Query         psy3970
Match_columns 104
No_of_seqs    104 out of 245
Neff          4.5 
Searched_HMMs 46136
Date          Fri Aug 16 22:00:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3970.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3970hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd01396 MeCP2_MBD MeCP2, MBD1,  99.9 1.1E-27 2.3E-32  159.5   6.8   70   24-94      2-75  (77)
  2 smart00391 MBD Methyl-CpG bind  99.9 3.3E-26 7.2E-31  152.2   7.2   69   22-91      2-74  (77)
  3 PF01429 MBD:  Methyl-CpG bindi  99.9 1.1E-25 2.3E-30  148.5   7.3   71   19-89      1-76  (77)
  4 cd00122 MBD MeCP2, MBD1, MBD2,  99.9 2.6E-24 5.7E-29  136.9   6.0   57   24-82      2-62  (62)
  5 cd01397 HAT_MBD Methyl-CpG bin  99.9 2.2E-24 4.8E-29  143.3   5.5   62   28-90      5-70  (73)
  6 KOG4161|consensus               99.8 1.3E-20 2.9E-25  149.4   5.0   88   15-102     5-92  (272)
  7 cd01395 HMT_MBD Methyl-CpG bin  99.6 5.1E-16 1.1E-20   99.9   4.2   53   28-82      5-60  (60)
  8 KOG4161|consensus               95.0   0.019 4.2E-07   46.0   2.7   82   18-102   166-254 (272)
  9 PF00397 WW:  WW domain;  Inter  86.9    0.86 1.9E-05   24.9   2.7   24   29-59      1-25  (31)
 10 PF14030 DUF4245:  Protein of u  67.1      14  0.0003   27.4   4.7   38   25-62     59-96  (169)
 11 PF12528 DUF3728:  Prepilin pep  66.3      13 0.00028   24.9   4.0   35   27-61     40-74  (84)
 12 PRK10332 hypothetical protein;  63.7      14 0.00029   26.3   3.9   33   27-60     63-95  (107)
 13 smart00456 WW Domain with 2 co  63.2     7.8 0.00017   20.5   2.1   21   29-57      1-21  (32)
 14 PF12874 zf-met:  Zinc-finger o  60.2      18 0.00039   17.9   3.1   22   52-73      1-22  (25)
 15 cd01259 PH_Apbb1ip Apbb1ip (Am  50.9      28 0.00061   25.1   3.8   34   30-72     13-47  (114)
 16 KOG1141|consensus               44.5      10 0.00022   36.0   0.9   45   47-91    617-665 (1262)
 17 PF00096 zf-C2H2:  Zinc finger,  42.7      37 0.00079   16.3   2.5   17   56-72      5-21  (23)
 18 PF07624 PSD2:  Protein of unkn  42.2      20 0.00043   23.1   1.8   19   56-74      1-19  (76)
 19 KOG3259|consensus               41.0      17 0.00037   27.7   1.5   22   28-56      6-27  (163)
 20 smart00497 IENR1 Intron encode  38.8      44 0.00096   19.0   2.8   24   50-73      3-29  (53)
 21 PF13894 zf-C2H2_4:  C2H2-type   38.1      47   0.001   15.4   2.6   16   57-72      6-21  (24)
 22 PF12680 SnoaL_2:  SnoaL-like d  31.4      77  0.0017   18.9   3.2   26   48-74     21-46  (102)
 23 cd00201 WW Two conserved trypt  30.7      51  0.0011   16.8   2.0   19   30-56      1-19  (31)
 24 PHA00616 hypothetical protein   26.9      33 0.00071   20.8   0.8   17   57-73      7-23  (44)
 25 PF03633 Glyco_hydro_65C:  Glyc  25.9      26 0.00055   20.8   0.2    9   27-35      1-9   (54)
 26 COG4957 Predicted transcriptio  25.6      34 0.00074   25.7   0.9   37   37-80     66-104 (148)
 27 PF14657 Integrase_AP2:  AP2-li  24.2 1.4E+02  0.0031   17.1   3.3   25   49-73      4-36  (46)
 28 PF07676 PD40:  WD40-like Beta   23.9      89  0.0019   16.7   2.2   14   48-61     10-23  (39)
 29 PF07453 NUMOD1:  NUMOD1 domain  23.8      63  0.0014   17.6   1.6   16   59-74     14-29  (37)
 30 KOG1891|consensus               22.9      56  0.0012   26.6   1.7   14   28-41     93-106 (271)
 31 KOG1141|consensus               22.4      77  0.0017   30.5   2.7   53   28-85    806-861 (1262)
 32 PF12171 zf-C2H2_jaz:  Zinc-fin  21.9      33 0.00071   17.6   0.1   21   52-72      2-22  (27)
 33 PF10411 DsbC_N:  Disulfide bon  21.3      79  0.0017   19.2   1.8   12   50-61     34-45  (57)
 34 PF07894 DUF1669:  Protein of u  20.2 1.1E+02  0.0023   25.2   2.8   47   21-72     97-143 (284)

No 1  
>cd01396 MeCP2_MBD MeCP2, MBD1, MBD2, MBD3, and MBD4 are members of a protein family that share the methyl-CpG-binding domain (MBD). The MBD, consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1.
Probab=99.94  E-value=1.1e-27  Score=159.51  Aligned_cols=70  Identities=44%  Similarity=0.743  Sum_probs=64.5

Q ss_pred             ccCCCCCCCcEEEEEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHhC----CCCCcceeeecCcccchhhhh
Q psy3970          24 YECPQLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIRG----NIPGVSFDFRSGKLNSLQKHR   94 (104)
Q Consensus        24 ~~~p~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~~----~l~~e~FdF~~~k~~~~~~~k   94 (104)
                      .+||+||+||+||+++|++| ++++.||||++|+|++|||+.||++||+.    .+++++|||+++++..++..+
T Consensus         2 ~~~~~lp~GW~r~~~~R~~g-s~~k~DvyY~sP~Gkk~RS~~ev~~yL~~~~~~~~~~~~FdF~~~k~~~~~~~~   75 (77)
T cd01396           2 PEDPRLPPGWKRELVPRKSG-SAGKFDVYYISPTGKKFRSKVELARYLEKNGPTSLDLSDFDFTVPKKLGLGSPR   75 (77)
T ss_pred             CCCCCCCCCCEEEEEEecCC-CCCcceEEEECCCCCEEECHHHHHHHHHhCCCCCCcHhHcccCCCcccccccCC
Confidence            57899999999999999999 78999999999999999999999999998    499999999999988776543


No 2  
>smart00391 MBD Methyl-CpG binding domain. Methyl-CpG binding domain, also known as the TAM (TTF-IIP5, ARBP, MeCP1) domain
Probab=99.93  E-value=3.3e-26  Score=152.20  Aligned_cols=69  Identities=42%  Similarity=0.729  Sum_probs=63.0

Q ss_pred             ccccCCCCCCCcEEEEEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHhCC----CCCcceeeecCcccchh
Q psy3970          22 KRYECPQLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIRGN----IPGVSFDFRSGKLNSLQ   91 (104)
Q Consensus        22 ~~~~~p~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~~~----l~~e~FdF~~~k~~~~~   91 (104)
                      ..+++| ||+||+|++++|++|.++++.||||+||||++|||+.||++||.++    +++++|||+++.++...
T Consensus         2 ~~~~~P-lp~GW~R~~~~r~~g~~~~~~dV~Y~sP~GkklRs~~ev~~YL~~~~~~~~~~~~F~F~~~~~~~~~   74 (77)
T smart00391        2 DPLRLP-LPCGWRRETKQRKSGRSAGKFDVYYISPCGKKLRSKSELARYLHKNGDLSLDLECFDFNATVPVGPK   74 (77)
T ss_pred             CcccCC-CCCCcEEEEEEecCCCCCCcccEEEECCCCCeeeCHHHHHHHHHhCCCcccccccccCcCCcccccc
Confidence            457887 9999999999999999999999999999999999999999999974    78899999999887654


No 3  
>PF01429 MBD:  Methyl-CpG binding domain;  InterPro: IPR001739 Methylation at CpG dinucleotide, the most common DNA modification in eukaryotes, has been correlated with gene silencing associated with various phenomena such as genomic imprinting, transposon and chromosome X inactivation, differentiation, and cancer. Effects of DNA methylation are mediated through proteins which bind to symmetrically methylated CpGs. Such proteins contain a specific domain of ~70 residues, the methyl-CpG-binding domain (MBD), which is linked to additional domains associated with chromatin, such as the bromodomain, the AT hook motif,the SET domain, or the PHD finger. MBD-containing proteins appear to act as structural proteins, which recruit a variety of histone deacetylase (HDAC) complexes and chromatin remodelling factors, leading to chromatin compaction and, consequently, to transcriptional repression. The MBD of MeCP2, MBD1, MBD2, MBD4 and BAZ2 mediates binding to DNA, in case of MeCP2, MBD1 and MBD2 preferentially to methylated CpG. In case of human MBD3 and SETDB1 the MBD has been shown to mediate protein-protein interactions [, ]. The MBD folds into an alpha/beta sandwich structure comprising a layer of twisted beta sheet, backed by another layer formed by the alpha1 helix and a hairpin loop at the C terminus. These layers are both amphipathic, with the alpha1 helix and the beta sheet lying parallel and the hydrophobic faces tightly packed against each other. The beta sheet is composed of two long inner strands (beta2 and beta3) sandwiched by two shorter outer strands (beta1 and beta4) [].; GO: 0003677 DNA binding, 0005634 nucleus; PDB: 2KY8_A 1UB1_A 1D9N_A 1IG4_A 1QK9_A 3C2I_A.
Probab=99.93  E-value=1.1e-25  Score=148.49  Aligned_cols=71  Identities=39%  Similarity=0.734  Sum_probs=60.1

Q ss_pred             cccccccCCCCCCCcEEEEEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHhCC-----CCCcceeeecCcccc
Q psy3970          19 PTKKRYECPQLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIRGN-----IPGVSFDFRSGKLNS   89 (104)
Q Consensus        19 ~~~~~~~~p~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~~~-----l~~e~FdF~~~k~~~   89 (104)
                      |+.....+++||+||+||+++|++|++++++||||+||+|++|||+.||.+||..+     +++++|+|.+.+++.
T Consensus         1 ~~~~~~~~~~Lp~GW~re~~~R~~g~~~~~~dv~Y~sP~Gk~~RS~~eV~~yL~~~~~~~~l~~~~F~F~~~~~~~   76 (77)
T PF01429_consen    1 IHRISPLDPPLPDGWKREVVVRKSGSSAGKKDVYYYSPCGKRFRSKKEVVRYLKENPSEHDLKPENFSFSKRLIML   76 (77)
T ss_dssp             --SSECEBTTSTTT-EEEEEESSSSTTTTSEEEEEEETTSEEESSHHHHHHHHTTSS---SS-CTTBBTTTTB---
T ss_pred             CCccccccCCCCCCCEEEEEEecCCCcCCceEEEEECCCCCEEeCHHHHHHHHHhCCCcccCCHhHCCCCCCcccC
Confidence            35567788899999999999999999999999999999999999999999999874     679999999887653


No 4  
>cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD). The MBD consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1. The MBDs present in putative chromatin remodelling subunit, BAZ2A, and putative histone methyltransferase, CLLD8, represent two phylogenetically distinct groups within the MBD protein family.
Probab=99.90  E-value=2.6e-24  Score=136.86  Aligned_cols=57  Identities=51%  Similarity=0.938  Sum_probs=52.7

Q ss_pred             ccCCCCCCCcEEEEEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHhCC----CCCcceee
Q psy3970          24 YECPQLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIRGN----IPGVSFDF   82 (104)
Q Consensus        24 ~~~p~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~~~----l~~e~FdF   82 (104)
                      +.+ |+|+||+|++++|++| ++++.||||++|||++|||+.||++||.++    +++++|||
T Consensus         2 l~~-P~p~GW~R~~~~r~~g-~~~k~dv~Y~sP~Gk~~Rs~~ev~~yL~~~~~~~l~~~~F~F   62 (62)
T cd00122           2 LRD-PLPPGWKRELVIRKSG-SAGKGDVYYYSPCGKKLRSKPEVARYLEKTGPSSLDLENFSF   62 (62)
T ss_pred             CCC-CCCCCeEEEEEEcCCC-CCCcceEEEECCCCceecCHHHHHHHHHhCCCCCCcHHHCCC
Confidence            345 4699999999999999 779999999999999999999999999974    99999998


No 5  
>cd01397 HAT_MBD Methyl-CpG binding domains (MBD) present in putative chromatin remodelling factor such as BAZ2A; BAZ2A contains a MBD, DDT, PHD-type zinc finger and Bromo domain suggesting that BAZ2A might be associated with histone acetyltransferase (HAT) activity. The Drosophila melanogaster toutatis protein, a putative subunit of the chromatin-remodeling complex, and other such proteins in this group share a similar domain architecture with BAZ2A, as does the Caenorhabditis elegans flectin homolog.
Probab=99.90  E-value=2.2e-24  Score=143.35  Aligned_cols=62  Identities=34%  Similarity=0.554  Sum_probs=57.5

Q ss_pred             CCCCCcEEEEEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHhC----CCCCcceeeecCcccch
Q psy3970          28 QLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIRG----NIPGVSFDFRSGKLNSL   90 (104)
Q Consensus        28 ~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~~----~l~~e~FdF~~~k~~~~   90 (104)
                      ||+.||+||+++|+.| ++.++|||||+|||||+||++||++||..    .+++|||+|++..++++
T Consensus         5 Pl~~GW~Re~vir~~~-~~~~~dV~Y~aPcGKklRs~~ev~~yL~~~~~~~Lt~dnFsF~~~~~vg~   70 (73)
T cd01397           5 PLELGWRRETRIRGLG-GRIQGEVAYYAPCGKKLRQYPEVIKYLSKNGISLLSRENFSFSARAPVGD   70 (73)
T ss_pred             CCCCCceeEEEeccCC-CCccceEEEECCCCcccccHHHHHHHHHhCCccCccHhHccccCCccccc
Confidence            6999999999999998 67999999999999999999999999996    48999999998887764


No 6  
>KOG4161|consensus
Probab=99.81  E-value=1.3e-20  Score=149.37  Aligned_cols=88  Identities=42%  Similarity=0.728  Sum_probs=83.8

Q ss_pred             cccccccccccCCCCCCCcEEEEEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHhCCCCCcceeeecCcccchhhhh
Q psy3970          15 LKMLPTKKRYECPQLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIRGNIPGVSFDFRSGKLNSLQKHR   94 (104)
Q Consensus        15 ~~~~~~~~~~~~p~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~~~l~~e~FdF~~~k~~~~~~~k   94 (104)
                      ...+++.++++||.||+||+|++++|++|.++|++||||+||.|++|||+.+++.||+...+...|+|-++++..+..++
T Consensus         5 ~~~~~~~~~~~c~~lp~GW~~~~~~r~~~~~~g~~dv~~~sp~g~~frsk~~l~~~~~~~~~~s~~~~v~~k~~~~~~~~   84 (272)
T KOG4161|consen    5 SSATIAGKRSDCPALPPGWTREEVQRSSGLSAGKSDVYYISPSGKKFRSKPQLARYLGKVGDLSLFDFVTGKMSPSERQK   84 (272)
T ss_pred             cccccccCcccCCCCCCCcchhhhcccCCCcccccceEEeCCcccccccccHHHHHhccccccccCcccccccccccccc
Confidence            45789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcccCC
Q psy3970          95 NKQRGNQF  102 (104)
Q Consensus        95 ~k~r~~~~  102 (104)
                      ++|+.+.+
T Consensus        85 ~~q~~~~~   92 (272)
T KOG4161|consen   85 NKQRKPED   92 (272)
T ss_pred             cCCCCCCc
Confidence            99888754


No 7  
>cd01395 HMT_MBD Methyl-CpG binding domains (MBD) present in putative histone methyltransferases (HMT) such as CLLD8 and SETDB1 proteins; CLLD8 contains a MBD, a PreSET and a bifurcated SET domain, suggesting that CLLD8 might be associated with methylation-mediated transcriptional repression. SETDB1 and other proteins in this group have a similar domain architecture. SETDB1 is a novel KAP-1-associated histone H3, lysine 9-specific methyltransferase that contributes to HP1-mediated silencing of euchromatic genes by KRAB zinc-finger proteins.
Probab=99.61  E-value=5.1e-16  Score=99.88  Aligned_cols=53  Identities=34%  Similarity=0.534  Sum_probs=48.8

Q ss_pred             CCCCCcEEEEEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHhCC---CCCcceee
Q psy3970          28 QLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIRGN---IPGVSFDF   82 (104)
Q Consensus        28 ~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~~~---l~~e~FdF   82 (104)
                      ||-.||+|+...|+.|+  .+.||+|.+||||++|+..||++||.++   +++|+|+|
T Consensus         5 Pll~gw~R~~~~~~~~~--~k~~V~Y~aPCGr~Lr~~~EV~~YL~~t~~~L~~d~FsF   60 (60)
T cd01395           5 PLLCGFQRMKYRARVGK--VKKHVIYKAPCGRSLRNMSEVHRYLRETCSFLTVDNFSF   60 (60)
T ss_pred             ccccCeEEEEEeccCCC--cccceEEECCcchhhhcHHHHHHHHHhccccceeecccC
Confidence            67899999999998873  5899999999999999999999999975   88999998


No 8  
>KOG4161|consensus
Probab=94.99  E-value=0.019  Score=45.97  Aligned_cols=82  Identities=17%  Similarity=0.174  Sum_probs=66.3

Q ss_pred             ccccccccCCCCCCCcEEEEEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHhCC-------CCCcceeeecCcccch
Q psy3970          18 LPTKKRYECPQLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIRGN-------IPGVSFDFRSGKLNSL   90 (104)
Q Consensus        18 ~~~~~~~~~p~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~~~-------l~~e~FdF~~~k~~~~   90 (104)
                      ..+.+.+..+.-+.||.+....+..-   ...+.||..|+++.+++..+++.++..+       ..+.+|.|....+..+
T Consensus       166 ~e~~d~~~l~~~~~g~~~~~~~~s~~---~~~~~~~~~p~~~~~~~~~~~~~~~~~n~~~~~~~p~l~~~~~~~~~ir~~  242 (272)
T KOG4161|consen  166 GESIDKLSLPKTPQGSGRSSAGESLL---SSVATYLETPSGKKHGESPEAVAWKNANGPSETEQPLLGDFIVTEPDIRRQ  242 (272)
T ss_pred             ccccCccccCcCCCccCccccccccc---cccCcccccCCCcccccchhhhhcccCCCCCcccCCCcccccccCCCcCcc
Confidence            45566677778899999988666543   5789999999999999999999998764       5778999999999999


Q ss_pred             hhhhhhhcccCC
Q psy3970          91 QKHRNKQRGNQF  102 (104)
Q Consensus        91 ~~~k~k~r~~~~  102 (104)
                      ..+..+.|++++
T Consensus       243 ~~~~~~~r~~~~  254 (272)
T KOG4161|consen  243 ESRVKNVRRSLF  254 (272)
T ss_pred             ccchhhhhhccc
Confidence            887666565543


No 9  
>PF00397 WW:  WW domain;  InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet. This short domain of approximately 40 amino acids, may be repeated up to four times in some proteins [, , , ]. The name WW or WWP derives from the presence of two signature tryptophan residues that are spaced 20-23 amino acids apart and are present in most WW domains known to date, as well as that of a conserved Pro. The WW domain binds to proteins with particular proline-motifs, [AP]-P-P-[AP]-Y, and/or phosphoserine- phosphothreonine-containing motifs [, ]. It is frequently associated with other domains typical for proteins in signal transduction processes. A large variety of proteins containing the WW domain are known. These include; dystrophin, a multidomain cytoskeletal protein; utrophin, a dystrophin-like protein of unknown function; vertebrate YAP protein, substrate of an unknown serine kinase; Mus musculus (Mouse) NEDD-4, involved in the embryonic development and differentiation of the central nervous system; Saccharomyces cerevisiae (Baker's yeast) RSP5, similar to NEDD-4 in its molecular organisation; Rattus norvegicus (Rat) FE65, a transcription-factor activator expressed preferentially in liver; Nicotiana tabacum (Common tobacco) DB10 protein, amongst others.; GO: 0005515 protein binding; PDB: 2JXW_A 2DK1_A 2JOC_A 2JO9_A 1YIU_A 1O6W_A 2JMF_A 1TK7_A 2KYK_A 2L5F_A ....
Probab=86.92  E-value=0.86  Score=24.89  Aligned_cols=24  Identities=33%  Similarity=0.699  Sum_probs=15.0

Q ss_pred             CCCCcEEEEEEccCCCCCCceeEEEEcC-CCc
Q psy3970          29 LPPGWYREEVTRNKGLSVGKVDVFYYSP-CGK   59 (104)
Q Consensus        29 Lp~GW~Rev~~R~~g~s~gk~DVYY~sP-~Gk   59 (104)
                      ||+||+...-  ..     .+.+|||+. +|.
T Consensus         1 LP~gW~~~~~--~~-----~g~~YY~N~~t~~   25 (31)
T PF00397_consen    1 LPPGWEEYFD--PD-----SGRPYYYNHETGE   25 (31)
T ss_dssp             SSTTEEEEEE--TT-----TSEEEEEETTTTE
T ss_pred             CCcCCEEEEc--CC-----CCCEEEEeCCCCC
Confidence            7999973332  11     346899987 443


No 10 
>PF14030 DUF4245:  Protein of unknown function (DUF4245)
Probab=67.06  E-value=14  Score=27.45  Aligned_cols=38  Identities=29%  Similarity=0.498  Sum_probs=29.5

Q ss_pred             cCCCCCCCcEEEEEEccCCCCCCceeEEEEcCCCceec
Q psy3970          25 ECPQLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKLR   62 (104)
Q Consensus        25 ~~p~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~GkkfR   62 (104)
                      ..|.||+||+---..|........+.|=|++|.|.-.+
T Consensus        59 ~~P~lP~gW~~nSar~~~~~g~~~w~vG~vt~~~~yv~   96 (169)
T PF14030_consen   59 RAPELPEGWKANSARRQGVGGVPAWHVGYVTPDGQYVQ   96 (169)
T ss_pred             eCCCCCCCceeeeEEecCCCCcceEEEEEEcCCCCEEE
Confidence            35789999988888666554446899999999987654


No 11 
>PF12528 DUF3728:  Prepilin peptidase dependent protein C (DUF3728);  InterPro: IPR022204  This family of proteins is found in bacteria. Proteins in this family are typically between 106 and 121 amino acids in length. The family is found in association with PF07963 from PFAM. There are two completely conserved C residues that may be functionally important. This family is frequently annotated as prepilin peptidase dependent protein C however there is little accompanying literature to confirm this. 
Probab=66.27  E-value=13  Score=24.91  Aligned_cols=35  Identities=17%  Similarity=0.302  Sum_probs=28.3

Q ss_pred             CCCCCCcEEEEEEccCCCCCCceeEEEEcCCCcee
Q psy3970          27 PQLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKL   61 (104)
Q Consensus        27 p~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~Gkkf   61 (104)
                      +.+|+||+.+.........+...-|-..+|.|+..
T Consensus        40 ~~~~~gWq~~~~~~~~~~~C~~itvtv~tP~~~~a   74 (84)
T PF12528_consen   40 SGPPPGWQYSRQQTSIQGGCRSITVTVTTPQNQQA   74 (84)
T ss_pred             cCCCCCceeeeeeeccCCCeEEEEEEEecCCCccc
Confidence            36899999998888755567788899999987754


No 12 
>PRK10332 hypothetical protein; Provisional
Probab=63.73  E-value=14  Score=26.32  Aligned_cols=33  Identities=18%  Similarity=0.347  Sum_probs=25.5

Q ss_pred             CCCCCCcEEEEEEccCCCCCCceeEEEEcCCCce
Q psy3970          27 PQLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKK   60 (104)
Q Consensus        27 p~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~Gkk   60 (104)
                      +++|+||+.+-.+. ....+....|-..+|.|++
T Consensus        63 ~~~~~gWq~~~~~~-~~~gC~~itv~v~~P~~~~   95 (107)
T PRK10332         63 ISPPANWQVNRMQT-SQAGCVSISVTLVSPGGRQ   95 (107)
T ss_pred             CCCCCCceeeeeec-CCCCcEEEEEEEecCCCch
Confidence            57899998876666 3345788999999998765


No 13 
>smart00456 WW Domain with 2 conserved Trp (W) residues. Also known as the WWP or rsp5 domain. Binds proline-rich polypeptides.
Probab=63.22  E-value=7.8  Score=20.47  Aligned_cols=21  Identities=33%  Similarity=0.779  Sum_probs=13.6

Q ss_pred             CCCCcEEEEEEccCCCCCCceeEEEEcCC
Q psy3970          29 LPPGWYREEVTRNKGLSVGKVDVFYYSPC   57 (104)
Q Consensus        29 Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~   57 (104)
                      ||.||....-.        .+.+||++..
T Consensus         1 lp~gW~~~~~~--------~g~~yy~n~~   21 (32)
T smart00456        1 LPPGWEERKDP--------DGRPYYYNHE   21 (32)
T ss_pred             CCCCCEEEECC--------CCCEEEEECC
Confidence            68999654431        1468998763


No 14 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=60.22  E-value=18  Score=17.91  Aligned_cols=22  Identities=27%  Similarity=0.613  Sum_probs=19.1

Q ss_pred             EEEcCCCceeccHHHHHHHHhC
Q psy3970          52 FYYSPCGKKLRTRSEVLQVIRG   73 (104)
Q Consensus        52 YY~sP~GkkfRSk~eV~ryL~~   73 (104)
                      ||-+.+++.|.|...+...|.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            6778899999999999988764


No 15 
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain. Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain. Apbb1ip consists of a Ras-associated domain and a PH domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=50.87  E-value=28  Score=25.11  Aligned_cols=34  Identities=24%  Similarity=0.379  Sum_probs=25.7

Q ss_pred             CCCc-EEEEEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHh
Q psy3970          30 PPGW-YREEVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIR   72 (104)
Q Consensus        30 p~GW-~Rev~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~   72 (104)
                      -..| ++-.++|.+|        .||+|-| +-++..+|+.+..
T Consensus        13 kKsWKk~~f~LR~SG--------LYy~~Kg-ksk~srdL~cl~~   47 (114)
T cd01259          13 KKSWKKYYFVLRSSG--------LYYFPKE-KTKNTRDLACLNL   47 (114)
T ss_pred             CccceEEEEEEeCCe--------eEEccCC-CcCCHHHHHHHHh
Confidence            3579 6678899998        4888888 4567788887765


No 16 
>KOG1141|consensus
Probab=44.50  E-value=10  Score=36.01  Aligned_cols=45  Identities=24%  Similarity=0.341  Sum_probs=36.9

Q ss_pred             CceeEEEEcCCCceeccHHHHHHHHhCC----CCCcceeeecCcccchh
Q psy3970          47 GKVDVFYYSPCGKKLRTRSEVLQVIRGN----IPGVSFDFRSGKLNSLQ   91 (104)
Q Consensus        47 gk~DVYY~sP~GkkfRSk~eV~ryL~~~----l~~e~FdF~~~k~~~~~   91 (104)
                      .-.-|-|-.|||.-+|.+.||.|||-.+    +-++.|+|..-.+...+
T Consensus       617 ~~fhv~yktpcg~~lr~~~el~ryL~et~c~flf~~~f~~~~yV~~~r~  665 (1262)
T KOG1141|consen  617 RDFHVEYKTPCGMPLRMRIELYRYLVETRCKFLFVIGFDRAFYVVRHRA  665 (1262)
T ss_pred             hcceeeccCCCccchHHHHHHHHHHHHhcCcEEEEeecccchheeeccc
Confidence            4567899999999999999999999864    67788888876665554


No 17 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=42.67  E-value=37  Score=16.35  Aligned_cols=17  Identities=29%  Similarity=0.673  Sum_probs=14.4

Q ss_pred             CCCceeccHHHHHHHHh
Q psy3970          56 PCGKKLRTRSEVLQVIR   72 (104)
Q Consensus        56 P~GkkfRSk~eV~ryL~   72 (104)
                      -+|+.|.++.++.+.+.
T Consensus         5 ~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    5 ICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             TTTEEESSHHHHHHHHH
T ss_pred             CCCCccCCHHHHHHHHh
Confidence            38999999999988764


No 18 
>PF07624 PSD2:  Protein of unknown function (DUF1585);  InterPro: IPR011478 This entry represents a conserved region at the C terminus of a family of cytochrome-like proteins found in bacteria such as Rhodopirellula baltica and Solibacter usitatus. These proteins also contain IPR013036 from INTERPRO, IPR013039 from INTERPRO, IPR013042 from INTERPRO and IPR013043 from INTERPRO.
Probab=42.25  E-value=20  Score=23.13  Aligned_cols=19  Identities=21%  Similarity=0.345  Sum_probs=17.7

Q ss_pred             CCCceeccHHHHHHHHhCC
Q psy3970          56 PCGKKLRTRSEVLQVIRGN   74 (104)
Q Consensus        56 P~GkkfRSk~eV~ryL~~~   74 (104)
                      |+|..|....|+..+|.++
T Consensus         1 pdG~~f~~~~eLk~~L~~~   19 (76)
T PF07624_consen    1 PDGTSFEGAAELKQYLAER   19 (76)
T ss_pred             CCCCccCCHHHHHHHHHHC
Confidence            8999999999999999875


No 19 
>KOG3259|consensus
Probab=41.03  E-value=17  Score=27.71  Aligned_cols=22  Identities=32%  Similarity=0.881  Sum_probs=14.6

Q ss_pred             CCCCCcEEEEEEccCCCCCCceeEEEEcC
Q psy3970          28 QLPPGWYREEVTRNKGLSVGKVDVFYYSP   56 (104)
Q Consensus        28 ~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP   56 (104)
                      .||+||.+..- |.      ..-+|||++
T Consensus         6 ~LP~~Wekr~S-rs------~gr~YyfN~   27 (163)
T KOG3259|consen    6 KLPPGWEKRMS-RS------SGRPYYFNT   27 (163)
T ss_pred             cCCchhheecc-cc------CCCcceecc
Confidence            69999955432 33      345799976


No 20 
>smart00497 IENR1 Intron encoded nuclease repeat motif. Repeat of unknown function, but possibly DNA-binding via helix-turn-helix motif (Ponting, unpublished).
Probab=38.77  E-value=44  Score=19.04  Aligned_cols=24  Identities=17%  Similarity=0.265  Sum_probs=19.0

Q ss_pred             eEEEEcCCCc---eeccHHHHHHHHhC
Q psy3970          50 DVFYYSPCGK---KLRTRSEVLQVIRG   73 (104)
Q Consensus        50 DVYY~sP~Gk---kfRSk~eV~ryL~~   73 (104)
                      -||-++.+|.   .|.|..|.+++|+-
T Consensus         3 ~V~~~d~~~~~i~~f~S~~eAa~~lg~   29 (53)
T smart00497        3 PVYVYDLDGNLIGEFSSIREAAKYLGI   29 (53)
T ss_pred             cEEEEeCCCCEEEEecCHHHHHHHhCC
Confidence            3677777763   59999999999985


No 21 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=38.07  E-value=47  Score=15.40  Aligned_cols=16  Identities=50%  Similarity=0.949  Sum_probs=13.2

Q ss_pred             CCceeccHHHHHHHHh
Q psy3970          57 CGKKLRTRSEVLQVIR   72 (104)
Q Consensus        57 ~GkkfRSk~eV~ryL~   72 (104)
                      +|+.|+++.++...+.
T Consensus         6 C~~~~~~~~~l~~H~~   21 (24)
T PF13894_consen    6 CGKSFRSKSELRQHMR   21 (24)
T ss_dssp             TS-EESSHHHHHHHHH
T ss_pred             CCCcCCcHHHHHHHHH
Confidence            8999999999988764


No 22 
>PF12680 SnoaL_2:  SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A ....
Probab=31.39  E-value=77  Score=18.88  Aligned_cols=26  Identities=23%  Similarity=0.411  Sum_probs=21.7

Q ss_pred             ceeEEEEcCCCceeccHHHHHHHHhCC
Q psy3970          48 KVDVFYYSPCGKKLRTRSEVLQVIRGN   74 (104)
Q Consensus        48 k~DVYY~sP~GkkfRSk~eV~ryL~~~   74 (104)
                      .-|+.|..| +..++.+.++..++...
T Consensus        21 ~~d~~~~~~-~~~~~g~~~~~~~~~~~   46 (102)
T PF12680_consen   21 APDAVFHDP-GGTLRGREAIREFFEEF   46 (102)
T ss_dssp             EEEEEEEET-TSEEESHHHHHHHHHHH
T ss_pred             CCCEEEEeC-CCcccCHHHHHHHHHHH
Confidence            358889999 66699999999999863


No 23 
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs.
Probab=30.70  E-value=51  Score=16.80  Aligned_cols=19  Identities=37%  Similarity=0.838  Sum_probs=11.9

Q ss_pred             CCCcEEEEEEccCCCCCCceeEEEEcC
Q psy3970          30 PPGWYREEVTRNKGLSVGKVDVFYYSP   56 (104)
Q Consensus        30 p~GW~Rev~~R~~g~s~gk~DVYY~sP   56 (104)
                      |.||......        .+.+||++.
T Consensus         1 p~~W~~~~~~--------~g~~yy~n~   19 (31)
T cd00201           1 PPGWEERWDP--------DGRVYYYNH   19 (31)
T ss_pred             CCCCEEEECC--------CCCEEEEEC
Confidence            6789644331        146888876


No 24 
>PHA00616 hypothetical protein
Probab=26.92  E-value=33  Score=20.77  Aligned_cols=17  Identities=29%  Similarity=0.686  Sum_probs=16.1

Q ss_pred             CCceeccHHHHHHHHhC
Q psy3970          57 CGKKLRTRSEVLQVIRG   73 (104)
Q Consensus        57 ~GkkfRSk~eV~ryL~~   73 (104)
                      ||+.|+.+.++.+++..
T Consensus         7 CG~~F~~~s~l~~H~r~   23 (44)
T PHA00616          7 CGGIFRKKKEVIEHLLS   23 (44)
T ss_pred             hhHHHhhHHHHHHHHHH
Confidence            89999999999999976


No 25 
>PF03633 Glyco_hydro_65C:  Glycosyl hydrolase family 65, C-terminal domain ;  InterPro: IPR005194 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. This family of glycosyl hydrolases (GH65 from CAZY) contains this domain and includes vacuolar acid trehalase and maltose phosphorylases. Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown [].; PDB: 1H54_A.
Probab=25.90  E-value=26  Score=20.81  Aligned_cols=9  Identities=44%  Similarity=1.154  Sum_probs=3.0

Q ss_pred             CCCCCCcEE
Q psy3970          27 PQLPPGWYR   35 (104)
Q Consensus        27 p~Lp~GW~R   35 (104)
                      |.||.+|.+
T Consensus         1 P~LP~~w~~    9 (54)
T PF03633_consen    1 PRLPKQWSS    9 (54)
T ss_dssp             ----TT-SE
T ss_pred             CcCCCccCE
Confidence            679999954


No 26 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=25.56  E-value=34  Score=25.70  Aligned_cols=37  Identities=11%  Similarity=0.152  Sum_probs=23.8

Q ss_pred             EEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHhCC--CCCcce
Q psy3970          37 EVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIRGN--IPGVSF   80 (104)
Q Consensus        37 v~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~~~--l~~e~F   80 (104)
                      +-+|++    .+-|-..+=-+||+|.|   |.|+|..+  +++++|
T Consensus        66 V~~kKS----VtpD~IicLEDGkkfKS---LKRHL~t~~gmTPd~Y  104 (148)
T COG4957          66 VPIKKS----VTPDYIICLEDGKKFKS---LKRHLTTHYGLTPDEY  104 (148)
T ss_pred             CCcccc----cCCCeEEEeccCcchHH---HHHHHhcccCCCHHHH
Confidence            344554    35565555569999987   67899874  455443


No 27 
>PF14657 Integrase_AP2:  AP2-like DNA-binding integrase domain
Probab=24.23  E-value=1.4e+02  Score=17.09  Aligned_cols=25  Identities=24%  Similarity=0.503  Sum_probs=17.0

Q ss_pred             eeEE-EEcCCCce-------eccHHHHHHHHhC
Q psy3970          49 VDVF-YYSPCGKK-------LRTRSEVLQVIRG   73 (104)
Q Consensus        49 ~DVY-Y~sP~Gkk-------fRSk~eV~ryL~~   73 (104)
                      ..|| |...+|++       |+++.|...++..
T Consensus         4 ~~v~g~~~~~Gkrk~~~k~GF~TkkeA~~~~~~   36 (46)
T PF14657_consen    4 YRVYGYDDETGKRKQKTKRGFKTKKEAEKALAK   36 (46)
T ss_pred             EEEEEEECCCCCEEEEEcCCCCcHHHHHHHHHH
Confidence            3454 44448866       8888888888754


No 28 
>PF07676 PD40:  WD40-like Beta Propeller Repeat;  InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [, ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events. This region appears to be related to the IPR001680 from INTERPRO repeat. This model is likely to miss copies within a sequence.; PDB: 2HQS_D 1C5K_A 2IVZ_A 2W8B_D 3IAX_A 1CRZ_A 1N6F_D 1N6D_C 1N6E_C 1K32_A ....
Probab=23.91  E-value=89  Score=16.67  Aligned_cols=14  Identities=29%  Similarity=0.285  Sum_probs=8.1

Q ss_pred             ceeEEEEcCCCcee
Q psy3970          48 KVDVFYYSPCGKKL   61 (104)
Q Consensus        48 k~DVYY~sP~Gkkf   61 (104)
                      .----.+||+|+++
T Consensus        10 ~~~~p~~SpDGk~i   23 (39)
T PF07676_consen   10 DDGSPAWSPDGKYI   23 (39)
T ss_dssp             SEEEEEE-TTSSEE
T ss_pred             cccCEEEecCCCEE
Confidence            34445678888765


No 29 
>PF07453 NUMOD1:  NUMOD1 domain;  InterPro: IPR010896 This helix-turn-helix-containing DNA-binding domain is found associated in homing nucleases [].
Probab=23.78  E-value=63  Score=17.64  Aligned_cols=16  Identities=13%  Similarity=0.106  Sum_probs=14.0

Q ss_pred             ceeccHHHHHHHHhCC
Q psy3970          59 KKLRTRSEVLQVIRGN   74 (104)
Q Consensus        59 kkfRSk~eV~ryL~~~   74 (104)
                      +.|.|..|.+++|+-+
T Consensus        14 ~~F~Si~eAa~~l~i~   29 (37)
T PF07453_consen   14 KSFDSIREAARYLGIS   29 (37)
T ss_pred             EEEcCHHHHHHHhCCC
Confidence            7899999999999753


No 30 
>KOG1891|consensus
Probab=22.87  E-value=56  Score=26.63  Aligned_cols=14  Identities=50%  Similarity=0.919  Sum_probs=12.1

Q ss_pred             CCCCCcEEEEEEcc
Q psy3970          28 QLPPGWYREEVTRN   41 (104)
Q Consensus        28 ~Lp~GW~Rev~~R~   41 (104)
                      |||+||-.+..++.
T Consensus        93 PLPpgWav~~T~~g  106 (271)
T KOG1891|consen   93 PLPPGWAVEFTTEG  106 (271)
T ss_pred             CCCCCcceeeEecC
Confidence            89999999988774


No 31 
>KOG1141|consensus
Probab=22.36  E-value=77  Score=30.49  Aligned_cols=53  Identities=21%  Similarity=0.295  Sum_probs=38.8

Q ss_pred             CCCCCcEEEEEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHhCC---CCCcceeeecC
Q psy3970          28 QLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIRGN---IPGVSFDFRSG   85 (104)
Q Consensus        28 ~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~~~---l~~e~FdF~~~   85 (104)
                      +.-.||.|...-=..|     +-..|+.|+|--.+...|+..|+..+   ++|++|+|..+
T Consensus       806 t~~kGWg~rclddi~~-----g~fVciy~g~~l~~~~sdks~~~~~~~~~~~id~~~f~~~  861 (1262)
T KOG1141|consen  806 TIHKGWGRRCLDDITG-----GNFVCIYPGGALLHQISDKSEYIHVTRSLLTIDCFSFDAR  861 (1262)
T ss_pred             ccccccceEeeeecCC-----ceEEEEecchhhhhhhchhhhhcccchhhhcccccchhcc
Confidence            4557997665544433     25677889999999999999888754   78888888754


No 32 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=21.93  E-value=33  Score=17.60  Aligned_cols=21  Identities=24%  Similarity=0.630  Sum_probs=16.5

Q ss_pred             EEEcCCCceeccHHHHHHHHh
Q psy3970          52 FYYSPCGKKLRTRSEVLQVIR   72 (104)
Q Consensus        52 YY~sP~GkkfRSk~eV~ryL~   72 (104)
                      ||...|++.|.+...+...+.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            567789999999988776554


No 33 
>PF10411 DsbC_N:  Disulfide bond isomerase protein N-terminus;  InterPro: IPR018950  This is the N-terminal domain of the disulphide bond isomerase DsbC. The whole molecule is V-shaped, where each arm is a DsbC monomer of two domains linked by a hinge; and the N-termini of each monomer join to form the dimer interface at the base of the V, so are vital for dimerisation []. DsbC is required for disulphide bond formation and functions as a disulphide bond isomerase during oxidative protein-folding in bacterial periplasm. It also has chaperone activity []. ; PDB: 1EEJ_B 2IYJ_A 1TJD_A 1JZD_B 1JZO_A 1G0T_B 1T3B_A.
Probab=21.28  E-value=79  Score=19.23  Aligned_cols=12  Identities=25%  Similarity=0.553  Sum_probs=10.4

Q ss_pred             eEEEEcCCCcee
Q psy3970          50 DVFYYSPCGKKL   61 (104)
Q Consensus        50 DVYY~sP~Gkkf   61 (104)
                      .++|++++|+-|
T Consensus        34 ~i~Y~~~dg~yl   45 (57)
T PF10411_consen   34 GILYVDEDGRYL   45 (57)
T ss_dssp             EEEEEETTSSEE
T ss_pred             eEEEEcCCCCEE
Confidence            599999999765


No 34 
>PF07894 DUF1669:  Protein of unknown function (DUF1669);  InterPro: IPR012461 This family is composed of sequences derived from hypothetical eukaryotic proteins of unknown function. Some members of this family are annotated as being potential phospholipases but no literature was found to support this. 
Probab=20.16  E-value=1.1e+02  Score=25.20  Aligned_cols=47  Identities=23%  Similarity=0.406  Sum_probs=29.6

Q ss_pred             cccccCCCCCCCcEEEEEEccCCCCCCceeEEEEcCCCceeccHHHHHHHHh
Q psy3970          21 KKRYECPQLPPGWYREEVTRNKGLSVGKVDVFYYSPCGKKLRTRSEVLQVIR   72 (104)
Q Consensus        21 ~~~~~~p~Lp~GW~Rev~~R~~g~s~gk~DVYY~sP~GkkfRSk~eV~ryL~   72 (104)
                      ..-.+.|.|..||--.-..|  |  ...+.||+..|. -+--+-+||+|-+-
T Consensus        97 ~SD~~~P~LdLGWP~~~~~~--g--~Tr~~vy~qPp~-~~~p~IKE~vR~~I  143 (284)
T PF07894_consen   97 QSDTEPPPLDLGWPETPSYK--G--VTRATVYFQPPK-DGQPHIKEVVRRMI  143 (284)
T ss_pred             cCCCCCCCCCCCCCCCCccc--C--CceEEEEeCCCC-CCCCCHHHHHHHHH
Confidence            44556789999996632222  2  247888888876 44556666666543


Done!