Query         psy3987
Match_columns 175
No_of_seqs    81 out of 83
Neff          3.7 
Searched_HMMs 46136
Date          Fri Aug 16 22:22:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy3987.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/3987hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01500 Keratin_B2:  Keratin,   99.4 4.7E-13   1E-17  109.3   7.5  114   47-168    34-162 (164)
  2 PF01500 Keratin_B2:  Keratin,   99.1   1E-10 2.2E-15   95.8   7.0   56   30-89     25-82  (164)
  3 KOG4726|consensus               96.6   0.011 2.4E-07   48.0   8.0   11  101-111    78-88  (146)
  4 PF05287 PMG:  PMG protein;  In  81.5     8.6 0.00019   32.1   7.5   24  140-163   154-178 (180)
  5 PF05287 PMG:  PMG protein;  In  72.5      12 0.00025   31.3   5.9   22  149-170   154-176 (180)
  6 PF13165 DUF4001:  Protein of u   5.6 1.3E+02  0.0028   20.4  -0.9   11   68-78     24-34  (44)
  7 KOG0006|consensus                0.4 5.1E+03    0.11   18.1   0.4    9  167-175   400-408 (446)
  8 PF14835 zf-RING_6:  zf-RING of   0.4 4.6E+03     0.1   13.7   0.0    8  167-174    43-50  (65)
  9 PF04579 Keratin_matx:  Keratin   0.3 1.2E+04    0.26   12.3   1.9   29   68-96     43-73  (97)
 10 PF02048 Enterotoxin_ST:  Heat-   0.3 7.5E+03    0.16   12.3   0.5   10   43-52     42-51  (54)

No 1  
>PF01500 Keratin_B2:  Keratin, high sulfur B2 protein;  InterPro: IPR002494 High sulphur proteins are cysteine-rich proteins synthesized during the differentiation of hair matrix cells, and form hair fibres in association with hair keratin intermediate filaments []. This family has been divided up into four regions, with the second region containing 8 copies of a short repeat []. This family is also known as B2 or KAP1.; GO: 0045095 keratin filament
Probab=99.42  E-value=4.7e-13  Score=109.31  Aligned_cols=114  Identities=29%  Similarity=0.806  Sum_probs=65.5

Q ss_pred             CcccccccCCcCCcc-ccCCccccccCCCcccccccCcccccccc-CCC----C------CcccccCccceeecCCCCCc
Q psy3987          47 VCGTAVCQSVCGTAV-CQSVCGTAVCQSVCGTAVCQSVCGTAVCQ-SVC----G------TAVCQSVCGTAVCQSVCGTA  114 (175)
Q Consensus        47 cC~p~cC~ssCc~~~-C~~sCc~p~C~~~C~~~cC~p~Cc~~~C~-s~C----~------~sCCqscC~p~cC~~tC~~p  114 (175)
                      +++|+++++++++|+ +++++++|.||+.++++++||+|++++++ +.+    +      .....-.++++|||++++.+
T Consensus        34 CCqpsccqtscCrP~cc~ssCcrP~CqpccqssCcqPsCcqpScCqtgCgi~~~~~~g~~~~~g~vs~r~r~CRP~cc~~  113 (164)
T PF01500_consen   34 CCQPSCCQTSCCRPSCCVSSCCRPICQPCCQSSCCQPSCCQPSCCQTGCGIGGGIGYGQEGGSGAVSCRTRWCRPDCCVP  113 (164)
T ss_pred             ccCCCccCCceeCCceecccccCcccccccCCcccCCccccccccccccccCCccccccccCcccccccceeeCCCcccc
Confidence            455666666666665 45677777766656666666666666543 333    1      11222358999999999888


Q ss_pred             -ccccCc-CCcccccCcCCCCCCC-CcCCccccCCcCccceeeccccccccCCcCCc
Q psy3987         115 -VCQSVC-GTAVCQSVCGTAVCQS-VCGTAVCQSVCGTAVCQSVCGTAVCQSVCGTA  168 (175)
Q Consensus       115 -~C~~~C-~~~~C~ssC~~~vC~~-cC~~~~C~~~C~~~~C~~~C~~~~C~~~Cc~~  168 (175)
                       .++|.+ ++....++|    ||+ ..+.++||+.+    +.+.++||++.-.+.+|
T Consensus       114 ~~c~p~cC~~sC~~ptC----Cq~~~~qasCCRPs~----C~~scCRp~Cc~~c~~p  162 (164)
T PF01500_consen  114 GCCLPPCCVPSCCPPTC----CQLHHAQASCCRPSC----CGQSCCRPVCCCSCCEP  162 (164)
T ss_pred             CCcCCCeeecccCCCcc----ccccccccCccCccc----cCCCCCCcceeecccCC
Confidence             777777 333445555    654 22334444444    44444444444334444


No 2  
>PF01500 Keratin_B2:  Keratin, high sulfur B2 protein;  InterPro: IPR002494 High sulphur proteins are cysteine-rich proteins synthesized during the differentiation of hair matrix cells, and form hair fibres in association with hair keratin intermediate filaments []. This family has been divided up into four regions, with the second region containing 8 copies of a short repeat []. This family is also known as B2 or KAP1.; GO: 0045095 keratin filament
Probab=99.14  E-value=1e-10  Score=95.76  Aligned_cols=56  Identities=34%  Similarity=0.985  Sum_probs=37.0

Q ss_pred             CCCceecCC-CCCCcc-CCCcccccccCCcCCccccCCccccccCCCcccccccCccccccc
Q psy3987          30 CGTAVCQSV-CGTAVC-QSVCGTAVCQSVCGTAVCQSVCGTAVCQSVCGTAVCQSVCGTAVC   89 (175)
Q Consensus        30 C~p~cc~s~-C~~scC-~~cC~p~cC~ssCc~~~C~~sCc~p~C~~~C~~~cC~p~Cc~~~C   89 (175)
                      ++|+++++. |+|+++ .++++|.++++++++|.|++ ++++++   ++|+++|++++++.+
T Consensus        25 cQpsCc~~sCCqpsccqtscCrP~cc~ssCcrP~Cqp-ccqssC---cqPsCcqpScCqtgC   82 (164)
T PF01500_consen   25 CQPSCCQPSCCQPSCCQTSCCRPSCCVSSCCRPICQP-CCQSSC---CQPSCCQPSCCQTGC   82 (164)
T ss_pred             ccCccCCCCccCCCccCCceeCCceecccccCccccc-ccCCcc---cCCcccccccccccc
Confidence            445545443 566666 44677888888888887766 666666   666666666666666


No 3  
>KOG4726|consensus
Probab=96.65  E-value=0.011  Score=48.01  Aligned_cols=11  Identities=27%  Similarity=1.041  Sum_probs=6.4

Q ss_pred             CccceeecCCC
Q psy3987         101 VCGTAVCQSVC  111 (175)
Q Consensus       101 cC~p~cC~~tC  111 (175)
                      .+...++++++
T Consensus        78 ~c~~~~C~~~c   88 (146)
T KOG4726|consen   78 CCRCGCCRPSC   88 (146)
T ss_pred             CCCCCccCCCc
Confidence            45555666655


No 4  
>PF05287 PMG:  PMG protein;  InterPro: IPR007951 This family consists of several mouse anagen-specific protein mKAP13 (PMG1 and PMG2). PMG1 and 2 contain characteristic repeats reminiscent of the keratin-associated proteins (KAPs). Both genes are expressed in growing hair follicles in skin as well as in sebaceous and eccrine sweat glands. Interestingly, expression is also detected in the mammary epithelium where it is limited to the onset of the pubertal growth phase and is independent of ovarian hormones. Their broad, developmentally controlled expression pattern, together with their unique amino acid composition, demonstrate that pmg-1 and pmg-2 constitute a novel KAP gene family participating in the differentiation of all epithelial cells forming the epidermal appendages [].
Probab=81.54  E-value=8.6  Score=32.14  Aligned_cols=24  Identities=25%  Similarity=0.574  Sum_probs=13.2

Q ss_pred             CccccCCcC-ccceeeccccccccC
Q psy3987         140 TAVCQSVCG-TAVCQSVCGTAVCQS  163 (175)
Q Consensus       140 ~~~C~~~C~-~~~C~~~C~~~~C~~  163 (175)
                      +..|+++.. ...+++++++|+|.+
T Consensus       154 s~~CrP~~~~s~s~q~~c~~P~C~s  178 (180)
T PF05287_consen  154 SSSCRPSYFSSRSCQPSCYQPSCGS  178 (180)
T ss_pred             CCceecCccCcCCccCCccCCcccC
Confidence            334444443 445667777776654


No 5  
>PF05287 PMG:  PMG protein;  InterPro: IPR007951 This family consists of several mouse anagen-specific protein mKAP13 (PMG1 and PMG2). PMG1 and 2 contain characteristic repeats reminiscent of the keratin-associated proteins (KAPs). Both genes are expressed in growing hair follicles in skin as well as in sebaceous and eccrine sweat glands. Interestingly, expression is also detected in the mammary epithelium where it is limited to the onset of the pubertal growth phase and is independent of ovarian hormones. Their broad, developmentally controlled expression pattern, together with their unique amino acid composition, demonstrate that pmg-1 and pmg-2 constitute a novel KAP gene family participating in the differentiation of all epithelial cells forming the epidermal appendages [].
Probab=72.52  E-value=12  Score=31.34  Aligned_cols=22  Identities=23%  Similarity=0.634  Sum_probs=11.3

Q ss_pred             ccceeeccccc-cccCCcCCcee
Q psy3987         149 TAVCQSVCGTA-VCQSVCGTAVC  170 (175)
Q Consensus       149 ~~~C~~~C~~~-~C~~~Cc~~~C  170 (175)
                      +..||++.+.. .+++.+.+|.|
T Consensus       154 s~~CrP~~~~s~s~q~~c~~P~C  176 (180)
T PF05287_consen  154 SSSCRPSYFSSRSCQPSCYQPSC  176 (180)
T ss_pred             CCceecCccCcCCccCCccCCcc
Confidence            33466665543 45555555544


No 6  
>PF13165 DUF4001:  Protein of unknown function (DUF4001)
Probab=5.63  E-value=1.3e+02  Score=20.38  Aligned_cols=11  Identities=45%  Similarity=0.912  Sum_probs=5.4

Q ss_pred             ccccCCCcccc
Q psy3987          68 TAVCQSVCGTA   78 (175)
Q Consensus        68 ~p~C~~~C~~~   78 (175)
                      +.+||++|+++
T Consensus        24 qtSCQSACKTS   34 (44)
T PF13165_consen   24 QTSCQSACKTS   34 (44)
T ss_pred             hhHHHHHHhcc
Confidence            44555555444


No 7  
>KOG0006|consensus
Probab=0.40  E-value=5.1e+03  Score=18.11  Aligned_cols=9  Identities=56%  Similarity=1.176  Sum_probs=0.0

Q ss_pred             CceeecCCC
Q psy3987         167 TAVCHVPTD  175 (175)
Q Consensus       167 ~~~C~~~~~  175 (175)
                      .|+|||||.
T Consensus       400 CPkChvptE  408 (446)
T KOG0006|consen  400 CPKCHVPTE  408 (446)
T ss_pred             CCCccCccc


No 8  
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=0.40  E-value=4.6e+03  Score=13.74  Aligned_cols=8  Identities=50%  Similarity=1.203  Sum_probs=0.0

Q ss_pred             CceeecCC
Q psy3987         167 TAVCHVPT  174 (175)
Q Consensus       167 ~~~C~~~~  174 (175)
                      .|+||.|.
T Consensus        43 CPvC~~Pa   50 (65)
T PF14835_consen   43 CPVCHTPA   50 (65)
T ss_dssp             -SSS--B-
T ss_pred             CCCcCChH


No 9  
>PF04579 Keratin_matx:  Keratin, high-sulphur matrix protein;  InterPro: IPR007659 This is a family of keratins, high-sulphur matrix proteins. The keratin products of mammalian epidermal derivatives such as wool and hair consist of microfibrils embedded in a rigid matrix of other proteins. The matrix proteins include the high-sulphur and high-tyrosine keratins, having molecular weights of 6-20 kDa, whereas microfibrils contain the larger, low-sulphur keratins (40-56 kDa) [].; GO: 0005198 structural molecule activity, 0045095 keratin filament
Probab=0.32  E-value=1.2e+04  Score=12.34  Aligned_cols=29  Identities=17%  Similarity=0.435  Sum_probs=0.0

Q ss_pred             ccccCCCcccccccCcccccccc--CCCCCc
Q psy3987          68 TAVCQSVCGTAVCQSVCGTAVCQ--SVCGTA   96 (175)
Q Consensus        68 ~p~C~~~C~~~cC~p~Cc~~~C~--s~C~~s   96 (175)
                      +|.+.-.+-|.++.|.=+.++|+  +++.|.
T Consensus        43 qptcCD~cppPC~~P~~yVptc~LLns~~Pt   73 (97)
T PF04579_consen   43 QPTCCDNCPPPCCIPDPYVPTCWLLNSCHPT   73 (97)
T ss_pred             ccccccCCCCCcccCCcccCcEEEeccCCCC


No 10 
>PF02048 Enterotoxin_ST:  Heat-stable enterotoxin ST;  InterPro: IPR001489 This entry represents a group of heat-stable enterotoxins, such as STa from Escherichia coli, which is the cause of acute diarrhoea in infants and travellers in developing countries. The mature STa protein is a 19-residue peptide containing three disulphide bridges that are functionally important. STa contains an N-terminal signal peptide composed of two domains, Pre and Pro, involved in extracellular toxin release, and a core enterotoxigenic domain []. STa binds to and activates the guanylate cyclise C intestinal receptor, causing an increase in the intracellular levels of cyclic guanosine monophosphate (cGMP) [, , ].; GO: 0009405 pathogenesis, 0005576 extracellular region; PDB: 1ETN_A 1ETL_A 1ETM_A.
Probab=0.31  E-value=7.5e+03  Score=12.30  Aligned_cols=10  Identities=30%  Similarity=0.886  Sum_probs=0.0

Q ss_pred             ccCCCccccc
Q psy3987          43 VCQSVCGTAV   52 (175)
Q Consensus        43 cC~~cC~p~c   52 (175)
                      ||+-||-|+|
T Consensus        42 CCEvCCNPAC   51 (54)
T PF02048_consen   42 CCEVCCNPAC   51 (54)
T ss_dssp             --TT--STTS
T ss_pred             HHHhhcCccc


Done!