BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy3973
         (285 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2NPD|A Chain A, An Unusual Twin-His Arrangement In The Pore Of Ammonia
           Channels Is Essential For Substrate Conductance
          Length = 424

 Score = 27.7 bits (60), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 99  GMTVTFANQQGALAGIVSGLLFCSLVGFGGPKPAPKKLPSTIEGCPNL 146
           G TV F N   A+AG+V   L    VGFG     P  LP    G   L
Sbjct: 163 GGTVVFINA--AIAGLVGAYLIGKRVGFGKEAFKPHNLPMVFTGTAIL 208


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.409 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,608,533
Number of Sequences: 62578
Number of extensions: 294112
Number of successful extensions: 394
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 393
Number of HSP's gapped (non-prelim): 6
length of query: 285
length of database: 14,973,337
effective HSP length: 98
effective length of query: 187
effective length of database: 8,840,693
effective search space: 1653209591
effective search space used: 1653209591
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)