Query         psy4
Match_columns 150
No_of_seqs    177 out of 405
Neff          5.0 
Searched_HMMs 46136
Date          Fri Aug 16 22:46:41 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4090|consensus              100.0 2.4E-33 5.3E-38  218.3  10.3   95   53-150    42-137 (157)
  2 KOG4090|consensus               99.5 8.3E-15 1.8E-19  114.7   6.1   90   50-148    52-155 (157)
  3 PF09849 DUF2076:  Uncharacteri  96.5   0.019 4.1E-07   48.4   8.6   30   65-94    133-162 (247)
  4 PF06747 CHCH:  CHCH domain;  I  91.4    0.24 5.2E-06   28.9   2.7   18  132-149     1-19  (35)
  5 COG3416 Uncharacterized protei  86.4     2.5 5.5E-05   35.4   6.3   33   62-94    131-163 (233)
  6 PF09849 DUF2076:  Uncharacteri  77.3     6.8 0.00015   33.1   5.7   32   71-102   135-166 (247)
  7 PF05537 DUF759:  Borrelia burg  68.7     2.1 4.4E-05   38.9   0.7   29   62-97    127-155 (431)
  8 cd08177 MAR Maleylacetate redu  37.7      26 0.00056   30.0   2.3   24   75-98    215-241 (337)
  9 PF01431 Peptidase_M13:  Peptid  35.8      20 0.00043   28.0   1.2   15   82-96     36-50  (206)
 10 PRK09860 putative alcohol dehy  35.7      28  0.0006   30.5   2.2   25   74-98    246-273 (383)
 11 KOG4618|consensus               34.8      37 0.00081   23.9   2.3   21  128-148    20-41  (74)
 12 COG3134 Predicted outer membra  33.3      16 0.00035   29.3   0.4   19   73-91     71-89  (179)
 13 COG4395 Uncharacterized protei  32.8      55  0.0012   28.4   3.5    9   67-75     30-38  (281)
 14 COG3590 PepO Predicted metallo  32.0      19  0.0004   34.4   0.6   15   82-96    487-501 (654)
 15 COG1454 EutG Alcohol dehydroge  31.4      39 0.00084   30.2   2.4   26   73-98    243-271 (377)
 16 cd08182 HEPD Hydroxyethylphosp  29.6      44 0.00095   28.8   2.4   15   84-98    252-266 (367)
 17 KOG1924|consensus               28.8 1.4E+02  0.0029   30.2   5.7    8   64-71    598-605 (1102)
 18 KOG4695|consensus               28.5      35 0.00075   26.1   1.4   16  129-144    66-81  (122)
 19 cd08176 LPO Lactadehyde:propan  28.1      43 0.00093   29.1   2.1   24   75-98    244-270 (377)
 20 KOG4114|consensus               27.9      42 0.00092   23.5   1.6   14  131-144    44-57  (73)
 21 TIGR02638 lactal_redase lactal  27.5      49  0.0011   28.8   2.4   24   75-98    247-273 (379)
 22 cd08191 HHD 6-hydroxyhexanoate  27.3      47   0.001   28.9   2.2   24   75-98    253-279 (386)
 23 cd08185 Fe-ADH1 Iron-containin  26.9      40 0.00087   29.2   1.7   25   74-98    246-273 (380)
 24 cd08183 Fe-ADH2 Iron-containin  26.6      53  0.0012   28.4   2.4   24   75-98    238-264 (374)
 25 cd08193 HVD 5-hydroxyvalerate   26.2      52  0.0011   28.5   2.3   24   75-98    242-268 (376)
 26 cd08189 Fe-ADH5 Iron-containin  25.7      52  0.0011   28.5   2.2   24   75-98    243-269 (374)
 27 cd08551 Fe-ADH iron-containing  25.5      53  0.0012   28.2   2.2   23   76-98    240-265 (370)
 28 cd08182 HEPD Hydroxyethylphosp  25.3      48   0.001   28.5   1.9   25   68-92    240-264 (367)
 29 KOG3477|consensus               25.1      63  0.0014   23.7   2.2   17  128-144    26-42  (97)
 30 PRK10624 L-1,2-propanediol oxi  25.0      52  0.0011   28.6   2.1   24   75-98    246-272 (382)
 31 cd08186 Fe-ADH8 Iron-containin  24.7      58  0.0012   28.4   2.3   24   74-97    243-269 (383)
 32 cd08188 Fe-ADH4 Iron-containin  24.5      58  0.0012   28.3   2.2   13   86-98    258-270 (377)
 33 cd08178 AAD_C C-terminal alcoh  24.4      54  0.0012   28.7   2.1   24   75-98    248-274 (398)
 34 PF05051 COX17:  Cytochrome C o  24.3      72  0.0016   20.8   2.1   17  130-146    29-45  (49)
 35 cd08184 Fe-ADH3 Iron-containin  24.2      40 0.00086   29.3   1.2   25   74-98    235-262 (347)
 36 PF06897 DUF1269:  Protein of u  23.6      53  0.0011   24.0   1.6   16   75-90     21-36  (102)
 37 PF10200 Ndufs5:  NADH:ubiquino  23.3      90   0.002   22.9   2.7   19  130-148    31-49  (96)
 38 cd08179 NADPH_BDH NADPH-depend  22.9      71  0.0015   27.7   2.5   24   75-98    242-268 (375)
 39 PF08583 Cmc1:  Cytochrome c ox  22.7      67  0.0014   20.8   1.8   16  130-145    11-26  (69)
 40 KOG4138|consensus               22.6      77  0.0017   23.3   2.2   21  128-148    59-80  (96)
 41 cd08192 Fe-ADH7 Iron-containin  21.9      64  0.0014   27.8   2.0   24   75-98    244-269 (370)
 42 KOG4175|consensus               21.9      40 0.00087   28.6   0.7   25   67-91    219-243 (268)
 43 cd08191 HHD 6-hydroxyhexanoate  21.7      60  0.0013   28.3   1.8   25   68-92    253-277 (386)
 44 PRK15138 aldehyde reductase; P  21.4      58  0.0013   28.6   1.7   25   74-98    247-277 (387)
 45 PRK09430 djlA Dna-J like membr  21.0      83  0.0018   26.5   2.5   17  127-143    68-84  (267)
 46 cd08181 PPD-like 1,3-propanedi  20.7      68  0.0015   27.6   1.9   24   75-98    241-267 (357)
 47 KOG4110|consensus               20.6      68  0.0015   24.5   1.6   15  130-144    57-71  (120)
 48 PF03035 RNA_capsid:  Calicivir  20.6      72  0.0016   26.9   2.0   20   68-87      4-23  (226)
 49 COG1454 EutG Alcohol dehydroge  20.5      59  0.0013   29.1   1.5   27   68-94    245-271 (377)

No 1  
>KOG4090|consensus
Probab=100.00  E-value=2.4e-33  Score=218.30  Aligned_cols=95  Identities=52%  Similarity=0.710  Sum_probs=74.0

Q ss_pred             CCCCCCCCCCCCCCChhHHHHHHhhhhhhhhhhHhhhhhhccccCCCCCCCCCCCCCCCCCCCccccccccccCCCCCCc
Q psy4             53 QPTMPAPMAAPQQGPGLMAQMAATAGGVAIGSAVGHTIGHAVTGMFSGSDSKEAAPAAPAAPAPAYQQGSQSAAEPTGAC  132 (150)
Q Consensus        53 ~p~~~~~~a~~~~gpGl~~qmAstAaGvAvGsaVgH~ig~aitg~fsg~s~~~~~~~~q~~~~~~~~~~~q~~q~~~~~C  132 (150)
                      +|+..+.....+.+||||.|||+|++||+|||+|||+||++|||+|+|++++|++.++  ++|++++...+. .+++++|
T Consensus        42 ~Ps~~G~~~~~p~qPgl~aqMAtTaaGvavGsaVGHt~G~~iTg~Fsg~~~~ea~~~~--~~~~~p~g~~q~-~q~~~~C  118 (157)
T KOG4090|consen   42 APSAGGSPAFAPRQPGLMAQMATTAAGVAVGSAVGHTMGPAITGGFSGGSSHEAAVPD--ITYQAPAGSTQP-AQQQQPC  118 (157)
T ss_pred             CCCCCCCCCCCCCccHHHHHHHhhccchhccccccccccccccccccCCCCCCCCCcc--ccccccccccch-hhhcCch
Confidence            3444333333444599999999999999999999999999999999999888887776  455554432121 3456899


Q ss_pred             HHHHHHHHHHHHhc-CCCC
Q psy4            133 AWEIKQFLQCANTQ-SDLS  150 (150)
Q Consensus       133 ~~~~kqF~~C~~n~-~Di~  150 (150)
                      +||+|+|+||++|+ +||+
T Consensus       119 ~~e~kqF~dCa~~~~~d~s  137 (157)
T KOG4090|consen  119 FIEIKQFLDCAQNQGSDIS  137 (157)
T ss_pred             HHHHHHHHHHHHhcCcchH
Confidence            99999999999997 8985


No 2  
>KOG4090|consensus
Probab=99.54  E-value=8.3e-15  Score=114.66  Aligned_cols=90  Identities=22%  Similarity=0.246  Sum_probs=63.1

Q ss_pred             CCCCCCCCCCCCCCCCCChhHHHHHHhhhhhhhhhhHhhhhhhccccCCCCCCCCCCCCCCCCCCCcccccccccc----
Q psy4             50 VQAQPTMPAPMAAPQQGPGLMAQMAATAGGVAIGSAVGHTIGHAVTGMFSGSDSKEAAPAAPAAPAPAYQQGSQSA----  125 (150)
Q Consensus        50 ~~~~p~~~~~~a~~~~gpGl~~qmAstAaGvAvGsaVgH~ig~aitg~fsg~s~~~~~~~~q~~~~~~~~~~~q~~----  125 (150)
                      .+.+|++|++|+.+..|         +++|++|||+|||.|+++|+|+++.+...+....++.+..+...+.++.|    
T Consensus        52 ~p~qPgl~aqMAtTaaG---------vavGsaVGHt~G~~iTg~Fsg~~~~ea~~~~~~~~~p~g~~q~~q~~~~C~~e~  122 (157)
T KOG4090|consen   52 APRQPGLMAQMATTAAG---------VAVGSAVGHTMGPAITGGFSGGSSHEAAVPDITYQAPAGSTQPAQQQQPCFIEI  122 (157)
T ss_pred             CCCccHHHHHHHhhccc---------hhccccccccccccccccccCCCCCCCCCccccccccccccchhhhcCchHHHH
Confidence            33447887777777666         99999999999999999999999887665444433222111222222223    


Q ss_pred             ---------C-CCCCCcHHHHHHHHHHHHhcCC
Q psy4            126 ---------A-EPTGACAWEIKQFLQCANTQSD  148 (150)
Q Consensus       126 ---------q-~~~~~C~~~~kqF~~C~~n~~D  148 (150)
                               + .++..|+||+++|++|.++.+.
T Consensus       123 kqF~dCa~~~~~d~slC~~f~e~Lk~Ck~~~~~  155 (157)
T KOG4090|consen  123 KQFLDCAQNQGSDISLCEGYNEMLKQCKKNSGL  155 (157)
T ss_pred             HHHHHHHHhcCcchHHHHHHHHHHHHHHHHhcc
Confidence                     2 4678899999999999997643


No 3  
>PF09849 DUF2076:  Uncharacterized protein conserved in bacteria (DUF2076);  InterPro: IPR018648  This family of hypothetical prokaryotic proteins has no known function but includes putative perimplasmic ligand-binding sensor proteins.
Probab=96.48  E-value=0.019  Score=48.38  Aligned_cols=30  Identities=30%  Similarity=0.341  Sum_probs=25.4

Q ss_pred             CCChhHHHHHHhhhhhhhhhhHhhhhhhcc
Q psy4             65 QGPGLMAQMAATAGGVAIGSAVGHTIGHAV   94 (150)
Q Consensus        65 ~gpGl~~qmAstAaGvAvGsaVgH~ig~ai   94 (150)
                      +++|+|++++.||+|||-|..|+..|.++|
T Consensus       133 ~~ggFLg~A~~TAAGVAGG~lL~n~i~~lF  162 (247)
T PF09849_consen  133 APGGFLGGAAQTAAGVAGGMLLANGIESLF  162 (247)
T ss_pred             CcccHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            558999999999999999998888666544


No 4  
>PF06747 CHCH:  CHCH domain;  InterPro: IPR010625 A conserved motif was identified in the LOC118487 protein was called the CHCH motif. Alignment of this protein with related members showed the presence of three subgroups of proteins, which are called the S (Small), N (N-terminal extended) and C (C-terminal extended) subgroups. All three sub-groups of proteins have in common that they contain a predicted conserved [coiled coil 1]-[helix 1]-[coiled coil 2]-[helix 2] domain (CHCH domain). Within each helix of the CHCH domain, there are two cysteines present in a C-X9-C motif. The N-group contains an additional double helix domain, and each helix contains the C-X9-C motif. This family contains a number of characterised proteins: Cox19 protein - a nuclear gene of Saccharomyces cerevisiae, codes for an 11 kDa protein (Cox19p) required for expression of cytochrome oxidase. Because cox19 mutants are able to synthesise the mitochondrial and nuclear gene products of cytochrome oxidase, Cox19p probably functions post-translationally during assembly of the enzyme. Cox19p is present in the cytoplasm and mitochondria, where it exists as a soluble intermembrane protein. This dual location is similar to what was previously reported for Cox17p, a low molecular weight copper protein thought to be required for maturation of the CuA centre of subunit 2 of cytochrome oxidase. Cox19p have four conserved potential metal ligands, these are three cysteines and one histidine. Mrp10 - belongs to the class of yeast mitochondrial ribosomal proteins that are essential for translation []. Eukaryotic NADH-ubiquinone oxidoreductase 19 kDa (NDUFA8) subunit []. The CHCH domain was previously called DUF657 [].  ; PDB: 2ZXT_A 3A3C_A 2L0Y_A 2K3J_A.
Probab=91.39  E-value=0.24  Score=28.90  Aligned_cols=18  Identities=39%  Similarity=0.750  Sum_probs=14.1

Q ss_pred             cHHHHHHHHHHHHh-cCCC
Q psy4            132 CAWEIKQFLQCANT-QSDL  149 (150)
Q Consensus       132 C~~~~kqF~~C~~n-~~Di  149 (150)
                      |..++++|++|++. ++|+
T Consensus         1 C~~e~~~~~~Cl~~n~~~~   19 (35)
T PF06747_consen    1 CAEEMKAYLACLKENNFDW   19 (35)
T ss_dssp             THHHHHHHHHHHHCH-SST
T ss_pred             CHHHHHHHHHHHHHCCCcH
Confidence            88999999999984 4544


No 5  
>COG3416 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=86.38  E-value=2.5  Score=35.42  Aligned_cols=33  Identities=21%  Similarity=0.265  Sum_probs=26.2

Q ss_pred             CCCCCChhHHHHHHhhhhhhhhhhHhhhhhhcc
Q psy4             62 APQQGPGLMAQMAATAGGVAIGSAVGHTIGHAV   94 (150)
Q Consensus        62 ~~~~gpGl~~qmAstAaGvAvGsaVgH~ig~ai   94 (150)
                      ....+.|.+++.+.||+|||=|-.|+..|.+.|
T Consensus       131 ~~~r~ssFLG~AlqTAAGVAGGMlL~n~L~~mF  163 (233)
T COG3416         131 ANTRSSSFLGGALQTAAGVAGGMLLANGLEGMF  163 (233)
T ss_pred             cccccchhHHHHHHHHhhhhhhHHHHHHHHHHh
Confidence            345678999999999999999988877665444


No 6  
>PF09849 DUF2076:  Uncharacterized protein conserved in bacteria (DUF2076);  InterPro: IPR018648  This family of hypothetical prokaryotic proteins has no known function but includes putative perimplasmic ligand-binding sensor proteins.
Probab=77.31  E-value=6.8  Score=33.12  Aligned_cols=32  Identities=22%  Similarity=0.387  Sum_probs=23.9

Q ss_pred             HHHHHhhhhhhhhhhHhhhhhhccccCCCCCC
Q psy4             71 AQMAATAGGVAIGSAVGHTIGHAVTGMFSGSD  102 (150)
Q Consensus        71 ~qmAstAaGvAvGsaVgH~ig~aitg~fsg~s  102 (150)
                      +...++|+..|.|-+-|-+|+.+|+++|+++.
T Consensus       135 ggFLg~A~~TAAGVAGG~lL~n~i~~lF~~~~  166 (247)
T PF09849_consen  135 GGFLGGAAQTAAGVAGGMLLANGIESLFGGHS  166 (247)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHHHhcCCc
Confidence            66666777778887777777888888886644


No 7  
>PF05537 DUF759:  Borrelia burgdorferi protein of unknown function (DUF759);  InterPro: IPR008478 This entry consists of several uncharacterised proteins from Borrelia species including Borrelia burgdorferi and Borrelia garinii.
Probab=68.73  E-value=2.1  Score=38.94  Aligned_cols=29  Identities=52%  Similarity=0.881  Sum_probs=16.5

Q ss_pred             CCCCCChhHHHHHHhhhhhhhhhhHhhhhhhccccC
Q psy4             62 APQQGPGLMAQMAATAGGVAIGSAVGHTIGHAVTGM   97 (150)
Q Consensus        62 ~~~~gpGl~~qmAstAaGvAvGsaVgH~ig~aitg~   97 (150)
                      +.++|-||.+.+       ||||+||.+||.+|+.+
T Consensus       127 aasqgkgLvaKI-------AiGsaLGnvi~na~sKv  155 (431)
T PF05537_consen  127 AASQGKGLVAKI-------AIGSALGNVIGNAISKV  155 (431)
T ss_pred             Hhhcccchheeh-------hHHHHHHHHHHHHHhhh
Confidence            345677775554       35555566666666543


No 8  
>cd08177 MAR Maleylacetate reductase is involved in many aromatic compounds degradation pathways of aerobic microbes. Maleylacetate reductases (MAR) play an important role in the degradation of aromatic compounds  in aerobic microbes. In fungi and yeasts, the enzymes are involved in the catabolism of compounds such as phenol, tyrosine, benzoate, 4-hydroxybenzoate and resorcinol. In bacteria, the enzymes contribute to the degradation of resorcinol, 2,4-dihydroxybenzoate ([beta]-resorcylate) and 2,6-dihydroxybenzoate ([gamma]-resorcylate) via hydroxyquinol and maleylacetate. Maleylacetate reductases catalyze NADH- or NADPH-dependent reduction, at the carbon-carbon double bond, of maleylacetate or 2-chloromaleylacetate to 3-oxoadipate. In the case of 2-chloromaleylacetate, Maleylacetate reductases initially catalyses the NAD(P)H-dependent dechlorination to maleylacetate, which is then reduced to 3-oxoadipate. This enzyme is a homodimer. It is inhibited by thiol-blocking reagents such as p-
Probab=37.68  E-value=26  Score=29.95  Aligned_cols=24  Identities=33%  Similarity=0.678  Sum_probs=16.1

Q ss_pred             Hhhhhhhh---hhhHhhhhhhccccCC
Q psy4             75 ATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      ++.+|.++   |..+.|.|+|.|++.|
T Consensus       215 s~~ag~a~~~~~~g~~H~l~h~l~~~~  241 (337)
T cd08177         215 AWLCGTCLGSVGMGLSHKLGHVLGGTF  241 (337)
T ss_pred             HHHHHHHhccccHHHHHHhhCccccCc
Confidence            44556655   3567788888887776


No 9  
>PF01431 Peptidase_M13:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=35.78  E-value=20  Score=28.02  Aligned_cols=15  Identities=27%  Similarity=0.450  Sum_probs=10.4

Q ss_pred             hhhhHhhhhhhcccc
Q psy4             82 IGSAVGHTIGHAVTG   96 (150)
Q Consensus        82 vGsaVgH~ig~aitg   96 (150)
                      +|+.|||-|+|+|+.
T Consensus        36 lG~ilahel~hafd~   50 (206)
T PF01431_consen   36 LGFILAHELMHAFDP   50 (206)
T ss_dssp             HHHHHHHHHHHCTST
T ss_pred             HHHHHHHHHHHHHHH
Confidence            577777777777744


No 10 
>PRK09860 putative alcohol dehydrogenase; Provisional
Probab=35.67  E-value=28  Score=30.49  Aligned_cols=25  Identities=24%  Similarity=0.464  Sum_probs=14.9

Q ss_pred             HHhhhhhhh---hhhHhhhhhhccccCC
Q psy4             74 AATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        74 AstAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      |++.+|+++   |..+.|.|+|.|++.|
T Consensus       246 as~laG~a~~~~g~g~~Hal~h~lg~~~  273 (383)
T PRK09860        246 AQFLAGMAFNNASLGYVHAMAHQLGGFY  273 (383)
T ss_pred             HHHHHHHHHccccHHHHHHHhhHHhhCc
Confidence            455566666   4445666666666655


No 11 
>KOG4618|consensus
Probab=34.79  E-value=37  Score=23.86  Aligned_cols=21  Identities=19%  Similarity=0.365  Sum_probs=17.3

Q ss_pred             CCCCcHHHHHHHHHHHH-hcCC
Q psy4            128 PTGACAWEIKQFLQCAN-TQSD  148 (150)
Q Consensus       128 ~~~~C~~~~kqF~~C~~-n~~D  148 (150)
                      ..++|.-+.+.=++||+ |+.|
T Consensus        20 ~~nPCl~es~aSfkCLeennyD   41 (74)
T KOG4618|consen   20 YYNPCLLESSASFKCLEENNYD   41 (74)
T ss_pred             cCChHHHHHHHHHHHHHhcCcc
Confidence            45899999999999998 4555


No 12 
>COG3134 Predicted outer membrane lipoprotein [Function unknown]
Probab=33.33  E-value=16  Score=29.29  Aligned_cols=19  Identities=32%  Similarity=0.685  Sum_probs=12.8

Q ss_pred             HHHhhhhhhhhhhHhhhhh
Q psy4             73 MAATAGGVAIGSAVGHTIG   91 (150)
Q Consensus        73 mAstAaGvAvGsaVgH~ig   91 (150)
                      +++|+.|..+|-.|||-+|
T Consensus        71 iaGt~iGAv~GGl~G~Q~G   89 (179)
T COG3134          71 IAGSVLGAVAGGVIGHQFG   89 (179)
T ss_pred             chhhhhHHHhhhhcccccc
Confidence            5557777777777777665


No 13 
>COG4395 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.79  E-value=55  Score=28.40  Aligned_cols=9  Identities=22%  Similarity=0.660  Sum_probs=4.5

Q ss_pred             ChhHHHHHH
Q psy4             67 PGLMAQMAA   75 (150)
Q Consensus        67 pGl~~qmAs   75 (150)
                      .||||+|++
T Consensus        30 ~~~~g~l~g   38 (281)
T COG4395          30 SGMLGGLAG   38 (281)
T ss_pred             hhhhhHHHH
Confidence            455555543


No 14 
>COG3590 PepO Predicted metalloendopeptidase [Posttranslational modification, protein turnover, chaperones]
Probab=31.97  E-value=19  Score=34.44  Aligned_cols=15  Identities=47%  Similarity=0.993  Sum_probs=11.1

Q ss_pred             hhhhHhhhhhhcccc
Q psy4             82 IGSAVGHTIGHAVTG   96 (150)
Q Consensus        82 vGsaVgH~ig~aitg   96 (150)
                      ||.+|||-|||+|+-
T Consensus       487 IGaVIgHEI~HgFDd  501 (654)
T COG3590         487 IGAVIGHEIGHGFDD  501 (654)
T ss_pred             ccceehhhhcccccC
Confidence            677788888888743


No 15 
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion]
Probab=31.38  E-value=39  Score=30.24  Aligned_cols=26  Identities=35%  Similarity=0.648  Sum_probs=14.9

Q ss_pred             HHHhhhhhhhhhh---HhhhhhhccccCC
Q psy4             73 MAATAGGVAIGSA---VGHTIGHAVTGMF   98 (150)
Q Consensus        73 mAstAaGvAvGsa---VgH~ig~aitg~f   98 (150)
                      +|++.+|++++++   +.|.|+|.+++.|
T Consensus       243 ~aa~lAGmAF~na~lG~~HalaH~lG~~~  271 (377)
T COG1454         243 LAATLAGMAFANAGLGLVHALAHPLGALF  271 (377)
T ss_pred             HHHHHHHHHhcchhHHHHHHhhccccccc
Confidence            4556667777432   5566666665555


No 16 
>cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP). Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) with either NADH or NADPH as a cofactor. NADH is the preferred cofactor. PnAA is a biosynthetic intermediate for several phosphonates such as the antibiotic fosfomycin, phosphinothricin tripeptide (PTT), and 2-aminoethylphosphonate (AEP). This enzyme is named PhpC in PTT biosynthesis pathway in Streptomyces hygroscopicus and S. viridochromogenes. Members of this family are only found in bacteria.
Probab=29.64  E-value=44  Score=28.76  Aligned_cols=15  Identities=20%  Similarity=0.443  Sum_probs=8.3

Q ss_pred             hhHhhhhhhccccCC
Q psy4             84 SAVGHTIGHAVTGMF   98 (150)
Q Consensus        84 saVgH~ig~aitg~f   98 (150)
                      ..+.|.|+|.+++.|
T Consensus       252 ~g~~H~l~h~l~~~~  266 (367)
T cd08182         252 TTAAHAISYPLTSRY  266 (367)
T ss_pred             HHHHHHHhchhhcCC
Confidence            345566666665554


No 17 
>KOG1924|consensus
Probab=28.79  E-value=1.4e+02  Score=30.16  Aligned_cols=8  Identities=25%  Similarity=0.704  Sum_probs=4.1

Q ss_pred             CCCChhHH
Q psy4             64 QQGPGLMA   71 (150)
Q Consensus        64 ~~gpGl~~   71 (150)
                      +-++|||.
T Consensus       598 PP~~gm~p  605 (1102)
T KOG1924|consen  598 PPPPGMFP  605 (1102)
T ss_pred             CCCCCccc
Confidence            34455654


No 18 
>KOG4695|consensus
Probab=28.47  E-value=35  Score=26.08  Aligned_cols=16  Identities=50%  Similarity=0.906  Sum_probs=14.2

Q ss_pred             CCCcHHHHHHHHHHHH
Q psy4            129 TGACAWEIKQFLQCAN  144 (150)
Q Consensus       129 ~~~C~~~~kqF~~C~~  144 (150)
                      ...|.-|+.+|+||..
T Consensus        66 d~~C~Kei~~f~dC~~   81 (122)
T KOG4695|consen   66 DDACRKEIQGFLDCAA   81 (122)
T ss_pred             chHHHHHHHHHHHHHH
Confidence            3789999999999985


No 19 
>cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria. Lactadehyde:propanediol oxidoreductase (LPO) is a member of the group III iron-activated dehydrogenases which catalyze the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria. L-Fucose and L-rhamnose is used by Escherichia coli through an inducible pathway mediated by the fucose regulon comprising four linked oeprons fucO, fucA, fucPIK, and fucR. The fucA-encoded aldolase catalyzes the formation of dihydroxyacetone phosphate and L-lactaldehyde. Under anaerobic conditions, with NADH as a cofactor, lactaldehyde is converted by a fucO-encoded Lactadehyde:propanediol oxidoreductase (LPO) to L-1,2-propanediol, which is excreted as a fermentation product. In mutant strains, E. coli adapted to grow on L-1,2-propanediol, FucO catalyzes the oxidation of the polyol to
Probab=28.10  E-value=43  Score=29.06  Aligned_cols=24  Identities=25%  Similarity=0.552  Sum_probs=12.9

Q ss_pred             Hhhhhhhh---hhhHhhhhhhccccCC
Q psy4             75 ATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      ++.+|.++   |..+.|.|+|.|++.|
T Consensus       244 s~laG~a~~~~g~g~~Hal~h~l~~~~  270 (377)
T cd08176         244 QYLAGMAFNNAGLGYVHSMAHQLGGFY  270 (377)
T ss_pred             HHHHHHHHhhhhHHHHHHhhhhHhhcC
Confidence            44555555   4445566666665544


No 20 
>KOG4114|consensus
Probab=27.88  E-value=42  Score=23.54  Aligned_cols=14  Identities=36%  Similarity=0.788  Sum_probs=12.8

Q ss_pred             CcHHHHHHHHHHHH
Q psy4            131 ACAWEIKQFLQCAN  144 (150)
Q Consensus       131 ~C~~~~kqF~~C~~  144 (150)
                      -|...+|+|+||.-
T Consensus        44 eC~al~~af~dCKR   57 (73)
T KOG4114|consen   44 ECIALMKAFLDCKR   57 (73)
T ss_pred             HHHHHHHHHHHHHH
Confidence            59999999999984


No 21 
>TIGR02638 lactal_redase lactaldehyde reductase. This clade of genes encoding iron-containing alcohol dehydrogenase (pfam00465) proteins is generally found in apparent operons for the catabolism of rhamnose or fucose. Catabolism of both of these monosaccharides results in lactaldehyde which is reduced by this enzyme to 1,2 propanediol. This protein is alternatively known by the name 1,2 propanediol oxidoreductase. This enzyme is active under anaerobic conditions in E. coli while being inactivated by reactive oxygen species under aerobic conditions. Under aerobic conditions the lactaldehyde product of rhamnose and fucose catabolism is believed to be oxidized to lactate by a separate enzyme, lactaldehyde dehydrogenase.
Probab=27.52  E-value=49  Score=28.78  Aligned_cols=24  Identities=17%  Similarity=0.470  Sum_probs=12.2

Q ss_pred             Hhhhhhhh---hhhHhhhhhhccccCC
Q psy4             75 ATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      ++-+|+++   |..+.|.|+|.|++.|
T Consensus       247 s~laG~a~~~~g~g~~Hal~~~l~~~~  273 (379)
T TIGR02638       247 QYVAGMGFSNVGLGLVHGMAHPLGAFY  273 (379)
T ss_pred             HHHHHHHHhhhhHHHHHHhhhhhhcCc
Confidence            34445555   3344555555665554


No 22 
>cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate. 6-hydroxyhexanoate dehydrogenase (HHD). The 6-hydroxyhexanoate dehydrogenase catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate. Some bacteria can grow on cyclic ketones, cyclohexylamine, and alcohols as sole carbon source. Cyclohexylamine is an insecticide and antiseptic in various industries and is considered a possible environmental pollutant. The degradation of these chemical compounds are through the cyclohexanol and cyclohexanone biological oxidation pathway. The intermediates of this pathway include cyclohexanol, cyclohexanone, e-caprolactone, 6-hydroxyhexanoate, 6-oxohexanoate and adipate. The 6-hydroxyhexanoate dehydrogenase catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate.
Probab=27.34  E-value=47  Score=28.95  Aligned_cols=24  Identities=29%  Similarity=0.409  Sum_probs=12.8

Q ss_pred             Hhhhhhhhh---hhHhhhhhhccccCC
Q psy4             75 ATAGGVAIG---SAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAvG---saVgH~ig~aitg~f   98 (150)
                      ++-+|++++   -.+.|.|+|.|++.+
T Consensus       253 s~laG~a~~~~~~g~~Hal~~~l~~~~  279 (386)
T cd08191         253 ALLAGLAFGTAGTAAVHALQYPVGALT  279 (386)
T ss_pred             HHHHHHHHhccchHHHHHhhhhhhcCc
Confidence            344555553   345566666665554


No 23 
>cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like. Iron-containing alcohol dehydrogenases-like (ADH). Alcohol dehydrogenase catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions. The protein structure represents a dehydroquinate synthase fold and is a member of the iron-containing alcohol dehydrogenase-like family. They are distinct from other alcohol dehydrogenases which contain different protein domains. Proteins of this family have not been characterized. Their specific function is unknown. They are present in bacteria and archaea.
Probab=26.90  E-value=40  Score=29.21  Aligned_cols=25  Identities=36%  Similarity=0.666  Sum_probs=15.6

Q ss_pred             HHhhhhhhh---hhhHhhhhhhccccCC
Q psy4             74 AATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        74 AstAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      |++.+|+++   |..+.|.|+|.|++.+
T Consensus       246 as~laG~a~~~~g~g~~Hai~~~l~~~~  273 (380)
T cd08185         246 ANTLGGMVEANSGCTSPHALEHALSGLH  273 (380)
T ss_pred             HHHHHHHHHcCccchhhhHhhChHhccC
Confidence            345556666   3456677777776655


No 24 
>cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like. Iron-containing alcohol dehydrogenases (Fe-ADH). Alcohol dehydrogenase catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions. The protein structure represents a dehydroquinate synthase-like fold and is a member of the iron-activated alcohol dehydrogenase-like family. They are distinct from other alcohol dehydrogenases which contains different protein domain. Proteins of this family have not been characterized. Their specific function is unknown. They are mainly found in bacteria.
Probab=26.64  E-value=53  Score=28.44  Aligned_cols=24  Identities=29%  Similarity=0.659  Sum_probs=13.5

Q ss_pred             Hhhhhhhh---hhhHhhhhhhccccCC
Q psy4             75 ATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      ++-+|.++   |..+.|.|+|.|++.|
T Consensus       238 s~laG~a~~~~g~g~~Hai~h~lg~~~  264 (374)
T cd08183         238 SLLGGIALANAGLGAVHGLAGPIGGLF  264 (374)
T ss_pred             HHHHHHHHhhhhhHHHHHhhchhhcCC
Confidence            44455555   2345666666666654


No 25 
>cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor. 5-hydroxyvalerate dehydrogenase (HVD) is an iron-containing (type III) NAD-dependent alcohol dehydrogenase. It plays a role in the cyclopentanol metabolism biochemical pathway. It catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor. This cyclopentanol (cpn) degradation pathway is present in some bacteria which can use cyclopentanol as sole carbon source. In Comamonas sp. strain NCIMB 9872, this enzyme is encoded by the CpnD gene.
Probab=26.17  E-value=52  Score=28.47  Aligned_cols=24  Identities=29%  Similarity=0.364  Sum_probs=12.6

Q ss_pred             Hhhhhhhh---hhhHhhhhhhccccCC
Q psy4             75 ATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      ++.+|.++   |-.+.|.|+|.|++.+
T Consensus       242 s~laG~a~~~~g~g~~Hal~h~l~~~~  268 (376)
T cd08193         242 AMYAGQAFANAPVAAVHALAYPLGGKF  268 (376)
T ss_pred             HHHHHHHHhhhhHHHHHHhcchhhcCc
Confidence            44555555   2345566666665544


No 26 
>cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like. Iron-containing alcohol dehydrogenase-like. Alcohol dehydrogenase catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions. The protein structure represents a dehydroquinate synthase-like fold and belongs to the alcohol dehydrogenase-like superfamily. They are distinct from other alcohol dehydrogenases which contains different protein domain. Proteins of this family have not been characterized. Their specific function is unknown.
Probab=25.74  E-value=52  Score=28.49  Aligned_cols=24  Identities=29%  Similarity=0.583  Sum_probs=12.6

Q ss_pred             Hhhhhhhh---hhhHhhhhhhccccCC
Q psy4             75 ATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      ++-+|+++   |..+.|.|+|.|++.|
T Consensus       243 s~lag~a~~~~g~g~~Hal~h~l~~~~  269 (374)
T cd08189         243 SYYAGLAFTRAGVGYVHAIAHQLGGVY  269 (374)
T ss_pred             HHHHHHHHhcccHHHHHHhhhhhhcCC
Confidence            34445555   2345566666665554


No 27 
>cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like. Large metal-containing  alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases; insect-type, or short-chain alcohol dehydrogenases; iron-containing alcohol dehydrogenases, and others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement.  ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.
Probab=25.47  E-value=53  Score=28.18  Aligned_cols=23  Identities=26%  Similarity=0.583  Sum_probs=12.8

Q ss_pred             hhhhhhh---hhhHhhhhhhccccCC
Q psy4             76 TAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        76 tAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      +-+|+++   |..+.|.|+|+|++.|
T Consensus       240 ~laG~a~~~~~~g~~H~i~~~l~~~~  265 (370)
T cd08551         240 TLAGMAFSNAGLGAVHAMAHPLGALY  265 (370)
T ss_pred             HHHHHHHhCcchHHHHHHhhHHhhCC
Confidence            3344444   3456666666665554


No 28 
>cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP). Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) with either NADH or NADPH as a cofactor. NADH is the preferred cofactor. PnAA is a biosynthetic intermediate for several phosphonates such as the antibiotic fosfomycin, phosphinothricin tripeptide (PTT), and 2-aminoethylphosphonate (AEP). This enzyme is named PhpC in PTT biosynthesis pathway in Streptomyces hygroscopicus and S. viridochromogenes. Members of this family are only found in bacteria.
Probab=25.28  E-value=48  Score=28.53  Aligned_cols=25  Identities=16%  Similarity=0.235  Sum_probs=18.8

Q ss_pred             hhHHHHHHhhhhhhhhhhHhhhhhh
Q psy4             68 GLMAQMAATAGGVAIGSAVGHTIGH   92 (150)
Q Consensus        68 Gl~~qmAstAaGvAvGsaVgH~ig~   92 (150)
                      .++++|+-...|..+.|+|+|.|+.
T Consensus       240 s~laG~a~~~~~~g~~H~l~h~l~~  264 (367)
T cd08182         240 SLLAGLAISNTRTTAAHAISYPLTS  264 (367)
T ss_pred             HHHHHHHHhchhHHHHHHHhchhhc
Confidence            3567777666788889999998863


No 29 
>KOG3477|consensus
Probab=25.07  E-value=63  Score=23.73  Aligned_cols=17  Identities=35%  Similarity=0.841  Sum_probs=15.1

Q ss_pred             CCCCcHHHHHHHHHHHH
Q psy4            128 PTGACAWEIKQFLQCAN  144 (150)
Q Consensus       128 ~~~~C~~~~kqF~~C~~  144 (150)
                      -.+-|.-++|+++.|+.
T Consensus        26 H~geC~~em~eYl~Cl~   42 (97)
T KOG3477|consen   26 HLGECTAEMKEYLGCLK   42 (97)
T ss_pred             cccccHHHHHHHHHHHH
Confidence            35789999999999996


No 30 
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional
Probab=25.00  E-value=52  Score=28.63  Aligned_cols=24  Identities=17%  Similarity=0.458  Sum_probs=12.9

Q ss_pred             Hhhhhhhh---hhhHhhhhhhccccCC
Q psy4             75 ATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      ++-+|.++   |..+.|.|+|.|++.|
T Consensus       246 s~laG~a~~~~g~g~~Hal~h~l~~~~  272 (382)
T PRK10624        246 QYIAGMGFSNVGLGLVHGMAHPLGAFY  272 (382)
T ss_pred             HHHHHHHHhccchHHHHHhhhHHhhCC
Confidence            44455555   3345566666665555


No 31 
>cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase. Type III Iron-containing alcohol dehydrogenases (ADH). Alcohol dehydrogenase catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. The ADH of hyperthermophilic archaeon Thermococcus hydrothermalis oxidizes a series of primary aliphatic and aromatic alcohols preferentially from C2 to C8 but is also active towards methanol and glycerol and stereospecific for monoterpenes. It was suggested that the type III ADHs in microorganisms are involved in acetaldehyde detoxication rather than in alcohol turnover.
Probab=24.75  E-value=58  Score=28.37  Aligned_cols=24  Identities=25%  Similarity=0.547  Sum_probs=13.9

Q ss_pred             HHhhhhhhhh---hhHhhhhhhccccC
Q psy4             74 AATAGGVAIG---SAVGHTIGHAVTGM   97 (150)
Q Consensus        74 AstAaGvAvG---saVgH~ig~aitg~   97 (150)
                      |++.+|++++   -.+.|.|+|.|++.
T Consensus       243 as~laG~a~~~~~~g~~Hai~~~l~~~  269 (383)
T cd08186         243 ASAIAGIAIDNGLLHLTHALEHPLSAL  269 (383)
T ss_pred             HHHHHHHHHhcchhHHHHHhcCchhcC
Confidence            3444566553   34566666677665


No 32 
>cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like. Iron-containing alcohol dehydrogenase-like. Alcohol dehydrogenase catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions. The protein structure represents a dehydroquinate synthase-like fold and is belonged to the alcohol dehydrogenase-like superfamily. They are distinct from other alcohol dehydrogenases which contain different protein domains.  Proteins of this family have not been characterized. Their specific function is unknown.
Probab=24.45  E-value=58  Score=28.31  Aligned_cols=13  Identities=23%  Similarity=0.657  Sum_probs=6.8

Q ss_pred             HhhhhhhccccCC
Q psy4             86 VGHTIGHAVTGMF   98 (150)
Q Consensus        86 VgH~ig~aitg~f   98 (150)
                      +.|.|+|.|++.|
T Consensus       258 ~~Hal~~~l~~~~  270 (377)
T cd08188         258 AVHAMAHSLGGLL  270 (377)
T ss_pred             HHHHHhhhhhhCc
Confidence            4455555555544


No 33 
>cd08178 AAD_C C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD). Alcohol dehydrogenase domain located on the C-terminal of a bifunctional two-domain protein. The N-terminal of the protein contains an acetaldehyde-CoA dehydrogenase domain. This protein is involved in pyruvate metabolism. Pyruvate is converted to acetyl-CoA and formate by pyruvate formate-lysase (PFL). Under anaerobic condition, acetyl-CoA is reduced to acetaldehyde and ethanol by this two-domain protein. Acetyl-CoA is first converted into an enzyme-bound thiohemiacetal by the N-terminal acetaldehyde dehydrogenase domain. The enzyme-bound thiohemiacetal is subsequently reduced by the C-terminal  NAD+-dependent alcohol dehydrogenase domain. In E. coli, this protein is called AdhE and was shown pyruvate formate-lysase (PFL) deactivase activity, which is involved in the inactivation of PFL, a key enzyme in anaerobic metabolism. In Escherichi
Probab=24.44  E-value=54  Score=28.70  Aligned_cols=24  Identities=29%  Similarity=0.536  Sum_probs=11.5

Q ss_pred             Hhhhhhhhh---hhHhhhhhhccccCC
Q psy4             75 ATAGGVAIG---SAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAvG---saVgH~ig~aitg~f   98 (150)
                      ++-+|+++.   -.++|.|+|+|++.|
T Consensus       248 s~laG~a~~~~~lg~~Hal~h~l~~~~  274 (398)
T cd08178         248 ATIAGMAFANAFLGICHSMAHKLGAEF  274 (398)
T ss_pred             HHHHHHHhcccchhhhhhhhhhhccCC
Confidence            334455442   234555555555544


No 34 
>PF05051 COX17:  Cytochrome C oxidase copper chaperone (COX17);  InterPro: IPR007745 Cox17p is essential for the assembly of functional cytochrome c oxidase (CCO) and for delivery of copper ions to the mitochondrion for insertion into the enzyme in Saccharomyces cerevisiae [].; GO: 0005507 copper ion binding, 0016531 copper chaperone activity, 0006825 copper ion transport, 0005758 mitochondrial intermembrane space; PDB: 1U97_A 1U96_A 1Z2G_A 2RNB_A 2RN9_A 2LGQ_A 2L0Y_B.
Probab=24.25  E-value=72  Score=20.80  Aligned_cols=17  Identities=18%  Similarity=0.339  Sum_probs=14.6

Q ss_pred             CCcHHHHHHHHHHHHhc
Q psy4            130 GACAWEIKQFLQCANTQ  146 (150)
Q Consensus       130 ~~C~~~~kqF~~C~~n~  146 (150)
                      ..|..+++++++|+...
T Consensus        29 e~C~~~Ieahk~Cmr~~   45 (49)
T PF05051_consen   29 EDCKELIEAHKACMRGE   45 (49)
T ss_dssp             CCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHc
Confidence            35999999999999753


No 35 
>cd08184 Fe-ADH3 Iron-containing alcohol dehydrogenases-like. Iron-containing alcohol dehydrogenase-like. Proteins of this family have not been characterized. Their specific function is unknown. The protein structure represents a dehydroquinate synthase-like fold and is belonged to the iron-containing alcohol dehydrogenase-like superfamily. They are distinct from other alcohol dehydrogenases which contain different protein domains. Alcohol dehydrogenase catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron or zinc ions. Members of this family are mainly found in bacteria.
Probab=24.20  E-value=40  Score=29.34  Aligned_cols=25  Identities=24%  Similarity=0.325  Sum_probs=16.0

Q ss_pred             HHhhhhhhh---hhhHhhhhhhccccCC
Q psy4             74 AATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        74 AstAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      |++.+|+++   |..+.|.|+|.|++.+
T Consensus       235 As~laG~a~~~~g~g~~Hal~h~L~~~~  262 (347)
T cd08184         235 ASYLGGMSIANSQVGVCHAASYGLSLHL  262 (347)
T ss_pred             HHHHHHHHhCCcccccchhhchHhhcCC
Confidence            345567776   3456677777776765


No 36 
>PF06897 DUF1269:  Protein of unknown function (DUF1269);  InterPro: IPR009200 There are currently no experimental data for members of this group or their homologues. However, these proteins are predicted to contain two or more transmembrane segments.
Probab=23.57  E-value=53  Score=23.99  Aligned_cols=16  Identities=31%  Similarity=0.372  Sum_probs=7.3

Q ss_pred             HhhhhhhhhhhHhhhh
Q psy4             75 ATAGGVAIGSAVGHTI   90 (150)
Q Consensus        75 stAaGvAvGsaVgH~i   90 (150)
                      +++.|.++|..+|+..
T Consensus        21 G~~~GA~~Gal~G~l~   36 (102)
T PF06897_consen   21 GAAVGAAAGALAGALS   36 (102)
T ss_pred             HHHHHHHHHHHHhHHh
Confidence            3444444444444433


No 37 
>PF10200 Ndufs5:  NADH:ubiquinone oxidoreductase, NDUFS5-15kDa;  InterPro: IPR019342 Proteins in this entry form part of the NADH:ubiquinone oxidoreductase complex I. Complex I is the first multisubunit inner membrane protein complex of the mitochondrial electron transport chain and it transfers two electrons from NADH to ubiquinone. The mammalian complex I is composed of 45 different subunits. The proteins in this entry represent a component of the iron-sulphur (IP) fragment of the enzyme, that is not involved in catalysis. These proteins carry four highly conserved cysteine residues, but these do not appear to be in a configuration which would favour metal binding, so the exact function of the protein is uncertain []. 
Probab=23.34  E-value=90  Score=22.91  Aligned_cols=19  Identities=21%  Similarity=0.473  Sum_probs=13.2

Q ss_pred             CCcHHHHHHHHHHHHhcCC
Q psy4            130 GACAWEIKQFLQCANTQSD  148 (150)
Q Consensus       130 ~~C~~~~kqF~~C~~n~~D  148 (150)
                      +-|..+-++|++|++..++
T Consensus        31 ~RC~~FE~e~i~C~~~~G~   49 (96)
T PF10200_consen   31 SRCHPFEKEWIECAEAYGQ   49 (96)
T ss_pred             CchHHHHHHHHHHHHHHcc
Confidence            4677777778888765443


No 38 
>cd08179 NADPH_BDH NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria. NADPH-dependent butanol dehydrogenase (BDH) is involved in the butanol and ethanol formation pathway of some bacteria. The fermentation process is characterized by an acid producing growth phase, followed by a solvent producing phase. The latter phase is associated with the induction of solventogenic enzymes such as butanol dehydrogenase. The activity of the enzymes require NADPH as cofactor, as well as divalent ions zinc or iron. This family is a member of the iron-containing alcohol dehydrogenase superfamily. Protein structure has a dehydroquinate synthase-like fold.
Probab=22.93  E-value=71  Score=27.66  Aligned_cols=24  Identities=21%  Similarity=0.349  Sum_probs=13.1

Q ss_pred             Hhhhhhhh---hhhHhhhhhhccccCC
Q psy4             75 ATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      ++.+|.++   |..+.|.|+|.|++.+
T Consensus       242 s~laG~a~~~~g~g~~Hai~h~lg~~~  268 (375)
T cd08179         242 QCMAGMAFSNALLGIVHSMAHKTGAEF  268 (375)
T ss_pred             HHHHHHHHhhhhHHHHHHhhhhhccCC
Confidence            34455555   3445566666665554


No 39 
>PF08583 Cmc1:  Cytochrome c oxidase biogenesis protein Cmc1 like;  InterPro: IPR013892 Cmc1 is a metallo-chaperone like protein which is known to localise to the inner mitochondrial membrane in Saccharomyces cerevisiae. It is essential for full expression of cytochrome c oxidase and respiration []. Cmc1 contains two Cx9C motifs and is able to bind copper(I). Cmc1 is thought to play a role in mitochondrial copper trafficking and transfer to cytochrome c oxidase.
Probab=22.67  E-value=67  Score=20.79  Aligned_cols=16  Identities=38%  Similarity=0.725  Sum_probs=13.5

Q ss_pred             CCcHHHHHHHHHHHHh
Q psy4            130 GACAWEIKQFLQCANT  145 (150)
Q Consensus       130 ~~C~~~~kqF~~C~~n  145 (150)
                      ..|.-+++.|.+|..+
T Consensus        11 ~~C~~~i~~~~~C~~~   26 (69)
T PF08583_consen   11 KKCADEIEAFAECHKD   26 (69)
T ss_pred             HHhHHHHHHHHHHHhc
Confidence            4699999999999875


No 40 
>KOG4138|consensus
Probab=22.60  E-value=77  Score=23.27  Aligned_cols=21  Identities=19%  Similarity=0.389  Sum_probs=16.3

Q ss_pred             CCCCcHHHHHHHHHHHHh-cCC
Q psy4            128 PTGACAWEIKQFLQCANT-QSD  148 (150)
Q Consensus       128 ~~~~C~~~~kqF~~C~~n-~~D  148 (150)
                      +.--|..++..|.+|.+. ++.
T Consensus        59 DWRqC~~qm~~FrkCwek~~g~   80 (96)
T KOG4138|consen   59 DWRQCQPQMQAFRKCWEKQQGR   80 (96)
T ss_pred             cHHHHHHHHHHHHHHHHHHcCC
Confidence            345699999999999975 454


No 41 
>cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway. NAD-dependent iron-containing alcohol dehydrogenase-like. Proteins in this family are NAD-dependent alcohol dehydrogenases which are involved in the linear alkylbenzenesulfonate (LAS) degradation pathway. They catalyze the oxidation of beta-hydroxy CoA ester to beta-oxo CoA ester, which then be subject to CoA-dependent thiolysis to yield acetyl-CoA and 6-C8-SPC-CoA. The major laundry surfactant in worldwide use is commercial linear alkylbenzenesulfonate (LAS) which contains 20 congeners of linear alkanes (C10 to C13). LAS is fully biodegradable in oxic environments. Degradation involves microbial communities. Parvibaculum lavamentivorans DS-1T is a representative member of many heterotrophic, LAS-degrading communities, in which it catalyzes the first steps of LAS degradation. Strain DS-1T is a small heterotrophic bacterium able to omega-oxygenate the comm
Probab=21.89  E-value=64  Score=27.79  Aligned_cols=24  Identities=25%  Similarity=0.601  Sum_probs=13.6

Q ss_pred             Hhhhhhhh--hhhHhhhhhhccccCC
Q psy4             75 ATAGGVAI--GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAv--GsaVgH~ig~aitg~f   98 (150)
                      ++-+|+++  |..+.|.|+|.|++.|
T Consensus       244 s~laG~a~~~~~g~~Hal~h~l~~~~  269 (370)
T cd08192         244 ASMGAMAFQKGLGAVHSLSHPLGALY  269 (370)
T ss_pred             HHHHHHHHhhccHHHHHhhhHHhhCC
Confidence            34445554  3345677777776655


No 42 
>KOG4175|consensus
Probab=21.88  E-value=40  Score=28.60  Aligned_cols=25  Identities=32%  Similarity=0.595  Sum_probs=21.1

Q ss_pred             ChhHHHHHHhhhhhhhhhhHhhhhh
Q psy4             67 PGLMAQMAATAGGVAIGSAVGHTIG   91 (150)
Q Consensus        67 pGl~~qmAstAaGvAvGsaVgH~ig   91 (150)
                      +--|-|.+++|.||.|||.|-..+|
T Consensus       219 ~EHf~qVgsvaDGVvvGSkiv~l~g  243 (268)
T KOG4175|consen  219 PEHFKQVGSVADGVVVGSKIVKLLG  243 (268)
T ss_pred             HHHHHhhhhhccceEecHHHHHHhc
Confidence            4458899999999999999988665


No 43 
>cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate. 6-hydroxyhexanoate dehydrogenase (HHD). The 6-hydroxyhexanoate dehydrogenase catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate. Some bacteria can grow on cyclic ketones, cyclohexylamine, and alcohols as sole carbon source. Cyclohexylamine is an insecticide and antiseptic in various industries and is considered a possible environmental pollutant. The degradation of these chemical compounds are through the cyclohexanol and cyclohexanone biological oxidation pathway. The intermediates of this pathway include cyclohexanol, cyclohexanone, e-caprolactone, 6-hydroxyhexanoate, 6-oxohexanoate and adipate. The 6-hydroxyhexanoate dehydrogenase catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate.
Probab=21.68  E-value=60  Score=28.28  Aligned_cols=25  Identities=28%  Similarity=0.352  Sum_probs=18.9

Q ss_pred             hhHHHHHHhhhhhhhhhhHhhhhhh
Q psy4             68 GLMAQMAATAGGVAIGSAVGHTIGH   92 (150)
Q Consensus        68 Gl~~qmAstAaGvAvGsaVgH~ig~   92 (150)
                      +++++|+-.-.|..+.|+|+|.||.
T Consensus       253 s~laG~a~~~~~~g~~Hal~~~l~~  277 (386)
T cd08191         253 ALLAGLAFGTAGTAAVHALQYPVGA  277 (386)
T ss_pred             HHHHHHHHhccchHHHHHhhhhhhc
Confidence            5567776556788889999998873


No 44 
>PRK15138 aldehyde reductase; Provisional
Probab=21.44  E-value=58  Score=28.57  Aligned_cols=25  Identities=32%  Similarity=0.392  Sum_probs=14.4

Q ss_pred             HHhhhhhhhhh---h---HhhhhhhccccCC
Q psy4             74 AATAGGVAIGS---A---VGHTIGHAVTGMF   98 (150)
Q Consensus        74 AstAaGvAvGs---a---VgH~ig~aitg~f   98 (150)
                      |++.+|.++.+   .   +.|.|+|.|++.|
T Consensus       247 as~lag~a~~~~g~~~~~~~Hal~h~lg~~~  277 (387)
T PRK15138        247 AATQALNGLIGAGVPQDWATHMLGHELTAMH  277 (387)
T ss_pred             HHHHHHHHHhccCCCCCchhhhhcchhhhcc
Confidence            45556666621   1   3477777776655


No 45 
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional
Probab=21.03  E-value=83  Score=26.48  Aligned_cols=17  Identities=12%  Similarity=-0.058  Sum_probs=10.0

Q ss_pred             CCCCCcHHHHHHHHHHH
Q psy4            127 EPTGACAWEIKQFLQCA  143 (150)
Q Consensus       127 ~~~~~C~~~~kqF~~C~  143 (150)
                      .+...+.-|++.+..-+
T Consensus        68 ADG~Vse~Ei~~~~~l~   84 (267)
T PRK09430         68 AKGRVTEADIRIASQLM   84 (267)
T ss_pred             cCCCcCHHHHHHHHHHH
Confidence            45566777777554443


No 46 
>cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD). 1,3-propanediol dehydrogenase-like (PPD). This family is a member of the iron-containing alcohol dehydrogenase superfamily, and exhibits a dehydroquinate synthase-like fold.  Protein sequence similarity search and other biochemical evidences suggest that they are close to the iron-containing 1,3-propanediol dehydrogenase (EC 1.1.1.202). 1,3-propanediol dehydrogenase catalyzes the oxidation of propane-1,3-diol to 3-hydroxypropanal with the simultaneous reduction of NADP+ to NADPH. The protein structure of Thermotoga maritima TM0920 gene contains one NADP+ and one iron ion.
Probab=20.71  E-value=68  Score=27.63  Aligned_cols=24  Identities=29%  Similarity=0.439  Sum_probs=14.0

Q ss_pred             Hhhhhhhh---hhhHhhhhhhccccCC
Q psy4             75 ATAGGVAI---GSAVGHTIGHAVTGMF   98 (150)
Q Consensus        75 stAaGvAv---GsaVgH~ig~aitg~f   98 (150)
                      ++-+|+++   |..+.|.|+|.|++.+
T Consensus       241 s~laG~a~~~~g~~~~Hal~~~l~~~~  267 (357)
T cd08181         241 STLAGMVIAQTGTTLPHGLGYPLTYEK  267 (357)
T ss_pred             HHHHHHHHhcccchhhHhhcCccccCC
Confidence            34455555   3456677777776654


No 47 
>KOG4110|consensus
Probab=20.60  E-value=68  Score=24.45  Aligned_cols=15  Identities=33%  Similarity=0.689  Sum_probs=11.0

Q ss_pred             CCcHHHHHHHHHHHH
Q psy4            130 GACAWEIKQFLQCAN  144 (150)
Q Consensus       130 ~~C~~~~kqF~~C~~  144 (150)
                      .-|..++..|.||+-
T Consensus        57 keC~ie~~dFqECv~   71 (120)
T KOG4110|consen   57 KECAIEYDDFQECVL   71 (120)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            358888888888874


No 48 
>PF03035 RNA_capsid:  Calicivirus putative RNA polymerase/capsid protein;  InterPro: IPR004278 Caliciviruses are a small round-structured virus group defined by RNA-dependent RNA polymerase and capsid diversity.
Probab=20.57  E-value=72  Score=26.90  Aligned_cols=20  Identities=30%  Similarity=0.508  Sum_probs=13.2

Q ss_pred             hhHHHHHHhhhhhhhhhhHh
Q psy4             68 GLMAQMAATAGGVAIGSAVG   87 (150)
Q Consensus        68 Gl~~qmAstAaGvAvGsaVg   87 (150)
                      -+|+.||+.++|.+||+.|.
T Consensus         4 Af~a~lAgd~~g~~vgslI~   23 (226)
T PF03035_consen    4 AFIAGLAGDALGSGVGSLIN   23 (226)
T ss_pred             HHHHHHHHHHhhhhHHHHHH
Confidence            46777777777766666554


No 49 
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion]
Probab=20.48  E-value=59  Score=29.09  Aligned_cols=27  Identities=26%  Similarity=0.434  Sum_probs=20.2

Q ss_pred             hhHHHHHHhhhhhhhhhhHhhhhhhcc
Q psy4             68 GLMAQMAATAGGVAIGSAVGHTIGHAV   94 (150)
Q Consensus        68 Gl~~qmAstAaGvAvGsaVgH~ig~ai   94 (150)
                      .++++||=.=+|+.+-|+++|.||+.+
T Consensus       245 a~lAGmAF~na~lG~~HalaH~lG~~~  271 (377)
T COG1454         245 ATLAGMAFANAGLGLVHALAHPLGALF  271 (377)
T ss_pred             HHHHHHHhcchhHHHHHHhhccccccc
Confidence            356667666678889999999998444


Done!