cysteine peptidases in family C39 cleave the "double-glycine" leader peptides from the precursors of various bacteriocins (mostly non-lantibiotic). The cleavage is mediated by the transporter as part of the secretion process. Bacteriocins are antibiotic proteins secreted by some species of bacteria that inhibit the growth of other bacterial species. The bacteriocin is synthesized as a precursor with an N-terminal leader peptide, and processing involves removal of the leader peptide by cleavage at a Gly-Gly bond, followed by translocation of the mature bacteriocin across the cytoplasmic membrane. Most endopeptidases of family C39 are N-terminal domains in larger proteins (ABC transporters) that serve both functions. The proposed protease active site is conserved in this sub-family of proteins with a single peptidase domain, which are 
Probab=30.35  E-value=53  Score=19.23  Aligned_cols=12  Identities=33%  Similarity=0.720  Sum_probs=10.4

Q ss_pred             CCCeEEEEEEEe
Q psy3964          10 GLDHAVLAVGYG   21 (65)
Q Consensus        10 ~~~Hav~ivG~g   21 (65)
                      ..+|.++|+||.
T Consensus        92 ~~gH~vVv~g~~  103 (141)
T cd02549          92 PSGHAMVVIGYD  103 (141)
T ss_pred             CCCeEEEEEEEc
Confidence            367999999997


No 31 
>PF08151 FerI:  FerI (NUC094) domain;  InterPro: IPR012968  The ferlin gene family are characterised by multiple tandem C2 domains and a C-terminal transmembrane domain. They are found in a wide range of species and their function remains unknown, however, mutations in its two most well-characterised members, dysferlin and otoferlin, have been implicated in human disease []. This domain is present in proteins of the Ferlin family, which includes Otoferlin, Myoferlin and Dysferlin. It is often located between two C2 domains [].
Probab=29.01  E-value=1.2e+02  Score=17.26  Aligned_cols=21  Identities=29%  Similarity=0.525  Sum_probs=14.4

Q ss_pred             EEEEc-CCCCCCCCCeEEEEec
Q psy3964          29 WQVKN-SWSTYWGNQGYVLMSI   49 (65)
Q Consensus        29 W~i~N-Swg~~WG~~Gy~~i~~   49 (65)
                      |+.=+ -=...-|-+||++++.
T Consensus        18 W~~L~dP~D~~~G~kGYlKv~i   39 (72)
T PF08151_consen   18 WALLTDPDDTSAGVKGYLKVDI   39 (72)
T ss_pred             eEEecCCCCCccCCceEEEEEE
Confidence            66544 3334568999999985


No 32 
>PF01640 Peptidase_C10:  Peptidase C10 family classification.;  InterPro: IPR000200 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to MEROPS peptidase family C10 (streptopain family, clan CA). Streptopain is a cysteine protease found in Streptococcus pyogenes that shows some structural and functional similarity to papain (family C1) [, ]. The order of the catalytic cysteine/histidine dyad is the same and the surrounding sequences are similar. The two proteins also show similar specificities, both preferring a hydrophobic residue at the P2 site [, ]. Streptopain shows a high degree of sequence similarity to the S. pyogenes exotoxin B, and strong similarity to the prtT gene product of Porphyromonas gingivalis (Bacteroides gingivalis), both of which have been included in the family [].; GO: 0008234 cysteine-type peptidase activity, 0006508 proteolysis; PDB: 4D8I_A 4D8E_A 4D8B_A 3BBA_B 3BB7_A 2JTC_A 1PVJ_A 1DKI_D 2UZJ_A.
Probab=25.81  E-value=1.8e+02  Score=18.90  Aligned_cols=30  Identities=27%  Similarity=0.580  Sum_probs=19.8

Q ss_pred             CeEEEEEEEeccCCeeEEEEEcCCCCCCCCCeEEE
Q psy3964          12 DHAVLAVGYGELDGKPYWQVKNSWSTYWGNQGYVL   46 (65)
Q Consensus        12 ~Hav~ivG~g~~~~~~yW~i~NSwg~~WG~~Gy~~   46 (65)
                      .||-+|=||..   ..|+-+-=.||-.  .+||++
T Consensus       163 GHawViDGy~~---~~~~H~NwGW~G~--~nGyy~  192 (192)
T PF01640_consen  163 GHAWVIDGYDS---DGYFHCNWGWGGS--SNGYYR  192 (192)
T ss_dssp             EEEEEEEEEES---SSEEEEE-SSTTT--T-EEEE
T ss_pred             CeEEEEcCccC---CCeEEEeeCccCC--CCCccC
Confidence            79999999953   3466665566554  578874


No 33 
>PHA02885 putative interleukin binding protein; Provisional
Probab=24.38  E-value=1.2e+02  Score=19.13  Aligned_cols=15  Identities=33%  Similarity=0.486  Sum_probs=11.4

Q ss_pred             eccCCeeEEEEEcCC
Q psy3964          21 GELDGKPYWQVKNSW   35 (65)
Q Consensus        21 g~~~~~~yW~i~NSw   35 (65)
                      ..|++--||+..|+-
T Consensus        57 nsedgyiywi~pnnt   71 (135)
T PHA02885         57 NSEDGYIYWIGPNNT   71 (135)
T ss_pred             cCCCceEEEEeCCCC
Confidence            356678899999974


No 34 
>smart00230 CysPc Calpain-like thiol protease family. Calpain-like thiol protease family (peptidase family C2). Calcium activated neutral protease (large subunit).
Probab=21.88  E-value=1.3e+02  Score=21.09  Aligned_cols=28  Identities=21%  Similarity=0.439  Sum_probs=21.5

Q ss_pred             CCCeEEEEEEEeccCCee--EEEEEcCCCC
Q psy3964          10 GLDHAVLAVGYGELDGKP--YWQVKNSWST   37 (65)
Q Consensus        10 ~~~Hav~ivG~g~~~~~~--yW~i~NSwg~   37 (65)
                      ..+||-.|++...-++..  .-.++|-||.
T Consensus       226 v~~HaYsVl~v~~~~~~~~~Ll~lrNPWg~  255 (318)
T smart00230      226 VKGHAYSVTDVREVQGRRQELLRLRNPWGQ  255 (318)
T ss_pred             ccCccEEEEEEEEEecCCeEEEEEECCCCC
Confidence            358999999987644444  7899999983


Done!