Query         psy3967
Match_columns 324
No_of_seqs    259 out of 1221
Neff          6.4 
Searched_HMMs 46136
Date          Fri Aug 16 21:53:07 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3967.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3967hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1101|consensus               99.9 7.1E-28 1.5E-32  206.9   6.2   94  165-258     5-100 (147)
  2 smart00238 BIR Baculoviral inh  99.9 3.2E-23 6.9E-28  157.1   6.5   70  174-243     1-70  (71)
  3 KOG1101|consensus               99.9 5.4E-23 1.2E-27  176.7   5.2   81   30-117     6-89  (147)
  4 cd00022 BIR Baculoviral inhibi  99.9 1.1E-22 2.5E-27  153.2   5.5   68  176-243     1-68  (69)
  5 PF00653 BIR:  Inhibitor of Apo  99.9 7.5E-23 1.6E-27  155.1   4.1   66  178-243     1-70  (70)
  6 smart00238 BIR Baculoviral inh  99.9 1.9E-22 4.2E-27  152.8   6.0   69   38-113     1-70  (71)
  7 cd00022 BIR Baculoviral inhibi  99.9 3.8E-22 8.2E-27  150.3   5.3   67   40-113     1-68  (69)
  8 PF00653 BIR:  Inhibitor of Apo  99.8 8.1E-22 1.7E-26  149.4   4.0   66   42-113     1-70  (70)
  9 PF13920 zf-C3HC4_3:  Zinc fing  97.8   1E-05 2.2E-10   57.0   2.1   26  298-323     2-27  (50)
 10 KOG4275|consensus               97.7 1.3E-05 2.9E-10   75.4   1.0   26  298-323   300-325 (350)
 11 KOG4265|consensus               97.6   2E-05 4.3E-10   76.2   1.3   28  297-324   289-316 (349)
 12 KOG1571|consensus               97.2 0.00018 3.8E-09   69.8   2.8   29  295-323   302-330 (355)
 13 KOG1100|consensus               96.4  0.0018 3.9E-08   59.2   2.1   26  299-324   159-184 (207)
 14 KOG4172|consensus               96.1 0.00047   1E-08   49.6  -2.4   25  299-323     8-32  (62)
 15 PF07967 zf-C3HC:  C3HC zinc fi  96.1  0.0077 1.7E-07   51.0   4.2   48   36-90      4-54  (133)
 16 PF07967 zf-C3HC:  C3HC zinc fi  95.8  0.0088 1.9E-07   50.6   3.3   47  173-220     5-54  (133)
 17 PF13923 zf-C3HC4_2:  Zinc fing  94.8    0.02 4.3E-07   38.0   1.9   21  301-321     1-22  (39)
 18 smart00184 RING Ring finger. E  93.8   0.031 6.7E-07   35.3   1.2   20  301-320     1-20  (39)
 19 PF13445 zf-RING_UBOX:  RING-ty  92.8   0.072 1.6E-06   36.6   1.8   20  301-321     1-24  (43)
 20 PF00097 zf-C3HC4:  Zinc finger  90.8    0.16 3.4E-06   33.6   1.7   21  301-321     1-22  (41)
 21 KOG4692|consensus               88.8    0.14 3.1E-06   50.0   0.3   26  296-321   420-445 (489)
 22 PF15227 zf-C3HC4_4:  zinc fing  88.4    0.37   8E-06   32.7   2.1   21  301-321     1-21  (42)
 23 KOG1785|consensus               86.1    0.18 3.9E-06   50.0  -0.7   24  298-321   369-392 (563)
 24 PF13639 zf-RING_2:  Ring finge  84.7    0.61 1.3E-05   31.4   1.6   22  300-321     2-26  (44)
 25 PF14447 Prok-RING_4:  Prokaryo  84.2    0.53 1.2E-05   34.0   1.2   25  297-321     6-30  (55)
 26 PF14634 zf-RING_5:  zinc-RING   81.9    0.59 1.3E-05   31.7   0.6   22  300-321     1-25  (44)
 27 cd00162 RING RING-finger (Real  81.2    0.76 1.6E-05   29.8   1.0   21  300-320     1-22  (45)
 28 KOG0823|consensus               80.2    0.82 1.8E-05   42.3   1.1   24  298-321    47-70  (230)
 29 COG5574 PEX10 RING-finger-cont  77.4    0.79 1.7E-05   43.2   0.2   25  298-322   215-239 (271)
 30 KOG0317|consensus               74.9    0.84 1.8E-05   43.5  -0.3   24  298-321   239-262 (293)
 31 KOG4765|consensus               74.6     1.7 3.8E-05   42.9   1.7   53   32-91     47-102 (419)
 32 PF11682 DUF3279:  Protein of u  71.0     3.5 7.5E-05   35.0   2.5   60  190-255    15-83  (128)
 33 smart00504 Ubox Modified RING   70.6     2.8 6.1E-05   29.9   1.6   23  299-321     2-24  (63)
 34 KOG4765|consensus               67.3     3.7 8.1E-05   40.7   2.2   52  168-220    47-101 (419)
 35 KOG1814|consensus               66.9     1.8 3.9E-05   43.3  -0.1   24  298-321   184-210 (445)
 36 PHA02929 N1R/p28-like protein;  65.7     3.2   7E-05   38.8   1.4   25  297-321   173-205 (238)
 37 PF08600 Rsm1:  Rsm1-like;  Int  64.3     3.7 7.9E-05   32.6   1.3   34   78-114    18-63  (91)
 38 PLN00032 DNA-directed RNA poly  59.5     4.5 9.6E-05   30.8   0.9   11  210-220     5-15  (71)
 39 KOG3497|consensus               58.6       4 8.6E-05   30.2   0.5   15  209-223     4-19  (69)
 40 COG5243 HRD1 HRD ubiquitin lig  57.6     4.7  0.0001   40.0   0.9   25  296-320   285-322 (491)
 41 PRK04016 DNA-directed RNA poly  55.5       6 0.00013   29.4   1.0   12  209-220     4-15  (62)
 42 KOG2164|consensus               54.5     5.6 0.00012   40.9   0.9   26  298-323   186-211 (513)
 43 COG5236 Uncharacterized conser  52.2     7.1 0.00015   38.4   1.2   27  295-321    58-84  (493)
 44 PF01194 RNA_pol_N:  RNA polyme  48.7     5.7 0.00012   29.3  -0.0   11  210-220     5-15  (60)
 45 COG1644 RPB10 DNA-directed RNA  48.3      12 0.00025   27.8   1.5   12  209-220     4-15  (63)
 46 KOG4628|consensus               46.9      12 0.00026   36.9   1.9   22  299-320   230-254 (348)
 47 PHA02926 zinc finger-like prot  46.4     7.1 0.00015   36.2   0.2   26  296-321   168-202 (242)
 48 PF12678 zf-rbx1:  RING-H2 zinc  44.2      19  0.0004   27.2   2.2   20  301-320    22-54  (73)
 49 KOG0978|consensus               41.6     3.9 8.5E-05   43.7  -2.5   31  291-321   636-666 (698)
 50 PF10367 Vps39_2:  Vacuolar sor  41.3      21 0.00045   28.0   2.2   27  295-321    75-103 (109)
 51 smart00744 RINGv The RING-vari  40.7      17 0.00038   25.3   1.4   18  300-317     1-20  (49)
 52 COG5540 RING-finger-containing  37.3      18 0.00039   35.1   1.4   26  295-320   320-348 (374)
 53 PF04564 U-box:  U-box domain;   31.9      41 0.00088   25.2   2.3   24  297-320     3-26  (73)
 54 PF04710 Pellino:  Pellino;  In  28.7      19 0.00041   36.1   0.0   13  309-321   358-370 (416)
 55 KOG0320|consensus               23.6      24 0.00052   31.6  -0.3   24  298-321   131-156 (187)
 56 COG4416 Com Mu-like prophage p  20.4      86  0.0019   22.7   2.0   37   58-103    12-48  (60)
 57 KOG0802|consensus               20.2      40 0.00088   35.1   0.5   24  297-320   290-318 (543)

No 1  
>KOG1101|consensus
Probab=99.94  E-value=7.1e-28  Score=206.92  Aligned_cols=94  Identities=48%  Similarity=0.989  Sum_probs=88.6

Q ss_pred             CCCCCCCCCCHHHHHhccccCCCCC--CCChHHHHHcCCcccCCCCceEEeeeCCcccCCCCCCChHHHHHhhcCCCchh
Q psy3967         165 SPPAFPNYATYESRLRSFDSWPISL--RLKPVTLTEAGFFYTGKADQTLCFRCGGGLKHWEETDDPWTEHARWFSSCPYV  242 (324)
Q Consensus       165 ~~p~~~~y~~~~~Rl~SF~~Wp~~~--~~~~~~LA~AGFyytg~~D~v~Cf~Cg~~l~~W~~~DdP~~eH~~~~p~C~f~  242 (324)
                      ..|.++.|..+++|++||.+||+..  .+.|+.||+|||||+|..|.++||+|+++|.+|+++||||+||++|+|.|.|+
T Consensus         5 ~~~~~~~~~~~~aRl~TF~~Wp~~~~~~c~p~~lA~AGFy~~g~~D~~~Cf~C~~~L~~We~~DDPW~EH~k~~p~C~F~   84 (147)
T KOG1101|consen    5 FDPQNPKMAREEARLKTFKNWPYSDMDKCTPEQLAEAGFYYTGKQDCVKCFFCSGGLDDWEPGDDPWEEHAKWSPECEFL   84 (147)
T ss_pred             ccccchhHHHHHHHHhhhhcCCCCCCCCcCHHHHHhCCceeeCCCCceECcccCcccccCCCCCCcHHHHHhhCCCCcee
Confidence            4567888999999999999999986  68999999999999999999999999999999999999999999999999999


Q ss_pred             hhccchhHHHhhhccc
Q psy3967         243 KLVKGQEFINQVIGHK  258 (324)
Q Consensus       243 ~~~kg~~~i~~v~~~~  258 (324)
                      +..||++|+..|+...
T Consensus        85 ~~~k~~e~~~~v~~~~  100 (147)
T KOG1101|consen   85 KLKKGREFLGTVQSTA  100 (147)
T ss_pred             ecccchhhhhHHHHhH
Confidence            9999999999998654


No 2  
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat. Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
Probab=99.88  E-value=3.2e-23  Score=157.07  Aligned_cols=70  Identities=50%  Similarity=1.208  Sum_probs=65.4

Q ss_pred             CHHHHHhccccCCCCCCCChHHHHHcCCcccCCCCceEEeeeCCcccCCCCCCChHHHHHhhcCCCchhh
Q psy3967         174 TYESRLRSFDSWPISLRLKPVTLTEAGFFYTGKADQTLCFRCGGGLKHWEETDDPWTEHARWFSSCPYVK  243 (324)
Q Consensus       174 ~~~~Rl~SF~~Wp~~~~~~~~~LA~AGFyytg~~D~v~Cf~Cg~~l~~W~~~DdP~~eH~~~~p~C~f~~  243 (324)
                      ++++|++||.+||+...+.++.||+|||||+|.+|.|+|++|++.|.+|+++|+||++|++++|+|.|++
T Consensus         1 ~~~~R~~sF~~w~~~~~~~~~~LA~~Gfyy~~~~d~v~C~~C~~~l~~w~~~d~p~~~H~~~~p~C~fv~   70 (71)
T smart00238        1 SEEARLKTFQNWPYNSKLTPEQLAEAGFYYTGVGDEVKCFFCGGELDNWEPGDDPWEEHKKWSPNCPFVR   70 (71)
T ss_pred             CHHHHHHHHHcCCCCccCCHHHHHHcCCeECCCCCEEEeCCCCCCcCCCCCCCCHHHHHhHhCcCCcCcc
Confidence            3689999999999744578999999999999999999999999999999999999999999999999985


No 3  
>KOG1101|consensus
Probab=99.87  E-value=5.4e-23  Score=176.75  Aligned_cols=81  Identities=47%  Similarity=0.929  Sum_probs=74.9

Q ss_pred             cccccCCcCHHHHHhccCCCCCCCC---cCHHHHHHcCceecCCCCCCCCCCeEeecccCceeccccCCCChhhhhcccC
Q psy3967          30 CSRKQNMTLECDRLDSFKNSWPLTY---LSAKQMAAAGFYFLGKKENGRFSDDVKCIFCGIELGKWVQGDDPLKDHEKWS  106 (324)
Q Consensus        30 ~~~~~~~~~e~~RL~SF~~~Wp~~~---~~~~~LA~aGFyy~g~~~~~~~~D~V~C~~C~~~l~~w~~~Ddp~~eH~~~s  106 (324)
                      +.....|..+++||+||.+ ||++.   +.|+.||+|||||+|.      +|.|+||+|++.|.+|+++||||.||.+|+
T Consensus         6 ~~~~~~~~~~~aRl~TF~~-Wp~~~~~~c~p~~lA~AGFy~~g~------~D~~~Cf~C~~~L~~We~~DDPW~EH~k~~   78 (147)
T KOG1101|consen    6 DPQNPKMAREEARLKTFKN-WPYSDMDKCTPEQLAEAGFYYTGK------QDCVKCFFCSGGLDDWEPGDDPWEEHAKWS   78 (147)
T ss_pred             cccchhHHHHHHHHhhhhc-CCCCCCCCcCHHHHHhCCceeeCC------CCceECcccCcccccCCCCCCcHHHHHhhC
Confidence            3456679999999999999 99985   8999999999999999      899999999999999999999999999999


Q ss_pred             CCCcccccccc
Q psy3967         107 PNCWFLRRLKK  117 (324)
Q Consensus       107 P~C~f~~~~~~  117 (324)
                      |.|.|++..+.
T Consensus        79 p~C~F~~~~k~   89 (147)
T KOG1101|consen   79 PECEFLKLKKG   89 (147)
T ss_pred             CCCceeecccc
Confidence            99999987643


No 4  
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger.
Probab=99.87  E-value=1.1e-22  Score=153.18  Aligned_cols=68  Identities=56%  Similarity=1.263  Sum_probs=64.3

Q ss_pred             HHHHhccccCCCCCCCChHHHHHcCCcccCCCCceEEeeeCCcccCCCCCCChHHHHHhhcCCCchhh
Q psy3967         176 ESRLRSFDSWPISLRLKPVTLTEAGFFYTGKADQTLCFRCGGGLKHWEETDDPWTEHARWFSSCPYVK  243 (324)
Q Consensus       176 ~~Rl~SF~~Wp~~~~~~~~~LA~AGFyytg~~D~v~Cf~Cg~~l~~W~~~DdP~~eH~~~~p~C~f~~  243 (324)
                      ++|++||.+||++....++.||+|||||+|.+|.++|++|++.|.+|+++|+||++|.+++|+|+|++
T Consensus         1 ~~R~~TF~~w~~~~~~~~~~La~~Gfyy~~~~d~v~C~~C~~~~~~w~~~d~p~~~H~~~~p~C~fv~   68 (69)
T cd00022           1 EARLKTFKNWPISLKVTPEKLAEAGFYYTGRGDEVKCFFCGLELKNWEPGDDPWEEHKRWSPNCPFVL   68 (69)
T ss_pred             ChHHHHHHcCCCCccCCHHHHHHcCCeEcCCCCEEEeCCCCCCccCCCCCCCHHHHHhHhCcCCcCcc
Confidence            36999999999985578999999999999999999999999999999999999999999999999986


No 5  
>PF00653 BIR:  Inhibitor of Apoptosis domain;  InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.   The baculovirus inhibitor of apoptosis protein repeat (BIR) is a domain of tandem repeats separated by a variable length linker that seems to confer cell death-preventing activity [, ]. The BIR domains characterise the Inhibitor of Apoptosis (IAP) family of proteins (MEROPS proteinase inhibitor family I32, clan IV) that suppress apoptosis by interacting with and inhibiting the enzymatic activity of both initiator and effector caspases (MEROPS peptidase family C14, IPR002398 from INTERPRO). Several distinct mammalian IAPs including XIAP, c-IAP1, c-IAP2, and ML-IAP, have been identified, and they all exhibit antiapoptotic activity in cell culture. The functional unit in each IAP protein is the baculoviral IAP repeat (BIR), which contains approximately 80 amino acids folded around a zinc atom. Most mammalian IAPs have more than one BIR domain, with the different BIR domains performing distinct functions. For example, in XIAP, the third BIR domain (BIR3) potently inhibits the catalytic activity of caspase-9, whereas the linker sequences immediately preceding the second BIR domain (BIR2) selectively targets caspase-3 or -7.  The first-recognised members of family MEROPS inhibitor family I32 were viral proteins that inhibited the apoptosis of infected cells: Cp-IAP from Cydia pomonella granulosis virus (CpGV) [] and Op-IAP from Orgyia pseudotsugata multicapsid polyhedrosis virus(OpMNPV) []. The discovery of homologous proteins in mammals followed soon after with the recognition that mutations in the gene for neuronal apoptosis inhibitory protein (NIAP) underlie spinal muscular atrophy []. The inhibitors in family I32 all possess one or more 80-residue domains known as BIR (baculovirus inhibitor repeat) domains and have accordingly been termed 'BIR-containing' or 'BIRC' proteins as well as IAP proteins.  The mechanism of inhibition of caspases by the IAP proteins is complex, and reactive site residues cannot yet be identified with any confidence. Despite the conservation of the BIR or IAP (inhibitor of apoptosis) domains throughout the family it seems clear that other parts of the molecules also make essential contributions to inhibitory activity.  Homologs of most components in the mammalian apoptotic pathway have been identified in fruit flies. The Drosophila Apaf-1, known as Dapaf-1, HAC-1 or Dark, shares significant sequence similarity with its mammalian counterpart, and is critically important for the activation of the Drosophila initiator caspase Dronc. Dronc, in turn, cleaves and activates the effector caspase DrICE. The Drosophila IAP, DIAP1, binds to and in-activates both DrICE and Dronc through its BIR1 and BIR2 domains. During apoptosis, the anti-death function of DIAP1 is countered by at least four pro-apoptotic proteins, Reaper, Hid, Grim, and sickle, through direct physical interactions. These four proteins represent the functional homologs of the mammalian protein Smac, and they all share a conserved IAP-binding motif at their N termini. The three proteins Reaper, Hid, and Grim are collectively referred to as the RHG proteins [, ].  Both XIAP and DIAP1 contain a RING domain at their C termini, and can act as an E3 ubiquitin ligase. Indeed, both XIAP and DIAP1 have been shown to promote self-ubiquitination and degradation as well as to negatively regulate the target caspases. Nonetheless, important differences exist between XIAP and DIAP1. The primary function of XIAP is thought to inhibit the catalytic activities of caspases; to what extent the ubiquitinating activity of XIAP contributes to its function remains unclear. For DIAP1, however, the ubiquitinating activity appears to be essential for its function.  Recently a Drosophila p53 protein has been identified that mediates apoptosis via a novel pathway involving the activation of the Reaper gene and subsequent inhibition of the inhibitors of apoptosis (IAPs). CIAP1, a major mammalian homologue of Drosophila IAPs, is irreversibly inhibited (cleaved) during p53-dependent apoptosis and this cleavage is mediated by a serine protease. Serine protease inhibitors that block CIAP1 cleavage inhibit p53-dependent apoptosis. Furthermore, activation of the p53 protein increases the transcription of the HTRA2 gene, which encodes a serine protease that interacts with CIAP1 and potentiates apoptosis. Therefore mammalian p53 protein activates apoptosis through a novel pathway functionally similar to that in Drosophila, which involves HTRA2 and subsequent inhibition of CIAP1 by cleavage [].; GO: 0005622 intracellular; PDB: 3HL5_B 3UW5_A 3CM7_A 1G3F_A 1G73_C 3G76_G 3CM2_C 2VSL_A 2OPZ_B 3CLX_A ....
Probab=99.87  E-value=7.5e-23  Score=155.05  Aligned_cols=66  Identities=52%  Similarity=1.115  Sum_probs=58.3

Q ss_pred             HHhccc-cCCCCC---CCChHHHHHcCCcccCCCCceEEeeeCCcccCCCCCCChHHHHHhhcCCCchhh
Q psy3967         178 RLRSFD-SWPISL---RLKPVTLTEAGFFYTGKADQTLCFRCGGGLKHWEETDDPWTEHARWFSSCPYVK  243 (324)
Q Consensus       178 Rl~SF~-~Wp~~~---~~~~~~LA~AGFyytg~~D~v~Cf~Cg~~l~~W~~~DdP~~eH~~~~p~C~f~~  243 (324)
                      |++||. +||+..   .+.+++||+|||||+|.+|+|+|++|++.|.+|+++||||++|.+++|+|+|++
T Consensus         1 Rl~SF~~~wp~~~~~~~~~~~~LA~aGFyy~~~~d~v~C~~C~~~l~~w~~~Ddp~~~H~~~sp~C~f~k   70 (70)
T PF00653_consen    1 RLKSFRSNWPHSNDHDPVSPEKLARAGFYYTGTGDRVRCFYCGLELDNWEPNDDPWEEHKRHSPNCPFVK   70 (70)
T ss_dssp             HHHGGTTGSSTTTTTSSSHHHHHHHTTEEEESSTTEEEETTTTEEEES-STT--HHHHHHHHSTTBHHHH
T ss_pred             ChhHHCCcccCccccCCCCHHHHHHCCCEEcCCCCEEEEeccCCEEeCCCCCCCHHHHHHHHCcCCeecC
Confidence            899995 599753   467899999999999999999999999999999999999999999999999984


No 6  
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat. Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
Probab=99.86  E-value=1.9e-22  Score=152.76  Aligned_cols=69  Identities=55%  Similarity=1.172  Sum_probs=65.2

Q ss_pred             CHHHHHhccCCCCCC-CCcCHHHHHHcCceecCCCCCCCCCCeEeecccCceeccccCCCChhhhhcccCCCCcccc
Q psy3967          38 LECDRLDSFKNSWPL-TYLSAKQMAAAGFYFLGKKENGRFSDDVKCIFCGIELGKWVQGDDPLKDHEKWSPNCWFLR  113 (324)
Q Consensus        38 ~e~~RL~SF~~~Wp~-~~~~~~~LA~aGFyy~g~~~~~~~~D~V~C~~C~~~l~~w~~~Ddp~~eH~~~sP~C~f~~  113 (324)
                      ++++||+||.+ ||+ ....++.||++||||+|.      +|.|+|++|+++|.+|+++|+|+++|++++|.|+|++
T Consensus         1 ~~~~R~~sF~~-w~~~~~~~~~~LA~~Gfyy~~~------~d~v~C~~C~~~l~~w~~~d~p~~~H~~~~p~C~fv~   70 (71)
T smart00238        1 SEEARLKTFQN-WPYNSKLTPEQLAEAGFYYTGV------GDEVKCFFCGGELDNWEPGDDPWEEHKKWSPNCPFVR   70 (71)
T ss_pred             CHHHHHHHHHc-CCCCccCCHHHHHHcCCeECCC------CCEEEeCCCCCCcCCCCCCCCHHHHHhHhCcCCcCcc
Confidence            47899999998 996 567999999999999998      8999999999999999999999999999999999986


No 7  
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger.
Probab=99.86  E-value=3.8e-22  Score=150.32  Aligned_cols=67  Identities=51%  Similarity=1.220  Sum_probs=64.1

Q ss_pred             HHHHhccCCCCCCC-CcCHHHHHHcCceecCCCCCCCCCCeEeecccCceeccccCCCChhhhhcccCCCCcccc
Q psy3967          40 CDRLDSFKNSWPLT-YLSAKQMAAAGFYFLGKKENGRFSDDVKCIFCGIELGKWVQGDDPLKDHEKWSPNCWFLR  113 (324)
Q Consensus        40 ~~RL~SF~~~Wp~~-~~~~~~LA~aGFyy~g~~~~~~~~D~V~C~~C~~~l~~w~~~Ddp~~eH~~~sP~C~f~~  113 (324)
                      ++||+||.+ ||++ ...+++||++||||+|.      +|.|+|++|++++.+|+++|+|+++|++++|.|+|++
T Consensus         1 ~~R~~TF~~-w~~~~~~~~~~La~~Gfyy~~~------~d~v~C~~C~~~~~~w~~~d~p~~~H~~~~p~C~fv~   68 (69)
T cd00022           1 EARLKTFKN-WPISLKVTPEKLAEAGFYYTGR------GDEVKCFFCGLELKNWEPGDDPWEEHKRWSPNCPFVL   68 (69)
T ss_pred             ChHHHHHHc-CCCCccCCHHHHHHcCCeEcCC------CCEEEeCCCCCCccCCCCCCCHHHHHhHhCcCCcCcc
Confidence            479999998 9998 68999999999999999      8999999999999999999999999999999999985


No 8  
>PF00653 BIR:  Inhibitor of Apoptosis domain;  InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.   The baculovirus inhibitor of apoptosis protein repeat (BIR) is a domain of tandem repeats separated by a variable length linker that seems to confer cell death-preventing activity [, ]. The BIR domains characterise the Inhibitor of Apoptosis (IAP) family of proteins (MEROPS proteinase inhibitor family I32, clan IV) that suppress apoptosis by interacting with and inhibiting the enzymatic activity of both initiator and effector caspases (MEROPS peptidase family C14, IPR002398 from INTERPRO). Several distinct mammalian IAPs including XIAP, c-IAP1, c-IAP2, and ML-IAP, have been identified, and they all exhibit antiapoptotic activity in cell culture. The functional unit in each IAP protein is the baculoviral IAP repeat (BIR), which contains approximately 80 amino acids folded around a zinc atom. Most mammalian IAPs have more than one BIR domain, with the different BIR domains performing distinct functions. For example, in XIAP, the third BIR domain (BIR3) potently inhibits the catalytic activity of caspase-9, whereas the linker sequences immediately preceding the second BIR domain (BIR2) selectively targets caspase-3 or -7.  The first-recognised members of family MEROPS inhibitor family I32 were viral proteins that inhibited the apoptosis of infected cells: Cp-IAP from Cydia pomonella granulosis virus (CpGV) [] and Op-IAP from Orgyia pseudotsugata multicapsid polyhedrosis virus(OpMNPV) []. The discovery of homologous proteins in mammals followed soon after with the recognition that mutations in the gene for neuronal apoptosis inhibitory protein (NIAP) underlie spinal muscular atrophy []. The inhibitors in family I32 all possess one or more 80-residue domains known as BIR (baculovirus inhibitor repeat) domains and have accordingly been termed 'BIR-containing' or 'BIRC' proteins as well as IAP proteins.  The mechanism of inhibition of caspases by the IAP proteins is complex, and reactive site residues cannot yet be identified with any confidence. Despite the conservation of the BIR or IAP (inhibitor of apoptosis) domains throughout the family it seems clear that other parts of the molecules also make essential contributions to inhibitory activity.  Homologs of most components in the mammalian apoptotic pathway have been identified in fruit flies. The Drosophila Apaf-1, known as Dapaf-1, HAC-1 or Dark, shares significant sequence similarity with its mammalian counterpart, and is critically important for the activation of the Drosophila initiator caspase Dronc. Dronc, in turn, cleaves and activates the effector caspase DrICE. The Drosophila IAP, DIAP1, binds to and in-activates both DrICE and Dronc through its BIR1 and BIR2 domains. During apoptosis, the anti-death function of DIAP1 is countered by at least four pro-apoptotic proteins, Reaper, Hid, Grim, and sickle, through direct physical interactions. These four proteins represent the functional homologs of the mammalian protein Smac, and they all share a conserved IAP-binding motif at their N termini. The three proteins Reaper, Hid, and Grim are collectively referred to as the RHG proteins [, ].  Both XIAP and DIAP1 contain a RING domain at their C termini, and can act as an E3 ubiquitin ligase. Indeed, both XIAP and DIAP1 have been shown to promote self-ubiquitination and degradation as well as to negatively regulate the target caspases. Nonetheless, important differences exist between XIAP and DIAP1. The primary function of XIAP is thought to inhibit the catalytic activities of caspases; to what extent the ubiquitinating activity of XIAP contributes to its function remains unclear. For DIAP1, however, the ubiquitinating activity appears to be essential for its function.  Recently a Drosophila p53 protein has been identified that mediates apoptosis via a novel pathway involving the activation of the Reaper gene and subsequent inhibition of the inhibitors of apoptosis (IAPs). CIAP1, a major mammalian homologue of Drosophila IAPs, is irreversibly inhibited (cleaved) during p53-dependent apoptosis and this cleavage is mediated by a serine protease. Serine protease inhibitors that block CIAP1 cleavage inhibit p53-dependent apoptosis. Furthermore, activation of the p53 protein increases the transcription of the HTRA2 gene, which encodes a serine protease that interacts with CIAP1 and potentiates apoptosis. Therefore mammalian p53 protein activates apoptosis through a novel pathway functionally similar to that in Drosophila, which involves HTRA2 and subsequent inhibition of CIAP1 by cleavage [].; GO: 0005622 intracellular; PDB: 3HL5_B 3UW5_A 3CM7_A 1G3F_A 1G73_C 3G76_G 3CM2_C 2VSL_A 2OPZ_B 3CLX_A ....
Probab=99.84  E-value=8.1e-22  Score=149.40  Aligned_cols=66  Identities=45%  Similarity=1.102  Sum_probs=57.5

Q ss_pred             HHhccCCCCCCC----CcCHHHHHHcCceecCCCCCCCCCCeEeecccCceeccccCCCChhhhhcccCCCCcccc
Q psy3967          42 RLDSFKNSWPLT----YLSAKQMAAAGFYFLGKKENGRFSDDVKCIFCGIELGKWVQGDDPLKDHEKWSPNCWFLR  113 (324)
Q Consensus        42 RL~SF~~~Wp~~----~~~~~~LA~aGFyy~g~~~~~~~~D~V~C~~C~~~l~~w~~~Ddp~~eH~~~sP~C~f~~  113 (324)
                      ||+||...||+.    .+++++||+|||||+|.      +|+|+|++|+++|.+|+++|||+++|++++|+|+|++
T Consensus         1 Rl~SF~~~wp~~~~~~~~~~~~LA~aGFyy~~~------~d~v~C~~C~~~l~~w~~~Ddp~~~H~~~sp~C~f~k   70 (70)
T PF00653_consen    1 RLKSFRSNWPHSNDHDPVSPEKLARAGFYYTGT------GDRVRCFYCGLELDNWEPNDDPWEEHKRHSPNCPFVK   70 (70)
T ss_dssp             HHHGGTTGSSTTTTTSSSHHHHHHHTTEEEESS------TTEEEETTTTEEEES-STT--HHHHHHHHSTTBHHHH
T ss_pred             ChhHHCCcccCccccCCCCHHHHHHCCCEEcCC------CCEEEEeccCCEEeCCCCCCCHHHHHHHHCcCCeecC
Confidence            999995339964    36899999999999999      9999999999999999999999999999999999973


No 9  
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=97.83  E-value=1e-05  Score=57.01  Aligned_cols=26  Identities=42%  Similarity=1.072  Sum_probs=22.6

Q ss_pred             cccccccccccccEEEecCCceeecc
Q psy3967         298 GRLCKICYQREMGVVFLPCGHIVACV  323 (324)
Q Consensus       298 ~~~C~iC~~~~~~~~~~PCgH~~~C~  323 (324)
                      +.+|.||+++.++++|+||||++.|.
T Consensus         2 ~~~C~iC~~~~~~~~~~pCgH~~~C~   27 (50)
T PF13920_consen    2 DEECPICFENPRDVVLLPCGHLCFCE   27 (50)
T ss_dssp             HSB-TTTSSSBSSEEEETTCEEEEEH
T ss_pred             cCCCccCCccCCceEEeCCCChHHHH
Confidence            46899999999999999999998774


No 10 
>KOG4275|consensus
Probab=97.67  E-value=1.3e-05  Score=75.41  Aligned_cols=26  Identities=50%  Similarity=1.131  Sum_probs=24.9

Q ss_pred             cccccccccccccEEEecCCceeecc
Q psy3967         298 GRLCKICYQREMGVVFLPCGHIVACV  323 (324)
Q Consensus       298 ~~~C~iC~~~~~~~~~~PCgH~~~C~  323 (324)
                      ..+|+|||+.++|.|||+|||.|+|.
T Consensus       300 ~~LC~ICmDaP~DCvfLeCGHmVtCt  325 (350)
T KOG4275|consen  300 RRLCAICMDAPRDCVFLECGHMVTCT  325 (350)
T ss_pred             HHHHHHHhcCCcceEEeecCcEEeeh
Confidence            68999999999999999999999996


No 11 
>KOG4265|consensus
Probab=97.61  E-value=2e-05  Score=76.20  Aligned_cols=28  Identities=36%  Similarity=0.841  Sum_probs=25.7

Q ss_pred             ccccccccccccccEEEecCCceeeccC
Q psy3967         297 DGRLCKICYQREMGVVFLPCGHIVACVI  324 (324)
Q Consensus       297 ~~~~C~iC~~~~~~~~~~PCgH~~~C~~  324 (324)
                      ..++|+||+...||+++|||+|+|.|.+
T Consensus       289 ~gkeCVIClse~rdt~vLPCRHLCLCs~  316 (349)
T KOG4265|consen  289 SGKECVICLSESRDTVVLPCRHLCLCSG  316 (349)
T ss_pred             CCCeeEEEecCCcceEEecchhhehhHh
Confidence            4688999999999999999999999963


No 12 
>KOG1571|consensus
Probab=97.25  E-value=0.00018  Score=69.83  Aligned_cols=29  Identities=34%  Similarity=0.961  Sum_probs=25.8

Q ss_pred             CCccccccccccccccEEEecCCceeecc
Q psy3967         295 NSDGRLCKICYQREMGVVFLPCGHIVACV  323 (324)
Q Consensus       295 ~~~~~~C~iC~~~~~~~~~~PCgH~~~C~  323 (324)
                      ......|+||.+++.+++|+||||+|||.
T Consensus       302 ~~~p~lcVVcl~e~~~~~fvpcGh~ccct  330 (355)
T KOG1571|consen  302 LPQPDLCVVCLDEPKSAVFVPCGHVCCCT  330 (355)
T ss_pred             cCCCCceEEecCCccceeeecCCcEEEch
Confidence            34467899999999999999999999985


No 13 
>KOG1100|consensus
Probab=96.38  E-value=0.0018  Score=59.17  Aligned_cols=26  Identities=46%  Similarity=1.018  Sum_probs=23.8

Q ss_pred             ccccccccccccEEEecCCceeeccC
Q psy3967         299 RLCKICYQREMGVVFLPCGHIVACVI  324 (324)
Q Consensus       299 ~~C~iC~~~~~~~~~~PCgH~~~C~~  324 (324)
                      ..|+.|.++++.|+++||.|+|.|.+
T Consensus       159 ~~Cr~C~~~~~~VlllPCrHl~lC~~  184 (207)
T KOG1100|consen  159 RSCRKCGEREATVLLLPCRHLCLCGI  184 (207)
T ss_pred             ccceecCcCCceEEeecccceEeccc
Confidence            33999999999999999999999974


No 14 
>KOG4172|consensus
Probab=96.12  E-value=0.00047  Score=49.56  Aligned_cols=25  Identities=36%  Similarity=1.014  Sum_probs=23.3

Q ss_pred             ccccccccccccEEEecCCceeecc
Q psy3967         299 RLCKICYQREMGVVFLPCGHIVACV  323 (324)
Q Consensus       299 ~~C~iC~~~~~~~~~~PCgH~~~C~  323 (324)
                      .+|.||+++.+|.|+.-|||+|.|.
T Consensus         8 dECTICye~pvdsVlYtCGHMCmCy   32 (62)
T KOG4172|consen    8 DECTICYEHPVDSVLYTCGHMCMCY   32 (62)
T ss_pred             cceeeeccCcchHHHHHcchHHhHH
Confidence            5699999999999999999999884


No 15 
>PF07967 zf-C3HC:  C3HC zinc finger-like ;  InterPro: IPR012935 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc-finger like domain is distributed throughout the eukaryotic kingdom in NIPA (Nuclear interacting partner of ALK) and other proteins. NIPA is thought to perform an antiapoptotic role in nucleophosmin-anaplastic lymphoma kinase (ALK) mediated signalling events []. The domain is often repeated, with the second domain usually containing a large insert (approximately 90 residues) after the first three cysteine residues. The Schizosaccharomyces pombe protein containing this domain (O94506 from SWISSPROT) is involved in mRNA export from the nucleus [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=96.06  E-value=0.0077  Score=50.98  Aligned_cols=48  Identities=31%  Similarity=0.529  Sum_probs=39.0

Q ss_pred             CcCHHHHHhccCC-CCCCC--CcCHHHHHHcCceecCCCCCCCCCCeEeecccCceec
Q psy3967          36 MTLECDRLDSFKN-SWPLT--YLSAKQMAAAGFYFLGKKENGRFSDDVKCIFCGIELG   90 (324)
Q Consensus        36 ~~~e~~RL~SF~~-~Wp~~--~~~~~~LA~aGFyy~g~~~~~~~~D~V~C~~C~~~l~   90 (324)
                      ...+-.||+||.. +|...  .+++-.+|+.|+...+       .|.++|..|+..+.
T Consensus         4 r~~~l~RL~Tf~~~~W~~kp~~lspl~cA~~GW~~~~-------~d~l~C~~C~~~l~   54 (133)
T PF07967_consen    4 REDFLRRLETFKSLTWFPKPPWLSPLECARRGWICVS-------KDMLKCESCGARLC   54 (133)
T ss_pred             HHHHHHHHHHcccccccCCCcccCHHHHHHcCCCcCC-------CCEEEeCCCCCEEE
Confidence            3456799999986 58432  3899999999998866       58999999999875


No 16 
>PF07967 zf-C3HC:  C3HC zinc finger-like ;  InterPro: IPR012935 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc-finger like domain is distributed throughout the eukaryotic kingdom in NIPA (Nuclear interacting partner of ALK) and other proteins. NIPA is thought to perform an antiapoptotic role in nucleophosmin-anaplastic lymphoma kinase (ALK) mediated signalling events []. The domain is often repeated, with the second domain usually containing a large insert (approximately 90 residues) after the first three cysteine residues. The Schizosaccharomyces pombe protein containing this domain (O94506 from SWISSPROT) is involved in mRNA export from the nucleus [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=95.78  E-value=0.0088  Score=50.64  Aligned_cols=47  Identities=30%  Similarity=0.625  Sum_probs=38.6

Q ss_pred             CCHHHHHhcccc--C-CCCCCCChHHHHHcCCcccCCCCceEEeeeCCccc
Q psy3967         173 ATYESRLRSFDS--W-PISLRLKPVTLTEAGFFYTGKADQTLCFRCGGGLK  220 (324)
Q Consensus       173 ~~~~~Rl~SF~~--W-p~~~~~~~~~LA~AGFyytg~~D~v~Cf~Cg~~l~  220 (324)
                      ..+-.||+||..  | +.+..+++-.+|+.||...+ .|+++|-.|+..+.
T Consensus         5 ~~~l~RL~Tf~~~~W~~kp~~lspl~cA~~GW~~~~-~d~l~C~~C~~~l~   54 (133)
T PF07967_consen    5 EDFLRRLETFKSLTWFPKPPWLSPLECARRGWICVS-KDMLKCESCGARLC   54 (133)
T ss_pred             HHHHHHHHHcccccccCCCcccCHHHHHHcCCCcCC-CCEEEeCCCCCEEE
Confidence            456889999985  8 33445789999999999987 68999999998664


No 17 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=94.76  E-value=0.02  Score=38.00  Aligned_cols=21  Identities=38%  Similarity=0.860  Sum_probs=17.9

Q ss_pred             ccccccccccE-EEecCCceee
Q psy3967         301 CKICYQREMGV-VFLPCGHIVA  321 (324)
Q Consensus       301 C~iC~~~~~~~-~~~PCgH~~~  321 (324)
                      |.||++..++. ++++|||+.+
T Consensus         1 C~iC~~~~~~~~~~~~CGH~fC   22 (39)
T PF13923_consen    1 CPICLDELRDPVVVTPCGHSFC   22 (39)
T ss_dssp             ETTTTSB-SSEEEECTTSEEEE
T ss_pred             CCCCCCcccCcCEECCCCCchh
Confidence            78999999999 7999999964


No 18 
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=93.78  E-value=0.031  Score=35.34  Aligned_cols=20  Identities=45%  Similarity=1.021  Sum_probs=18.5

Q ss_pred             ccccccccccEEEecCCcee
Q psy3967         301 CKICYQREMGVVFLPCGHIV  320 (324)
Q Consensus       301 C~iC~~~~~~~~~~PCgH~~  320 (324)
                      |.||++...+++++||||..
T Consensus         1 C~iC~~~~~~~~~~~C~H~~   20 (39)
T smart00184        1 CPICLEELKDPVVLPCGHTF   20 (39)
T ss_pred             CCcCccCCCCcEEecCCChH
Confidence            78999999999999999984


No 19 
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=92.79  E-value=0.072  Score=36.56  Aligned_cols=20  Identities=40%  Similarity=0.981  Sum_probs=10.5

Q ss_pred             cccccccccc----EEEecCCceee
Q psy3967         301 CKICYQREMG----VVFLPCGHIVA  321 (324)
Q Consensus       301 C~iC~~~~~~----~~~~PCgH~~~  321 (324)
                      |-||++ -.+    -+.|||||+.+
T Consensus         1 CpIc~e-~~~~~n~P~~L~CGH~~c   24 (43)
T PF13445_consen    1 CPICKE-FSTEENPPMVLPCGHVFC   24 (43)
T ss_dssp             -TTT-----TTSS-EEE-SSS-EEE
T ss_pred             CCcccc-ccCCCCCCEEEeCccHHH
Confidence            678887 455    58899999986


No 20 
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=90.79  E-value=0.16  Score=33.62  Aligned_cols=21  Identities=43%  Similarity=0.944  Sum_probs=18.8

Q ss_pred             ccccccccccEE-EecCCceee
Q psy3967         301 CKICYQREMGVV-FLPCGHIVA  321 (324)
Q Consensus       301 C~iC~~~~~~~~-~~PCgH~~~  321 (324)
                      |.||++.-.+.+ ++||||..+
T Consensus         1 C~iC~~~~~~~~~~~~C~H~fC   22 (41)
T PF00097_consen    1 CPICLEPFEDPVILLPCGHSFC   22 (41)
T ss_dssp             ETTTSSBCSSEEEETTTSEEEE
T ss_pred             CCcCCccccCCCEEecCCCcch
Confidence            789999999888 999999865


No 21 
>KOG4692|consensus
Probab=88.77  E-value=0.14  Score=50.01  Aligned_cols=26  Identities=42%  Similarity=0.981  Sum_probs=23.5

Q ss_pred             CccccccccccccccEEEecCCceee
Q psy3967         296 SDGRLCKICYQREMGVVFLPCGHIVA  321 (324)
Q Consensus       296 ~~~~~C~iC~~~~~~~~~~PCgH~~~  321 (324)
                      .++.+|-||+..+++.||-||||-.|
T Consensus       420 sEd~lCpICyA~pi~Avf~PC~H~SC  445 (489)
T KOG4692|consen  420 SEDNLCPICYAGPINAVFAPCSHRSC  445 (489)
T ss_pred             cccccCcceecccchhhccCCCCchH
Confidence            35789999999999999999999876


No 22 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=88.40  E-value=0.37  Score=32.68  Aligned_cols=21  Identities=43%  Similarity=0.844  Sum_probs=17.6

Q ss_pred             ccccccccccEEEecCCceee
Q psy3967         301 CKICYQREMGVVFLPCGHIVA  321 (324)
Q Consensus       301 C~iC~~~~~~~~~~PCgH~~~  321 (324)
                      |-||++--.+=|.|+|||..+
T Consensus         1 CpiC~~~~~~Pv~l~CGH~FC   21 (42)
T PF15227_consen    1 CPICLDLFKDPVSLPCGHSFC   21 (42)
T ss_dssp             ETTTTSB-SSEEE-SSSSEEE
T ss_pred             CCccchhhCCccccCCcCHHH
Confidence            789999999999999999876


No 23 
>KOG1785|consensus
Probab=86.09  E-value=0.18  Score=50.03  Aligned_cols=24  Identities=42%  Similarity=0.934  Sum_probs=21.9

Q ss_pred             cccccccccccccEEEecCCceee
Q psy3967         298 GRLCKICYQREMGVVFLPCGHIVA  321 (324)
Q Consensus       298 ~~~C~iC~~~~~~~~~~PCgH~~~  321 (324)
                      -.+||||-+++.||-+-||||+.|
T Consensus       369 FeLCKICaendKdvkIEPCGHLlC  392 (563)
T KOG1785|consen  369 FELCKICAENDKDVKIEPCGHLLC  392 (563)
T ss_pred             HHHHHHhhccCCCcccccccchHH
Confidence            357999999999999999999876


No 24 
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=84.66  E-value=0.61  Score=31.43  Aligned_cols=22  Identities=45%  Similarity=0.913  Sum_probs=18.0

Q ss_pred             ccccccccc---ccEEEecCCceee
Q psy3967         300 LCKICYQRE---MGVVFLPCGHIVA  321 (324)
Q Consensus       300 ~C~iC~~~~---~~~~~~PCgH~~~  321 (324)
                      .|.||++.-   ..++.+||||+..
T Consensus         2 ~C~IC~~~~~~~~~~~~l~C~H~fh   26 (44)
T PF13639_consen    2 ECPICLEEFEDGEKVVKLPCGHVFH   26 (44)
T ss_dssp             CETTTTCBHHTTSCEEEETTSEEEE
T ss_pred             CCcCCChhhcCCCeEEEccCCCeeC
Confidence            599999754   6899999999753


No 25 
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=84.15  E-value=0.53  Score=34.03  Aligned_cols=25  Identities=28%  Similarity=0.638  Sum_probs=21.8

Q ss_pred             ccccccccccccccEEEecCCceee
Q psy3967         297 DGRLCKICYQREMGVVFLPCGHIVA  321 (324)
Q Consensus       297 ~~~~C~iC~~~~~~~~~~PCgH~~~  321 (324)
                      ....|..|......=+++||||+++
T Consensus         6 ~~~~~~~~~~~~~~~~~~pCgH~I~   30 (55)
T PF14447_consen    6 PEQPCVFCGFVGTKGTVLPCGHLIC   30 (55)
T ss_pred             cceeEEEccccccccccccccceee
Confidence            3567999999988899999999986


No 26 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=81.93  E-value=0.59  Score=31.73  Aligned_cols=22  Identities=32%  Similarity=0.848  Sum_probs=17.3

Q ss_pred             ccccccccc---ccEEEecCCceee
Q psy3967         300 LCKICYQRE---MGVVFLPCGHIVA  321 (324)
Q Consensus       300 ~C~iC~~~~---~~~~~~PCgH~~~  321 (324)
                      .|.||++.-   +..++++|||+.+
T Consensus         1 ~C~~C~~~~~~~~~~~l~~CgH~~C   25 (44)
T PF14634_consen    1 HCNICFEKYSEERRPRLTSCGHIFC   25 (44)
T ss_pred             CCcCcCccccCCCCeEEcccCCHHH
Confidence            377888655   6799999999864


No 27 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=81.18  E-value=0.76  Score=29.79  Aligned_cols=21  Identities=43%  Similarity=0.980  Sum_probs=15.4

Q ss_pred             cccccccccccEE-EecCCcee
Q psy3967         300 LCKICYQREMGVV-FLPCGHIV  320 (324)
Q Consensus       300 ~C~iC~~~~~~~~-~~PCgH~~  320 (324)
                      .|.||++.-.+.+ +.||||..
T Consensus         1 ~C~iC~~~~~~~~~~~~C~H~~   22 (45)
T cd00162           1 ECPICLEEFREPVVLLPCGHVF   22 (45)
T ss_pred             CCCcCchhhhCceEecCCCChh
Confidence            4899998874444 44599975


No 28 
>KOG0823|consensus
Probab=80.17  E-value=0.82  Score=42.31  Aligned_cols=24  Identities=29%  Similarity=0.534  Sum_probs=22.0

Q ss_pred             cccccccccccccEEEecCCceee
Q psy3967         298 GRLCKICYQREMGVVFLPCGHIVA  321 (324)
Q Consensus       298 ~~~C~iC~~~~~~~~~~PCgH~~~  321 (324)
                      .-.|-||+|...|-|+-+|||+-|
T Consensus        47 ~FdCNICLd~akdPVvTlCGHLFC   70 (230)
T KOG0823|consen   47 FFDCNICLDLAKDPVVTLCGHLFC   70 (230)
T ss_pred             ceeeeeeccccCCCEEeeccccee
Confidence            456999999999999999999977


No 29 
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=77.40  E-value=0.79  Score=43.24  Aligned_cols=25  Identities=24%  Similarity=0.583  Sum_probs=23.1

Q ss_pred             cccccccccccccEEEecCCceeec
Q psy3967         298 GRLCKICYQREMGVVFLPCGHIVAC  322 (324)
Q Consensus       298 ~~~C~iC~~~~~~~~~~PCgH~~~C  322 (324)
                      ...|.||++..-+-+..||||+-||
T Consensus       215 d~kC~lC~e~~~~ps~t~CgHlFC~  239 (271)
T COG5574         215 DYKCFLCLEEPEVPSCTPCGHLFCL  239 (271)
T ss_pred             ccceeeeecccCCcccccccchhhH
Confidence            5689999999999999999999875


No 30 
>KOG0317|consensus
Probab=74.94  E-value=0.84  Score=43.54  Aligned_cols=24  Identities=33%  Similarity=0.815  Sum_probs=22.2

Q ss_pred             cccccccccccccEEEecCCceee
Q psy3967         298 GRLCKICYQREMGVVFLPCGHIVA  321 (324)
Q Consensus       298 ~~~C~iC~~~~~~~~~~PCgH~~~  321 (324)
                      ...|.+|++...+--..||||+-|
T Consensus       239 ~~kC~LCLe~~~~pSaTpCGHiFC  262 (293)
T KOG0317|consen  239 TRKCSLCLENRSNPSATPCGHIFC  262 (293)
T ss_pred             CCceEEEecCCCCCCcCcCcchHH
Confidence            578999999999999999999876


No 31 
>KOG4765|consensus
Probab=74.65  E-value=1.7  Score=42.93  Aligned_cols=53  Identities=26%  Similarity=0.370  Sum_probs=40.5

Q ss_pred             cccCCcCHHHHHhccCC-CCCCC--CcCHHHHHHcCceecCCCCCCCCCCeEeecccCceecc
Q psy3967          32 RKQNMTLECDRLDSFKN-SWPLT--YLSAKQMAAAGFYFLGKKENGRFSDDVKCIFCGIELGK   91 (324)
Q Consensus        32 ~~~~~~~e~~RL~SF~~-~Wp~~--~~~~~~LA~aGFyy~g~~~~~~~~D~V~C~~C~~~l~~   91 (324)
                      +.-++-.+-.||+||.. +|-..  .+++..+|+.|+-...       .|.++|-+|+..|.-
T Consensus        47 k~wdred~lrRl~Tfks~tWygkp~~iS~lnCA~~GWv~vd-------~D~lkCe~C~a~L~~  102 (419)
T KOG4765|consen   47 KPWDREDLLRRLATFKSRTWYGKPFEISPLNCAKYGWVCVD-------CDMLKCESCGAFLCA  102 (419)
T ss_pred             CcccHHHHHHHHHhccCchhccCCcccchHHHhhcCeeecc-------CCeeehhhhhhHHhc
Confidence            44446667799999986 35332  3899999999997554       699999999998853


No 32 
>PF11682 DUF3279:  Protein of unknown function (DUF3279);  InterPro: IPR021696  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=71.04  E-value=3.5  Score=34.99  Aligned_cols=60  Identities=27%  Similarity=0.478  Sum_probs=42.8

Q ss_pred             CCChHHHHHcCCcccCCCCceEEeeeCCcccCC--CCCCChHHHHHhhc------CCCchhhhccch-hHHHhhh
Q psy3967         190 RLKPVTLTEAGFFYTGKADQTLCFRCGGGLKHW--EETDDPWTEHARWF------SSCPYVKLVKGQ-EFINQVI  255 (324)
Q Consensus       190 ~~~~~~LA~AGFyytg~~D~v~Cf~Cg~~l~~W--~~~DdP~~eH~~~~------p~C~f~~~~kg~-~~i~~v~  255 (324)
                      .+++...+.+      ..|...|.+||..|.==  ..+..||-||....      -.|.|+.-.++. ..|..+.
T Consensus        15 ~v~A~~a~~~------~~~~~tC~~Cg~~L~lh~~~~~~~pWFEH~~~~~~~~~l~~C~yl~pe~k~~~ri~~L~   83 (128)
T PF11682_consen   15 FVGARTAASA------PYDHWTCHSCGCPLILHPGTDTEPPWFEHDQHSLAENGLMQCPYLDPEEKERRRIKRLR   83 (128)
T ss_pred             EEehhhhhhC------CCCeEEEecCCceEEEecCCcCCCCccccCccccChhhcccCceECcccchHHHHHHHH
Confidence            3566777766      56899999999877533  45678999998875      359999866554 4554444


No 33 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=70.56  E-value=2.8  Score=29.93  Aligned_cols=23  Identities=30%  Similarity=0.473  Sum_probs=20.1

Q ss_pred             ccccccccccccEEEecCCceee
Q psy3967         299 RLCKICYQREMGVVFLPCGHIVA  321 (324)
Q Consensus       299 ~~C~iC~~~~~~~~~~PCgH~~~  321 (324)
                      ..|.||++--.+-|.+||||+..
T Consensus         2 ~~Cpi~~~~~~~Pv~~~~G~v~~   24 (63)
T smart00504        2 FLCPISLEVMKDPVILPSGQTYE   24 (63)
T ss_pred             cCCcCCCCcCCCCEECCCCCEEe
Confidence            46999999989999999999865


No 34 
>KOG4765|consensus
Probab=67.34  E-value=3.7  Score=40.67  Aligned_cols=52  Identities=21%  Similarity=0.400  Sum_probs=39.6

Q ss_pred             CCCCCCCHHHHHhccc--cCC-CCCCCChHHHHHcCCcccCCCCceEEeeeCCccc
Q psy3967         168 AFPNYATYESRLRSFD--SWP-ISLRLKPVTLTEAGFFYTGKADQTLCFRCGGGLK  220 (324)
Q Consensus       168 ~~~~y~~~~~Rl~SF~--~Wp-~~~~~~~~~LA~AGFyytg~~D~v~Cf~Cg~~l~  220 (324)
                      ..-+...+-.|++||+  +|- .+..+++...|+.|+-.-. .|.++|-+||..|.
T Consensus        47 k~wdred~lrRl~Tfks~tWygkp~~iS~lnCA~~GWv~vd-~D~lkCe~C~a~L~  101 (419)
T KOG4765|consen   47 KPWDREDLLRRLATFKSRTWYGKPFEISPLNCAKYGWVCVD-CDMLKCESCGAFLC  101 (419)
T ss_pred             CcccHHHHHHHHHhccCchhccCCcccchHHHhhcCeeecc-CCeeehhhhhhHHh
Confidence            3445677899999998  462 2234689999999997664 58999999997663


No 35 
>KOG1814|consensus
Probab=66.87  E-value=1.8  Score=43.28  Aligned_cols=24  Identities=38%  Similarity=0.866  Sum_probs=19.9

Q ss_pred             cccccccccccc---cEEEecCCceee
Q psy3967         298 GRLCKICYQREM---GVVFLPCGHIVA  321 (324)
Q Consensus       298 ~~~C~iC~~~~~---~~~~~PCgH~~~  321 (324)
                      .-.|-|||+...   .++|+||+|+-|
T Consensus       184 lf~C~ICf~e~~G~~c~~~lpC~Hv~C  210 (445)
T KOG1814|consen  184 LFDCCICFEEQMGQHCFKFLPCSHVFC  210 (445)
T ss_pred             cccceeeehhhcCcceeeecccchHHH
Confidence            346999998875   599999999865


No 36 
>PHA02929 N1R/p28-like protein; Provisional
Probab=65.72  E-value=3.2  Score=38.78  Aligned_cols=25  Identities=20%  Similarity=0.663  Sum_probs=18.2

Q ss_pred             cccccccccccccc--------EEEecCCceee
Q psy3967         297 DGRLCKICYQREMG--------VVFLPCGHIVA  321 (324)
Q Consensus       297 ~~~~C~iC~~~~~~--------~~~~PCgH~~~  321 (324)
                      +...|.||++.-.+        .++.+|||.-+
T Consensus       173 ~~~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC  205 (238)
T PHA02929        173 KDKECAICMEKVYDKEIKNMYFGILSNCNHVFC  205 (238)
T ss_pred             CCCCCccCCcccccCccccccceecCCCCCccc
Confidence            35689999996332        46778999755


No 37 
>PF08600 Rsm1:  Rsm1-like;  InterPro: IPR013909 This entry contains Nuclear-interacting partner of ALK (NIPA) and NIPA like proteins, as well as mRNA export factor Rsm1, all of which contain a C3HC-type zinc finger. The domain represented in this entry is found C-terminal to the zinc-finger like domain IPR012935 from INTERPRO. Rsm1 is involved in mRNA export from the nucleus []. NIPA is an essential component of an SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry [].
Probab=64.26  E-value=3.7  Score=32.57  Aligned_cols=34  Identities=29%  Similarity=0.749  Sum_probs=27.4

Q ss_pred             CeEeecccCceeccccCC------------CChhhhhcccCCCCccccc
Q psy3967          78 DDVKCIFCGIELGKWVQG------------DDPLKDHEKWSPNCWFLRR  114 (324)
Q Consensus        78 D~V~C~~C~~~l~~w~~~------------Ddp~~eH~~~sP~C~f~~~  114 (324)
                      ..+.|-+|..++.-|.-.            =||+.+|+.+   ||++..
T Consensus        18 ~~~~C~~C~Rr~GLW~f~~~~ss~~~~~~~~d~~~eHr~~---CPwv~~   63 (91)
T PF08600_consen   18 GLLSCSYCFRRLGLWMFKSKESSDSDPMSPFDPLEEHREY---CPWVNP   63 (91)
T ss_pred             CeEEccccCcEeeeeecccCccCCCCcCCCCCCccccccc---CCccCC
Confidence            489999999999888642            3788899875   999875


No 38 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=59.55  E-value=4.5  Score=30.80  Aligned_cols=11  Identities=36%  Similarity=0.954  Sum_probs=10.3

Q ss_pred             eEEeeeCCccc
Q psy3967         210 TLCFRCGGGLK  220 (324)
Q Consensus       210 v~Cf~Cg~~l~  220 (324)
                      |+||.||..+.
T Consensus         5 VRCFTCGkvig   15 (71)
T PLN00032          5 VRCFTCGKVIG   15 (71)
T ss_pred             eeecCCCCCcH
Confidence            79999999997


No 39 
>KOG3497|consensus
Probab=58.59  E-value=4  Score=30.17  Aligned_cols=15  Identities=40%  Similarity=1.086  Sum_probs=11.8

Q ss_pred             ceEEeeeCCcccC-CC
Q psy3967         209 QTLCFRCGGGLKH-WE  223 (324)
Q Consensus       209 ~v~Cf~Cg~~l~~-W~  223 (324)
                      -++||.||.++.+ |+
T Consensus         4 PiRCFtCGKvig~KWe   19 (69)
T KOG3497|consen    4 PIRCFTCGKVIGDKWE   19 (69)
T ss_pred             eeEeeeccccccccHH
Confidence            3799999999863 54


No 40 
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]
Probab=57.56  E-value=4.7  Score=40.00  Aligned_cols=25  Identities=40%  Similarity=0.881  Sum_probs=17.4

Q ss_pred             CccccccccccccccE-------------EEecCCcee
Q psy3967         296 SDGRLCKICYQREMGV-------------VFLPCGHIV  320 (324)
Q Consensus       296 ~~~~~C~iC~~~~~~~-------------~~~PCgH~~  320 (324)
                      .+++.|.||||+-...             ==|||||..
T Consensus       285 n~D~~C~ICmde~~h~~~~~~~~~~~~~pKrLpCGHil  322 (491)
T COG5243         285 NSDRTCTICMDEMFHPDHEPLPRGLDMTPKRLPCGHIL  322 (491)
T ss_pred             CCCCeEEEecccccCCCCccCcccccCCccccccccee
Confidence            4578999999982111             248999974


No 41 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=55.49  E-value=6  Score=29.35  Aligned_cols=12  Identities=33%  Similarity=0.888  Sum_probs=10.8

Q ss_pred             ceEEeeeCCccc
Q psy3967         209 QTLCFRCGGGLK  220 (324)
Q Consensus       209 ~v~Cf~Cg~~l~  220 (324)
                      -|+||.||..+.
T Consensus         4 PvRCFTCGkvi~   15 (62)
T PRK04016          4 PVRCFTCGKVIA   15 (62)
T ss_pred             CeEecCCCCChH
Confidence            489999999998


No 42 
>KOG2164|consensus
Probab=54.46  E-value=5.6  Score=40.85  Aligned_cols=26  Identities=31%  Similarity=0.512  Sum_probs=23.4

Q ss_pred             cccccccccccccEEEecCCceeecc
Q psy3967         298 GRLCKICYQREMGVVFLPCGHIVACV  323 (324)
Q Consensus       298 ~~~C~iC~~~~~~~~~~PCgH~~~C~  323 (324)
                      ...|-||++.+.-.+..-|||+-||.
T Consensus       186 ~~~CPICL~~~~~p~~t~CGHiFC~~  211 (513)
T KOG2164|consen  186 DMQCPICLEPPSVPVRTNCGHIFCGP  211 (513)
T ss_pred             CCcCCcccCCCCcccccccCceeeHH
Confidence            56799999999999999999999863


No 43 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=52.23  E-value=7.1  Score=38.42  Aligned_cols=27  Identities=26%  Similarity=0.624  Sum_probs=23.5

Q ss_pred             CCccccccccccccccEEEecCCceee
Q psy3967         295 NSDGRLCKICYQREMGVVFLPCGHIVA  321 (324)
Q Consensus       295 ~~~~~~C~iC~~~~~~~~~~PCgH~~~  321 (324)
                      ..+...|.||-+.---++++||+|-.|
T Consensus        58 DEen~~C~ICA~~~TYs~~~PC~H~~C   84 (493)
T COG5236          58 DEENMNCQICAGSTTYSARYPCGHQIC   84 (493)
T ss_pred             ccccceeEEecCCceEEEeccCCchHH
Confidence            345788999999999999999999765


No 44 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=48.73  E-value=5.7  Score=29.31  Aligned_cols=11  Identities=36%  Similarity=0.954  Sum_probs=9.1

Q ss_pred             eEEeeeCCccc
Q psy3967         210 TLCFRCGGGLK  220 (324)
Q Consensus       210 v~Cf~Cg~~l~  220 (324)
                      |+||.||..+.
T Consensus         5 VRCFTCGkvi~   15 (60)
T PF01194_consen    5 VRCFTCGKVIG   15 (60)
T ss_dssp             SS-STTTSBTC
T ss_pred             eecCCCCCChh
Confidence            68999999997


No 45 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=48.31  E-value=12  Score=27.81  Aligned_cols=12  Identities=33%  Similarity=0.869  Sum_probs=10.5

Q ss_pred             ceEEeeeCCccc
Q psy3967         209 QTLCFRCGGGLK  220 (324)
Q Consensus       209 ~v~Cf~Cg~~l~  220 (324)
                      -|+||.||..+.
T Consensus         4 PiRCFsCGkvi~   15 (63)
T COG1644           4 PVRCFSCGKVIG   15 (63)
T ss_pred             ceEeecCCCCHH
Confidence            379999999997


No 46 
>KOG4628|consensus
Probab=46.91  E-value=12  Score=36.90  Aligned_cols=22  Identities=32%  Similarity=0.754  Sum_probs=17.2

Q ss_pred             ccccccccc---cccEEEecCCcee
Q psy3967         299 RLCKICYQR---EMGVVFLPCGHIV  320 (324)
Q Consensus       299 ~~C~iC~~~---~~~~~~~PCgH~~  320 (324)
                      -.|.||+|.   .--+..|||+|.-
T Consensus       230 ~~CaIClEdY~~GdklRiLPC~H~F  254 (348)
T KOG4628|consen  230 DTCAICLEDYEKGDKLRILPCSHKF  254 (348)
T ss_pred             ceEEEeecccccCCeeeEecCCCch
Confidence            389999975   4457889999963


No 47 
>PHA02926 zinc finger-like protein; Provisional
Probab=46.43  E-value=7.1  Score=36.23  Aligned_cols=26  Identities=31%  Similarity=0.607  Sum_probs=19.4

Q ss_pred             Ccccccccccccc---------ccEEEecCCceee
Q psy3967         296 SDGRLCKICYQRE---------MGVVFLPCGHIVA  321 (324)
Q Consensus       296 ~~~~~C~iC~~~~---------~~~~~~PCgH~~~  321 (324)
                      +.+.+|.|||+.-         +--++.+|+|.-|
T Consensus       168 SkE~eCgICmE~I~eK~~~~eRrFGIL~~CnHsFC  202 (242)
T PHA02926        168 SKEKECGICYEVVYSKRLENDRYFGLLDSCNHIFC  202 (242)
T ss_pred             cCCCCCccCccccccccccccccccccCCCCchHH
Confidence            3467899999863         2258889999854


No 48 
>PF12678 zf-rbx1:  RING-H2 zinc finger;  InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This domain constitutes a conserved region found in proteins that participate in diverse functions relevant to chromosome metabolism and cell cycle control [].The domain contains 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding.; PDB: 4A0C_D 4A0L_I 4A0K_B 2ECL_A 1LDK_C 3RTR_F 3DQV_Y 1U6G_B 1LDJ_B 2HYE_D ....
Probab=44.20  E-value=19  Score=27.18  Aligned_cols=20  Identities=45%  Similarity=1.029  Sum_probs=14.7

Q ss_pred             cccccccc-------------ccEEEecCCcee
Q psy3967         301 CKICYQRE-------------MGVVFLPCGHIV  320 (324)
Q Consensus       301 C~iC~~~~-------------~~~~~~PCgH~~  320 (324)
                      |.||++.-             ..++..+|||.-
T Consensus        22 C~IC~~~l~~~~~~~~~~~~~~~i~~~~C~H~F   54 (73)
T PF12678_consen   22 CAICREPLEDPCPECQAPQDECPIVWGPCGHIF   54 (73)
T ss_dssp             ETTTTSBTTSTTCCHHHCTTTS-EEEETTSEEE
T ss_pred             ccccChhhhChhhhhcCCccccceEecccCCCE
Confidence            88887654             667888999974


No 49 
>KOG0978|consensus
Probab=41.61  E-value=3.9  Score=43.68  Aligned_cols=31  Identities=23%  Similarity=0.493  Sum_probs=26.9

Q ss_pred             CCCCCCccccccccccccccEEEecCCceee
Q psy3967         291 RPEPNSDGRLCKICYQREMGVVFLPCGHIVA  321 (324)
Q Consensus       291 ~~~~~~~~~~C~iC~~~~~~~~~~PCgH~~~  321 (324)
                      +++.+.....|.+|.++..|+|+.-|||+-|
T Consensus       636 Elk~yK~~LkCs~Cn~R~Kd~vI~kC~H~FC  666 (698)
T KOG0978|consen  636 ELKEYKELLKCSVCNTRWKDAVITKCGHVFC  666 (698)
T ss_pred             HHHHHHhceeCCCccCchhhHHHHhcchHHH
Confidence            3455667788999999999999999999976


No 50 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=41.34  E-value=21  Score=27.98  Aligned_cols=27  Identities=30%  Similarity=0.714  Sum_probs=20.0

Q ss_pred             CCcccccccccccc--ccEEEecCCceee
Q psy3967         295 NSDGRLCKICYQRE--MGVVFLPCGHIVA  321 (324)
Q Consensus       295 ~~~~~~C~iC~~~~--~~~~~~PCgH~~~  321 (324)
                      .++...|.+|...-  ..+++.||||++-
T Consensus        75 i~~~~~C~vC~k~l~~~~f~~~p~~~v~H  103 (109)
T PF10367_consen   75 ITESTKCSVCGKPLGNSVFVVFPCGHVVH  103 (109)
T ss_pred             ECCCCCccCcCCcCCCceEEEeCCCeEEe
Confidence            34567899998654  4577789999874


No 51 
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins. Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Class
Probab=40.73  E-value=17  Score=25.31  Aligned_cols=18  Identities=33%  Similarity=0.874  Sum_probs=14.9

Q ss_pred             ccccccc--ccccEEEecCC
Q psy3967         300 LCKICYQ--REMGVVFLPCG  317 (324)
Q Consensus       300 ~C~iC~~--~~~~~~~~PCg  317 (324)
                      .|.||++  .+.+.++.||.
T Consensus         1 ~CrIC~~~~~~~~~l~~PC~   20 (49)
T smart00744        1 ICRICHDEGDEGDPLVSPCR   20 (49)
T ss_pred             CccCCCCCCCCCCeeEeccc
Confidence            4899996  67788899995


No 52 
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=37.31  E-value=18  Score=35.14  Aligned_cols=26  Identities=31%  Similarity=0.681  Sum_probs=19.5

Q ss_pred             CCccccccccccc---cccEEEecCCcee
Q psy3967         295 NSDGRLCKICYQR---EMGVVFLPCGHIV  320 (324)
Q Consensus       295 ~~~~~~C~iC~~~---~~~~~~~PCgH~~  320 (324)
                      ....-.|.|||+.   .-.++.+||.|.-
T Consensus       320 a~~GveCaICms~fiK~d~~~vlPC~H~F  348 (374)
T COG5540         320 ADKGVECAICMSNFIKNDRLRVLPCDHRF  348 (374)
T ss_pred             cCCCceEEEEhhhhcccceEEEeccCcee
Confidence            3445789999974   3348999999974


No 53 
>PF04564 U-box:  U-box domain;  InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis. Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A ....
Probab=31.93  E-value=41  Score=25.16  Aligned_cols=24  Identities=38%  Similarity=0.504  Sum_probs=19.6

Q ss_pred             ccccccccccccccEEEecCCcee
Q psy3967         297 DGRLCKICYQREMGVVFLPCGHIV  320 (324)
Q Consensus       297 ~~~~C~iC~~~~~~~~~~PCgH~~  320 (324)
                      +.-.|-|+.+-=+|=|++|+||..
T Consensus         3 ~~f~CpIt~~lM~dPVi~~~G~ty   26 (73)
T PF04564_consen    3 DEFLCPITGELMRDPVILPSGHTY   26 (73)
T ss_dssp             GGGB-TTTSSB-SSEEEETTSEEE
T ss_pred             cccCCcCcCcHhhCceeCCcCCEE
Confidence            467899999999999999999874


No 54 
>PF04710 Pellino:  Pellino;  InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ].; PDB: 3EGB_B 3EGA_A.
Probab=28.72  E-value=19  Score=36.12  Aligned_cols=13  Identities=38%  Similarity=0.884  Sum_probs=0.0

Q ss_pred             ccEEEecCCceee
Q psy3967         309 MGVVFLPCGHIVA  321 (324)
Q Consensus       309 ~~~~~~PCgH~~~  321 (324)
                      -..+|.||||++.
T Consensus       358 pthaF~PCGHv~S  370 (416)
T PF04710_consen  358 PTHAFNPCGHVCS  370 (416)
T ss_dssp             -------------
T ss_pred             Cceeecccccccc
Confidence            4678999999984


No 55 
>KOG0320|consensus
Probab=23.60  E-value=24  Score=31.64  Aligned_cols=24  Identities=29%  Similarity=0.635  Sum_probs=19.1

Q ss_pred             cccccccccccccEE-E-ecCCceee
Q psy3967         298 GRLCKICYQREMGVV-F-LPCGHIVA  321 (324)
Q Consensus       298 ~~~C~iC~~~~~~~~-~-~PCgH~~~  321 (324)
                      .-.|-|||+.....+ + --|||+-|
T Consensus       131 ~~~CPiCl~~~sek~~vsTkCGHvFC  156 (187)
T KOG0320|consen  131 TYKCPICLDSVSEKVPVSTKCGHVFC  156 (187)
T ss_pred             ccCCCceecchhhccccccccchhHH
Confidence            356999998877776 3 69999876


No 56 
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=20.38  E-value=86  Score=22.73  Aligned_cols=37  Identities=19%  Similarity=0.169  Sum_probs=23.2

Q ss_pred             HHHHHcCceecCCCCCCCCCCeEeecccCceeccccCCCChhhhhc
Q psy3967          58 KQMAAAGFYFLGKKENGRFSDDVKCIFCGIELGKWVQGDDPLKDHE  103 (324)
Q Consensus        58 ~~LA~aGFyy~g~~~~~~~~D~V~C~~C~~~l~~w~~~Ddp~~eH~  103 (324)
                      +-||+|||-  +.       -+++|.-|+..-.-..+..-|.+.|+
T Consensus        12 KlLa~a~~~--~y-------le~KCPrCK~vN~~~~~~e~~t~~~k   48 (60)
T COG4416          12 KLLAEAEGQ--AY-------LEKKCPRCKEVNEFYIKEEATTQIHK   48 (60)
T ss_pred             HHHHhcccc--ee-------eeecCCccceeeeeecccccchhhhh
Confidence            567888773  21       25778888776555555556666665


No 57 
>KOG0802|consensus
Probab=20.23  E-value=40  Score=35.08  Aligned_cols=24  Identities=42%  Similarity=0.852  Sum_probs=21.0

Q ss_pred             cccccccccccccc-----EEEecCCcee
Q psy3967         297 DGRLCKICYQREMG-----VVFLPCGHIV  320 (324)
Q Consensus       297 ~~~~C~iC~~~~~~-----~~~~PCgH~~  320 (324)
                      ....|.||.|.-..     .-.+||||+.
T Consensus       290 ~~~~C~IC~e~l~~~~~~~~~rL~C~Hif  318 (543)
T KOG0802|consen  290 SDELCIICLEELHSGHNITPKRLPCGHIF  318 (543)
T ss_pred             cCCeeeeechhhccccccccceeecccch
Confidence            36789999999888     7999999975


Done!