Diaphorina citri psyllid: psy3997


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MKFSHSKVKSNIISWNRVVLLHGPPGTGKTSLCKAVAQKLSIRLQSKYKITEFIEINSHSLFSKYFSESGKLVQKMFNKIKEAVEYEESLVCLLIDEIESLTRARESVMSGTEPSDGVRVVNAVLTQIDQLKKKSTGLSGRTLRKIPFLTFVKYISNNSVSMENFLIALEKTVLDLLVEEKSLPLKRNTEVPNTYLHSNQRIHIYLMFCGTSYPLQHSKHFTELVQSHPGRCKVTSDDSTLNFSFSSLAVQHCIPL
cccccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHcccccccccccHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHccccccccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccc
*KFSHSKVKSNIISWNRVVLLHGPPGTGKTSLCKAVAQKLSIRLQSKYKITEFIEINSHSLFSKYFSESGKLVQKMFNKIKEAVEYEESLVCLLIDEIESLT***************VRVVNAVLTQIDQLKKKSTGLSGRTLRKIPFLTFVKYISNNSVSMENFLIALEKTVLDLLVEEKSLPLKRNTEVPNTYLHSNQRIHIYLMFCGTSYPLQHSKHFTELVQSHPGRCKVTSDDSTLNFSFSSLAVQHCIP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFSHSKVKSNIISWNRVVLLHGPPGTGKTSLCKAVAQKLSIRLQSKYKITEFIEINSHSLFSKYFSESGKLVQKMFNKIKEAVEYEESLVCLLIDEIESLTRARESVMSGTEPSDGVRVVNAVLTQIDQLKKKSTGLSGRTLRKIPFLTFVKYISNNSVSMENFLIALEKTVLDLLVEEKSLPLKRNTEVPNTYLHSNQRIHIYLMFCGTSYPLQHSKHFTELVQSHPGRCKVTSDDSTLNFSFSSLAVQHCIPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pachytene checkpoint protein 2 homolog Plays a key role in chromosome recombination and chromosome structure development during meiosis. Required at early steps in meiotic recombination that leads to non-crossovers pathways. Also needed for efficient completion of homologous synapsis by influencing crossover distribution along the chromosomes affecting both crossovers and non-crossovers pathways.confidentE1C6Q1
Putative pachytene checkpoint protein 2 Plays a key role in chromosome recombination during meiosis.confidentQ09535
Pachytene checkpoint protein 2 homolog Plays a key role in chromosome recombination and chromosome structure development during meiosis. Required at early steps in meiotic recombination that leads to non-crossovers pathways. Also needed for efficient completion of homologous synapsis by influencing crossover distribution along the chromosomes affecting both crossovers and non-crossovers pathways.confidentQ6PH52

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022624 [CC]proteasome accessory complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0000502
GO:0044427 [CC]chromosomal partprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226, GO:0044422
GO:0010259 [BP]multicellular organismal agingprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0007569 [BP]cell agingprobableGO:0032502, GO:0007568, GO:0009987, GO:0044767, GO:0044763, GO:0008150, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0022607 [BP]cellular component assemblyprobableGO:0044085, GO:0008150, GO:0071840, GO:0016043
GO:0001673 [CC]male germ cell nucleusprobableGO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043073, GO:0044424, GO:0043227, GO:0043226
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0019222 [BP]regulation of metabolic processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0090304 [BP]nucleic acid metabolic processprobableGO:0006139, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0071822 [BP]protein complex subunit organizationprobableGO:0043933, GO:0008150, GO:0071840, GO:0016043
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain I
Confidence level:very confident
Coverage over the Query: 9-150,162-187,198-230,243-248
View the alignment between query and template
View the model in PyMOL
Template: 2V1U, chain A
Confidence level:confident
Coverage over the Query: 14-105,116-131,146-187,198-233
View the alignment between query and template
View the model in PyMOL