Query psy3987
Match_columns 175
No_of_seqs 81 out of 83
Neff 3.7
Searched_HMMs 46136
Date Fri Aug 16 22:22:01 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy3987.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3987hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF01500 Keratin_B2: Keratin, 99.4 4.7E-13 1E-17 109.3 7.5 114 47-168 34-162 (164)
2 PF01500 Keratin_B2: Keratin, 99.1 1E-10 2.2E-15 95.8 7.0 56 30-89 25-82 (164)
3 KOG4726|consensus 96.6 0.011 2.4E-07 48.0 8.0 11 101-111 78-88 (146)
4 PF05287 PMG: PMG protein; In 81.5 8.6 0.00019 32.1 7.5 24 140-163 154-178 (180)
5 PF05287 PMG: PMG protein; In 72.5 12 0.00025 31.3 5.9 22 149-170 154-176 (180)
6 PF13165 DUF4001: Protein of u 5.6 1.3E+02 0.0028 20.4 -0.9 11 68-78 24-34 (44)
7 KOG0006|consensus 0.4 5.1E+03 0.11 18.1 0.4 9 167-175 400-408 (446)
8 PF14835 zf-RING_6: zf-RING of 0.4 4.6E+03 0.1 13.7 0.0 8 167-174 43-50 (65)
9 PF04579 Keratin_matx: Keratin 0.3 1.2E+04 0.26 12.3 1.9 29 68-96 43-73 (97)
10 PF02048 Enterotoxin_ST: Heat- 0.3 7.5E+03 0.16 12.3 0.5 10 43-52 42-51 (54)
No 1
>PF01500 Keratin_B2: Keratin, high sulfur B2 protein; InterPro: IPR002494 High sulphur proteins are cysteine-rich proteins synthesized during the differentiation of hair matrix cells, and form hair fibres in association with hair keratin intermediate filaments []. This family has been divided up into four regions, with the second region containing 8 copies of a short repeat []. This family is also known as B2 or KAP1.; GO: 0045095 keratin filament
Probab=99.42 E-value=4.7e-13 Score=109.31 Aligned_cols=114 Identities=29% Similarity=0.806 Sum_probs=65.5
Q ss_pred CcccccccCCcCCcc-ccCCccccccCCCcccccccCcccccccc-CCC----C------CcccccCccceeecCCCCCc
Q psy3987 47 VCGTAVCQSVCGTAV-CQSVCGTAVCQSVCGTAVCQSVCGTAVCQ-SVC----G------TAVCQSVCGTAVCQSVCGTA 114 (175)
Q Consensus 47 cC~p~cC~ssCc~~~-C~~sCc~p~C~~~C~~~cC~p~Cc~~~C~-s~C----~------~sCCqscC~p~cC~~tC~~p 114 (175)
+++|+++++++++|+ +++++++|.||+.++++++||+|++++++ +.+ + .....-.++++|||++++.+
T Consensus 34 CCqpsccqtscCrP~cc~ssCcrP~CqpccqssCcqPsCcqpScCqtgCgi~~~~~~g~~~~~g~vs~r~r~CRP~cc~~ 113 (164)
T PF01500_consen 34 CCQPSCCQTSCCRPSCCVSSCCRPICQPCCQSSCCQPSCCQPSCCQTGCGIGGGIGYGQEGGSGAVSCRTRWCRPDCCVP 113 (164)
T ss_pred ccCCCccCCceeCCceecccccCcccccccCCcccCCccccccccccccccCCccccccccCcccccccceeeCCCcccc
Confidence 455666666666665 45677777766656666666666666543 333 1 11222358999999999888
Q ss_pred -ccccCc-CCcccccCcCCCCCCC-CcCCccccCCcCccceeeccccccccCCcCCc
Q psy3987 115 -VCQSVC-GTAVCQSVCGTAVCQS-VCGTAVCQSVCGTAVCQSVCGTAVCQSVCGTA 168 (175)
Q Consensus 115 -~C~~~C-~~~~C~ssC~~~vC~~-cC~~~~C~~~C~~~~C~~~C~~~~C~~~Cc~~ 168 (175)
.++|.+ ++....++| ||+ ..+.++||+.+ +.+.++||++.-.+.+|
T Consensus 114 ~~c~p~cC~~sC~~ptC----Cq~~~~qasCCRPs~----C~~scCRp~Cc~~c~~p 162 (164)
T PF01500_consen 114 GCCLPPCCVPSCCPPTC----CQLHHAQASCCRPSC----CGQSCCRPVCCCSCCEP 162 (164)
T ss_pred CCcCCCeeecccCCCcc----ccccccccCccCccc----cCCCCCCcceeecccCC
Confidence 777777 333445555 654 22334444444 44444444444334444
No 2
>PF01500 Keratin_B2: Keratin, high sulfur B2 protein; InterPro: IPR002494 High sulphur proteins are cysteine-rich proteins synthesized during the differentiation of hair matrix cells, and form hair fibres in association with hair keratin intermediate filaments []. This family has been divided up into four regions, with the second region containing 8 copies of a short repeat []. This family is also known as B2 or KAP1.; GO: 0045095 keratin filament
Probab=99.14 E-value=1e-10 Score=95.76 Aligned_cols=56 Identities=34% Similarity=0.985 Sum_probs=37.0
Q ss_pred CCCceecCC-CCCCcc-CCCcccccccCCcCCccccCCccccccCCCcccccccCccccccc
Q psy3987 30 CGTAVCQSV-CGTAVC-QSVCGTAVCQSVCGTAVCQSVCGTAVCQSVCGTAVCQSVCGTAVC 89 (175)
Q Consensus 30 C~p~cc~s~-C~~scC-~~cC~p~cC~ssCc~~~C~~sCc~p~C~~~C~~~cC~p~Cc~~~C 89 (175)
++|+++++. |+|+++ .++++|.++++++++|.|++ ++++++ ++|+++|++++++.+
T Consensus 25 cQpsCc~~sCCqpsccqtscCrP~cc~ssCcrP~Cqp-ccqssC---cqPsCcqpScCqtgC 82 (164)
T PF01500_consen 25 CQPSCCQPSCCQPSCCQTSCCRPSCCVSSCCRPICQP-CCQSSC---CQPSCCQPSCCQTGC 82 (164)
T ss_pred ccCccCCCCccCCCccCCceeCCceecccccCccccc-ccCCcc---cCCcccccccccccc
Confidence 445545443 566666 44677888888888887766 666666 666666666666666
No 3
>KOG4726|consensus
Probab=96.65 E-value=0.011 Score=48.01 Aligned_cols=11 Identities=27% Similarity=1.041 Sum_probs=6.4
Q ss_pred CccceeecCCC
Q psy3987 101 VCGTAVCQSVC 111 (175)
Q Consensus 101 cC~p~cC~~tC 111 (175)
.+...++++++
T Consensus 78 ~c~~~~C~~~c 88 (146)
T KOG4726|consen 78 CCRCGCCRPSC 88 (146)
T ss_pred CCCCCccCCCc
Confidence 45555666655
No 4
>PF05287 PMG: PMG protein; InterPro: IPR007951 This family consists of several mouse anagen-specific protein mKAP13 (PMG1 and PMG2). PMG1 and 2 contain characteristic repeats reminiscent of the keratin-associated proteins (KAPs). Both genes are expressed in growing hair follicles in skin as well as in sebaceous and eccrine sweat glands. Interestingly, expression is also detected in the mammary epithelium where it is limited to the onset of the pubertal growth phase and is independent of ovarian hormones. Their broad, developmentally controlled expression pattern, together with their unique amino acid composition, demonstrate that pmg-1 and pmg-2 constitute a novel KAP gene family participating in the differentiation of all epithelial cells forming the epidermal appendages [].
Probab=81.54 E-value=8.6 Score=32.14 Aligned_cols=24 Identities=25% Similarity=0.574 Sum_probs=13.2
Q ss_pred CccccCCcC-ccceeeccccccccC
Q psy3987 140 TAVCQSVCG-TAVCQSVCGTAVCQS 163 (175)
Q Consensus 140 ~~~C~~~C~-~~~C~~~C~~~~C~~ 163 (175)
+..|+++.. ...+++++++|+|.+
T Consensus 154 s~~CrP~~~~s~s~q~~c~~P~C~s 178 (180)
T PF05287_consen 154 SSSCRPSYFSSRSCQPSCYQPSCGS 178 (180)
T ss_pred CCceecCccCcCCccCCccCCcccC
Confidence 334444443 445667777776654
No 5
>PF05287 PMG: PMG protein; InterPro: IPR007951 This family consists of several mouse anagen-specific protein mKAP13 (PMG1 and PMG2). PMG1 and 2 contain characteristic repeats reminiscent of the keratin-associated proteins (KAPs). Both genes are expressed in growing hair follicles in skin as well as in sebaceous and eccrine sweat glands. Interestingly, expression is also detected in the mammary epithelium where it is limited to the onset of the pubertal growth phase and is independent of ovarian hormones. Their broad, developmentally controlled expression pattern, together with their unique amino acid composition, demonstrate that pmg-1 and pmg-2 constitute a novel KAP gene family participating in the differentiation of all epithelial cells forming the epidermal appendages [].
Probab=72.52 E-value=12 Score=31.34 Aligned_cols=22 Identities=23% Similarity=0.634 Sum_probs=11.3
Q ss_pred ccceeeccccc-cccCCcCCcee
Q psy3987 149 TAVCQSVCGTA-VCQSVCGTAVC 170 (175)
Q Consensus 149 ~~~C~~~C~~~-~C~~~Cc~~~C 170 (175)
+..||++.+.. .+++.+.+|.|
T Consensus 154 s~~CrP~~~~s~s~q~~c~~P~C 176 (180)
T PF05287_consen 154 SSSCRPSYFSSRSCQPSCYQPSC 176 (180)
T ss_pred CCceecCccCcCCccCCccCCcc
Confidence 33466665543 45555555544
No 6
>PF13165 DUF4001: Protein of unknown function (DUF4001)
Probab=5.63 E-value=1.3e+02 Score=20.38 Aligned_cols=11 Identities=45% Similarity=0.912 Sum_probs=5.4
Q ss_pred ccccCCCcccc
Q psy3987 68 TAVCQSVCGTA 78 (175)
Q Consensus 68 ~p~C~~~C~~~ 78 (175)
+.+||++|+++
T Consensus 24 qtSCQSACKTS 34 (44)
T PF13165_consen 24 QTSCQSACKTS 34 (44)
T ss_pred hhHHHHHHhcc
Confidence 44555555444
No 7
>KOG0006|consensus
Probab=0.40 E-value=5.1e+03 Score=18.11 Aligned_cols=9 Identities=56% Similarity=1.176 Sum_probs=0.0
Q ss_pred CceeecCCC
Q psy3987 167 TAVCHVPTD 175 (175)
Q Consensus 167 ~~~C~~~~~ 175 (175)
.|+|||||.
T Consensus 400 CPkChvptE 408 (446)
T KOG0006|consen 400 CPKCHVPTE 408 (446)
T ss_pred CCCccCccc
No 8
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=0.40 E-value=4.6e+03 Score=13.74 Aligned_cols=8 Identities=50% Similarity=1.203 Sum_probs=0.0
Q ss_pred CceeecCC
Q psy3987 167 TAVCHVPT 174 (175)
Q Consensus 167 ~~~C~~~~ 174 (175)
.|+||.|.
T Consensus 43 CPvC~~Pa 50 (65)
T PF14835_consen 43 CPVCHTPA 50 (65)
T ss_dssp -SSS--B-
T ss_pred CCCcCChH
No 9
>PF04579 Keratin_matx: Keratin, high-sulphur matrix protein; InterPro: IPR007659 This is a family of keratins, high-sulphur matrix proteins. The keratin products of mammalian epidermal derivatives such as wool and hair consist of microfibrils embedded in a rigid matrix of other proteins. The matrix proteins include the high-sulphur and high-tyrosine keratins, having molecular weights of 6-20 kDa, whereas microfibrils contain the larger, low-sulphur keratins (40-56 kDa) [].; GO: 0005198 structural molecule activity, 0045095 keratin filament
Probab=0.32 E-value=1.2e+04 Score=12.34 Aligned_cols=29 Identities=17% Similarity=0.435 Sum_probs=0.0
Q ss_pred ccccCCCcccccccCcccccccc--CCCCCc
Q psy3987 68 TAVCQSVCGTAVCQSVCGTAVCQ--SVCGTA 96 (175)
Q Consensus 68 ~p~C~~~C~~~cC~p~Cc~~~C~--s~C~~s 96 (175)
+|.+.-.+-|.++.|.=+.++|+ +++.|.
T Consensus 43 qptcCD~cppPC~~P~~yVptc~LLns~~Pt 73 (97)
T PF04579_consen 43 QPTCCDNCPPPCCIPDPYVPTCWLLNSCHPT 73 (97)
T ss_pred ccccccCCCCCcccCCcccCcEEEeccCCCC
No 10
>PF02048 Enterotoxin_ST: Heat-stable enterotoxin ST; InterPro: IPR001489 This entry represents a group of heat-stable enterotoxins, such as STa from Escherichia coli, which is the cause of acute diarrhoea in infants and travellers in developing countries. The mature STa protein is a 19-residue peptide containing three disulphide bridges that are functionally important. STa contains an N-terminal signal peptide composed of two domains, Pre and Pro, involved in extracellular toxin release, and a core enterotoxigenic domain []. STa binds to and activates the guanylate cyclise C intestinal receptor, causing an increase in the intracellular levels of cyclic guanosine monophosphate (cGMP) [, , ].; GO: 0009405 pathogenesis, 0005576 extracellular region; PDB: 1ETN_A 1ETL_A 1ETM_A.
Probab=0.31 E-value=7.5e+03 Score=12.30 Aligned_cols=10 Identities=30% Similarity=0.886 Sum_probs=0.0
Q ss_pred ccCCCccccc
Q psy3987 43 VCQSVCGTAV 52 (175)
Q Consensus 43 cC~~cC~p~c 52 (175)
||+-||-|+|
T Consensus 42 CCEvCCNPAC 51 (54)
T PF02048_consen 42 CCEVCCNPAC 51 (54)
T ss_dssp --TT--STTS
T ss_pred HHHhhcCccc
Done!