Query         psy3977
Match_columns 99
No_of_seqs    95 out of 97
Neff          4.8 
Searched_HMMs 46136
Date          Fri Aug 16 22:07:31 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3977.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3977hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF15228 DAP:  Death-associated 100.0 2.4E-41 5.2E-46  230.8   7.1   92    8-99      1-97  (97)
  2 TIGR01764 excise DNA binding d  28.8      27 0.00058   18.8   0.6   19    7-25     22-40  (49)
  3 PRK10693 response regulator of  19.9      56  0.0012   25.3   1.1   15    8-22    245-259 (303)
  4 PF15488 DUF4645:  Domain of un  19.3      49  0.0011   26.8   0.7   21    8-28    132-152 (294)
  5 PRK09417 mogA molybdenum cofac  16.1 1.3E+02  0.0028   22.5   2.3   27   58-84     74-100 (193)
  6 PF15442 DUF4629:  Domain of un  14.3      76  0.0017   23.5   0.6    8   70-77    138-145 (150)
  7 PRK13744 conjugal transfer pro  13.9      94   0.002   20.4   0.9   17   12-28     32-48  (83)
  8 PHA00692 hypothetical protein   12.5 1.1E+02  0.0024   19.7   0.9   15   11-25     37-51  (74)
  9 PF14693 Ribosomal_TL5_C:  Ribo  12.4      75  0.0016   20.6   0.1   19    9-27     12-30  (88)
 10 PF12415 rpo132:  Poxvirus DNA    9.7 1.7E+02  0.0037   16.4   1.0   14   62-75      6-19  (33)

No 1  
>PF15228 DAP:  Death-associated protein
Probab=100.00  E-value=2.4e-41  Score=230.78  Aligned_cols=92  Identities=51%  Similarity=0.802  Sum_probs=70.0

Q ss_pred             ccCCCcccccCceeeccccCCCCCCCCCCCCccccccccC--CCCCcc-ceee-cccccCCCCCChHHHHhhhcCCCCCc
Q psy3977           8 KGGHAPAVKAGGMRITQHKDPHNKSSTTSDEPTNQALKVS--TSPPKT-TAIA-GAPIRGNADYPPEAVQSFHEKPVPSV   83 (99)
Q Consensus         8 KaGHpPAvKAGGmRI~~k~~~~~~~~~~~ek~~~~~~~~s--~s~~~~-~~~i-g~~~K~~~dFP~~AvqvaH~KP~P~v   83 (99)
                      |||||||||||||||+||+.....+....+++.+++.|++  ++++++ .++| |+++|+|+|||++|||+||+||+|+|
T Consensus         1 KaGHpPAvKAGGmRI~qk~~~~~~e~~~~~~~~~~~~~~~~~~~~p~~~~~~isg~~~k~~~dfP~~AvqvaHqKP~P~~   80 (97)
T PF15228_consen    1 KAGHPPAVKAGGMRIVQKKEKGTPEKERKKKDDSEEEVESISNSPPKQTSVIISGAPAKGNHDFPPEAVQVAHQKPRPAV   80 (97)
T ss_pred             CCCCCcccccCCCEeeccccCCCCccccccccccccccccccccCCcccceeeccccccccccCcHHHHHHhhcCCCccc
Confidence            7999999999999999999543321111011122333333  333433 5677 99999999999999999999999999


Q ss_pred             ccc-CCCCCCcccCCCC
Q psy3977          84 EKS-HHNKPNMIQQPRK   99 (99)
Q Consensus        84 ek~-~~~~~~~IqQPRK   99 (99)
                      ++. +++++++||||||
T Consensus        81 ek~~~~~~~~~IqQPRK   97 (97)
T PF15228_consen   81 EKPPPPRRINIIQQPRK   97 (97)
T ss_pred             cCcCCCCCCccccCCCC
Confidence            999 8878899999998


No 2  
>TIGR01764 excise DNA binding domain, excisionase family. An excisionase, or Xis protein, is a small protein that binds and promotes excisive recombination; it is not enzymatically active. This model represents a number of putative excisionases and related proteins from temperate phage, plasmids, and transposons, as well as DNA binding domains of other proteins, such as a DNA modification methylase. This model identifies mostly small proteins and N-terminal regions of large proteins, but some proteins appear to have two copies. This domain appears similar, in both sequence and predicted secondary structure (PSIPRED) to the MerR family of transcriptional regulators (pfam00376).
Probab=28.79  E-value=27  Score=18.82  Aligned_cols=19  Identities=21%  Similarity=0.352  Sum_probs=14.4

Q ss_pred             cccCCCcccccCceeeccc
Q psy3977           7 LKGGHAPAVKAGGMRITQH   25 (99)
Q Consensus         7 lKaGHpPAvKAGGmRI~~k   25 (99)
                      ++.|..|+++.||.+...+
T Consensus        22 ~~~g~i~~~~~g~~~~~~~   40 (49)
T TIGR01764        22 IHEGELPAYRVGRHYRIPR   40 (49)
T ss_pred             HHcCCCCeEEeCCeEEEeH
Confidence            4678999999988766543


No 3  
>PRK10693 response regulator of RpoS; Provisional
Probab=19.94  E-value=56  Score=25.25  Aligned_cols=15  Identities=13%  Similarity=0.406  Sum_probs=11.8

Q ss_pred             ccCCCcccccCceee
Q psy3977           8 KGGHAPAVKAGGMRI   22 (99)
Q Consensus         8 KaGHpPAvKAGGmRI   22 (99)
                      -|||||++..++-++
T Consensus       245 ~AGhp~~~~~~~~~~  259 (303)
T PRK10693        245 SAGLNATLNTGEHQV  259 (303)
T ss_pred             eCCCCCEEecCCeEE
Confidence            499999997666666


No 4  
>PF15488 DUF4645:  Domain of unknown function (DUF4645)
Probab=19.35  E-value=49  Score=26.78  Aligned_cols=21  Identities=29%  Similarity=0.525  Sum_probs=17.5

Q ss_pred             ccCCCcccccCceeeccccCC
Q psy3977           8 KGGHAPAVKAGGMRITQHKDP   28 (99)
Q Consensus         8 KaGHpPAvKAGGmRI~~k~~~   28 (99)
                      .-|-|||+.+||-||..--.+
T Consensus       132 ~sG~PpalMigGtRVs~gg~e  152 (294)
T PF15488_consen  132 FSGSPPALMIGGTRVSNGGTE  152 (294)
T ss_pred             cCCCCceeeeccccccCCCCc
Confidence            468899999999999876554


No 5  
>PRK09417 mogA molybdenum cofactor biosynthesis protein MogA; Provisional
Probab=16.15  E-value=1.3e+02  Score=22.55  Aligned_cols=27  Identities=26%  Similarity=0.401  Sum_probs=24.9

Q ss_pred             cccccCCCCCChHHHHhhhcCCCCCcc
Q psy3977          58 GAPIRGNADYPPEAVQSFHEKPVPSVE   84 (99)
Q Consensus        58 g~~~K~~~dFP~~AvqvaH~KP~P~ve   84 (99)
                      |-..-+..||.++|+.-+=+|..|.+.
T Consensus        74 GGtg~g~rDvTpeAv~~l~~keipG~~  100 (193)
T PRK09417         74 GGTGPARRDVTPEATLAVADKEMPGFG  100 (193)
T ss_pred             CCCCCCCCCcHHHHHHHHhCCcCCcHH
Confidence            888889999999999999999999876


No 6  
>PF15442 DUF4629:  Domain of unknown function (DUF4629)
Probab=14.31  E-value=76  Score=23.48  Aligned_cols=8  Identities=63%  Similarity=0.929  Sum_probs=6.6

Q ss_pred             HHHHhhhc
Q psy3977          70 EAVQSFHE   77 (99)
Q Consensus        70 ~AvqvaH~   77 (99)
                      |.|||||-
T Consensus       138 eSVQVFH~  145 (150)
T PF15442_consen  138 ESVQVFHP  145 (150)
T ss_pred             HhHHhhhh
Confidence            68999994


No 7  
>PRK13744 conjugal transfer protein TrbG; Provisional
Probab=13.86  E-value=94  Score=20.41  Aligned_cols=17  Identities=41%  Similarity=0.473  Sum_probs=11.8

Q ss_pred             CcccccCceeeccccCC
Q psy3977          12 APAVKAGGMRITQHKDP   28 (99)
Q Consensus        12 pPAvKAGGmRI~~k~~~   28 (99)
                      .|---|||.||+----.
T Consensus        32 apepdaggkrivayvyk   48 (83)
T PRK13744         32 APEPDAGGKRIVAYVYK   48 (83)
T ss_pred             CCCCCCCCcEEEEEEee
Confidence            34556899999875443


No 8  
>PHA00692 hypothetical protein
Probab=12.54  E-value=1.1e+02  Score=19.69  Aligned_cols=15  Identities=27%  Similarity=0.631  Sum_probs=13.0

Q ss_pred             CCcccccCceeeccc
Q psy3977          11 HAPAVKAGGMRITQH   25 (99)
Q Consensus        11 HpPAvKAGGmRI~~k   25 (99)
                      -||....||-||++-
T Consensus        37 yppgfrfggcrvskg   51 (74)
T PHA00692         37 YPPGFRFGGCRVSKG   51 (74)
T ss_pred             cCCCccccceeeccc
Confidence            489999999999864


No 9  
>PF14693 Ribosomal_TL5_C:  Ribosomal protein TL5, C-terminal domain; PDB: 1FEU_D 2HGQ_Y 2HGJ_Y 2Y19_Z 2WRL_Z 3KIT_Z 2WH2_Z 2WDN_Z 3V25_Z 3HUZ_Z ....
Probab=12.41  E-value=75  Score=20.65  Aligned_cols=19  Identities=32%  Similarity=0.574  Sum_probs=13.8

Q ss_pred             cCCCcccccCceeeccccC
Q psy3977           9 GGHAPAVKAGGMRITQHKD   27 (99)
Q Consensus         9 aGHpPAvKAGGmRI~~k~~   27 (99)
                      -|.++.+|.||+--...+.
T Consensus        12 ~G~~~gvk~Gg~l~~~~~~   30 (88)
T PF14693_consen   12 VGESPGVKKGGILQQVLRE   30 (88)
T ss_dssp             ESSSHHHCTTSEEEESTSE
T ss_pred             EcccccCcCCcEEEEEEeE
Confidence            3679999999876555543


No 10 
>PF12415 rpo132:  Poxvirus DNA dependent RNA polymerase;  InterPro: IPR024390 All three classes of poxvirus genes - early, intermediate and late - are transcribed by the viral RNA polymerase compex []. This complex is composed of nine distinct subunits which total more than 500kDa in mass. The two largest subunits (147 and 136kDa) are homologous to the largest subunits of eukaryotic and prokaryotic RNA polymerases and, like them, are thought to form a claw-shaped structure whose cleft is the site of template interaction and phosphodiester bond formation. While the smaller subunits of poxvirus RNA polymerase show much less similarity, if any, to the smaller subunits of the eukaryotic and prokaryotic enzymes, it is thought that they may play a similar role in interacting with transcription factors. The 132kDa subunit is the second largest subunit of the poxvirus DNA dependent RNA polymerase and shows structural similarity to the second-largest RNA polymerase subunits of eubacteria, archaebacteria, and eukaryotes.
Probab=9.74  E-value=1.7e+02  Score=16.40  Aligned_cols=14  Identities=29%  Similarity=0.382  Sum_probs=10.3

Q ss_pred             cCCCCCChHHHHhh
Q psy3977          62 RGNADYPPEAVQSF   75 (99)
Q Consensus        62 K~~~dFP~~Avqva   75 (99)
                      .+.-|||+|++-.+
T Consensus         6 ~Lsydmp~ei~ylv   19 (33)
T PF12415_consen    6 SLSYDMPPEIIYLV   19 (33)
T ss_pred             hhccCCCHHHHHHH
Confidence            36789999987543


Done!