Query         psy4005
Match_columns 202
No_of_seqs    104 out of 188
Neff          2.6 
Searched_HMMs 46136
Date          Fri Aug 16 22:57:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4005.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4005hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3484|consensus              100.0   7E-47 1.5E-51  288.0   7.4   76   81-156     1-76  (91)
  2 PF01111 CKS:  Cyclin-dependent 100.0 1.7E-45 3.7E-50  269.8   6.3   70   85-154     1-70  (70)
  3 PLN00010 cyclin-dependent kina 100.0 4.4E-45 9.6E-50  276.8   8.1   77   84-160     2-78  (86)
  4 PTZ00453 cyclin-dependent kina 100.0 9.2E-44   2E-48  273.9   7.6   74   81-154    23-96  (96)
  5 PLN00010 cyclin-dependent kina  90.7    0.16 3.6E-06   39.4   1.9   16   14-29     60-75  (86)
  6 KOG3484|consensus               90.3    0.15 3.3E-06   39.9   1.4   13   14-26     62-74  (91)
  7 PF01111 CKS:  Cyclin-dependent  87.7     0.2 4.4E-06   37.4   0.5   12   14-25     58-69  (70)
  8 PF13783 DUF4177:  Domain of un  76.0     3.1 6.7E-05   28.6   2.8   52   96-152     1-61  (61)
  9 COG0429 Predicted hydrolase of  37.7      15 0.00033   34.6   1.0   21  162-182   300-320 (345)
 10 PF05972 APC_15aa:  APC 15 resi  34.4      19 0.00041   20.6   0.6   13   84-96      4-16  (16)
 11 TIGR02011 IscA iron-sulfur clu  33.6      30 0.00064   26.0   1.8   17   18-36     85-101 (105)
 12 PRK09502 iscA iron-sulfur clus  32.3      32  0.0007   26.0   1.8   17   18-36     87-103 (107)
 13 TIGR02150 IPP_isom_1 isopenten  28.3      89  0.0019   24.6   3.8   27  137-163    32-58  (158)
 14 PRK03759 isopentenyl-diphospha  25.3   1E+02  0.0022   24.9   3.7   29  128-156    26-58  (184)
 15 PF09355 Phage_Gp19:  Phage pro  23.1      52  0.0011   26.1   1.6   21  114-134    88-108 (116)
 16 PTZ00235 DNA polymerase epsilo  22.4      39 0.00085   31.1   0.8   49   14-62    233-291 (291)
 17 PF07254 DUF1434:  Protein of u  21.6      48   0.001   27.1   1.1   11  117-127   116-126 (132)
 18 TIGR00049 Iron-sulfur cluster   21.0      72  0.0016   23.4   1.9   17   19-37     86-102 (105)
 19 cd04697 Nudix_Hydrolase_38 Mem  20.6 1.8E+02  0.0039   21.6   3.9   21  136-156     4-24  (126)
 20 PF13975 gag-asp_proteas:  gag-  20.3      64  0.0014   22.6   1.4   18  116-133    31-48  (72)
 21 cd03676 Nudix_hydrolase_3 Memb  20.2 1.4E+02   0.003   23.7   3.5   33  130-162    26-66  (180)
 22 PF10738 Lpp-LpqN:  Probable li  20.1      70  0.0015   27.0   1.8   42  126-167    33-85  (175)

No 1  
>KOG3484|consensus
Probab=100.00  E-value=7e-47  Score=287.99  Aligned_cols=76  Identities=55%  Similarity=0.926  Sum_probs=73.7

Q ss_pred             CCCCCeeecCCcCCCceeEEEEEcChHHHhhCCCCCCCCHHHHhhhccccCCCeeEeeecCCCceeEEEecccccc
Q psy4005          81 MSADDIRYSDKYEDDNYIYRHVMLPPDLAKQVPKTHLMTETEWRNLGVQQSPGWIHYMLHLPGNENWVKNRYETLV  156 (202)
Q Consensus        81 M~~~~I~YS~KY~DD~YEYRHViLPkel~K~VPK~rLLsE~EWR~LGIQQS~GW~HYmiHkPEPHILLFRRPl~~~  156 (202)
                      |..++|+||+||.||+||||||+|||+++|+|||+|||||+|||+||||||+||+|||||.|||||||||||++..
T Consensus         1 ~~~~qi~YS~kY~Dd~fEYRHV~Lpk~~~K~vPk~rllsE~EWR~lGvqQS~GW~hYmiH~PEpHIlLFrRp~~~~   76 (91)
T KOG3484|consen    1 MFMDQIYYSDKYFDDEFEYRHVMLPKEVAKLVPKNRLLSETEWRGLGVQQSLGWVHYMIHAPEPHILLFRRPLNYA   76 (91)
T ss_pred             CCccceecccccccccceeEEeecCHHHHhhCCccccccHHHHhhhCccccCCeeEEEecCCCceEEEEecccchH
Confidence            5679999999999999999999999999999999999999999999999999999999999999999999999775


No 2  
>PF01111 CKS:  Cyclin-dependent kinase regulatory subunit;  InterPro: IPR000789 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. In eukaryotes, cyclin-dependent protein kinases interact with cyclins to regulate cell cycle progression, and are required for the G1 and G2 stages of cell division []. The proteins bind to a regulatory subunit, cyclin-dependent kinase regulatory subunit (CKS), which is essential for their function. This regulatory subunit is a small protein of 79 to 150 residues. In yeast (gene CKS1) and in fission yeast (gene suc1) a single isoform is known, while mammals have two highly related isoforms. The regulatory subunits exist as hexamers, formed by the symmetrical assembly of 3 interlocked homodimers, creating an unusual 12-stranded beta-barrel structure []. Through the barrel centre runs a 12A diameter tunnel, lined by 6 exposed helix pairs []. Six kinase units can be modelled to bind the hexameric structure, which may thus act as a hub for cyclin-dependent protein kinase multimerisation [, ].; GO: 0016538 cyclin-dependent protein kinase regulator activity, 0007049 cell cycle; PDB: 1CKS_C 3QY2_B 1QB3_C 1SCE_B 1PUC_A 1DKS_B 2AST_C 1BUH_B 1DKT_B 2ASS_C.
Probab=100.00  E-value=1.7e-45  Score=269.79  Aligned_cols=70  Identities=56%  Similarity=0.992  Sum_probs=55.8

Q ss_pred             CeeecCCcCCCceeEEEEEcChHHHhhCCCCCCCCHHHHhhhccccCCCeeEeeecCCCceeEEEecccc
Q psy4005          85 DIRYSDKYEDDNYIYRHVMLPPDLAKQVPKTHLMTETEWRNLGVQQSPGWIHYMLHLPGNENWVKNRYET  154 (202)
Q Consensus        85 ~I~YS~KY~DD~YEYRHViLPkel~K~VPK~rLLsE~EWR~LGIQQS~GW~HYmiHkPEPHILLFRRPl~  154 (202)
                      +|+||+||+||+||||||||||+++|++|+++||||+|||+||||||+||+|||+|+|||||||||||+|
T Consensus         1 ~I~YS~kY~Dd~yeYRhViLpk~~~k~vp~~~llsE~EWR~LGIqqS~GW~Hy~~h~pephiLlFrRp~n   70 (70)
T PF01111_consen    1 QIYYSDKYYDDEYEYRHVILPKEIAKLVPKDRLLSEEEWRGLGIQQSPGWEHYMIHKPEPHILLFRRPLN   70 (70)
T ss_dssp             G-EEE--EEBSSEEEEEEE--HHHHGTS-CCS---HHHHHHTT--S-TT-EEECETTSSTTEEEEEEECT
T ss_pred             CccccccccCCceEEEEEECCHHHHhhCccCcccCHHHHHhhCCccCCCcEEEEEeCCCCcEEEEecCCC
Confidence            5899999999999999999999999999999999999999999999999999999999999999999986


No 3  
>PLN00010 cyclin-dependent kinases regulatory subunit; Provisional
Probab=100.00  E-value=4.4e-45  Score=276.75  Aligned_cols=77  Identities=47%  Similarity=0.881  Sum_probs=73.6

Q ss_pred             CCeeecCCcCCCceeEEEEEcChHHHhhCCCCCCCCHHHHhhhccccCCCeeEeeecCCCceeEEEecccccccCCC
Q psy4005          84 DDIRYSDKYEDDNYIYRHVMLPPDLAKQVPKTHLMTETEWRNLGVQQSPGWIHYMLHLPGNENWVKNRYETLVRLRG  160 (202)
Q Consensus        84 ~~I~YS~KY~DD~YEYRHViLPkel~K~VPK~rLLsE~EWR~LGIQQS~GW~HYmiHkPEPHILLFRRPl~~~~l~g  160 (202)
                      ++|+||+||+||+||||||||||+++|+||+++||||+|||+||||||+||+|||+|+|||||||||||++..+..|
T Consensus         2 ~~I~YS~kY~Dd~yeYRhViLPk~~~k~ipk~~LL~E~EWR~LGIqqS~GW~Hy~~h~pEphILlFrRp~~~~~~~~   78 (86)
T PLN00010          2 GQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQE   78 (86)
T ss_pred             CccEeCCceeCCCcEEEEEEeCHHHHHhCCcCcccCHHHHHHhccccCCCcEEeeecCCCceEEEEEccCCCCCccc
Confidence            57999999999999999999999999999999999999999999999999999999999999999999998876443


No 4  
>PTZ00453 cyclin-dependent kinase; Provisional
Probab=100.00  E-value=9.2e-44  Score=273.91  Aligned_cols=74  Identities=54%  Similarity=0.936  Sum_probs=71.3

Q ss_pred             CCCCCeeecCCcCCCceeEEEEEcChHHHhhCCCCCCCCHHHHhhhccccCCCeeEeeecCCCceeEEEecccc
Q psy4005          81 MSADDIRYSDKYEDDNYIYRHVMLPPDLAKQVPKTHLMTETEWRNLGVQQSPGWIHYMLHLPGNENWVKNRYET  154 (202)
Q Consensus        81 M~~~~I~YS~KY~DD~YEYRHViLPkel~K~VPK~rLLsE~EWR~LGIQQS~GW~HYmiHkPEPHILLFRRPl~  154 (202)
                      +..++|+||+||+||+||||||||||+++|+||+++||||+|||+||||||+||+|||+|+|||||||||||++
T Consensus        23 ~~~~~I~YS~kY~DD~yEYRHViLPk~~~k~ipk~~LL~E~EWR~LGIqqS~GW~HY~~h~pEphILLFRRp~t   96 (96)
T PTZ00453         23 KLQSKILYSDKYYDDEYEYRHVILPKDFARLVPRSRLMSESEWRQLGVQQSVGWRHYMIHKPEPHVLLFKRPKT   96 (96)
T ss_pred             hccccceeCCceeCCCcEEEEEEeCHHHHHhCCCCccccHHHHHHhhhccCCCcEEeeecCCCCcEEEEecCCC
Confidence            34679999999999999999999999999999999999999999999999999999999999999999999974


No 5  
>PLN00010 cyclin-dependent kinases regulatory subunit; Provisional
Probab=90.73  E-value=0.16  Score=39.43  Aligned_cols=16  Identities=50%  Similarity=0.918  Sum_probs=13.3

Q ss_pred             ecceEEeeeCCCCCCC
Q psy4005          14 LEPHVLLFRRPKQPTP   29 (202)
Q Consensus        14 ~~~~~~~~~~~~~~~~   29 (202)
                      -|||+||||||..-.+
T Consensus        60 pEphILlFrRp~~~~~   75 (86)
T PLN00010         60 PEPHIMLFRRPLNYQQ   75 (86)
T ss_pred             CCceEEEEEccCCCCC
Confidence            4999999999987554


No 6  
>KOG3484|consensus
Probab=90.25  E-value=0.15  Score=39.91  Aligned_cols=13  Identities=69%  Similarity=1.244  Sum_probs=11.2

Q ss_pred             ecceEEeeeCCCC
Q psy4005          14 LEPHVLLFRRPKQ   26 (202)
Q Consensus        14 ~~~~~~~~~~~~~   26 (202)
                      -|||+||||||+.
T Consensus        62 PEpHIlLFrRp~~   74 (91)
T KOG3484|consen   62 PEPHILLFRRPLN   74 (91)
T ss_pred             CCceEEEEecccc
Confidence            3899999999874


No 7  
>PF01111 CKS:  Cyclin-dependent kinase regulatory subunit;  InterPro: IPR000789 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. In eukaryotes, cyclin-dependent protein kinases interact with cyclins to regulate cell cycle progression, and are required for the G1 and G2 stages of cell division []. The proteins bind to a regulatory subunit, cyclin-dependent kinase regulatory subunit (CKS), which is essential for their function. This regulatory subunit is a small protein of 79 to 150 residues. In yeast (gene CKS1) and in fission yeast (gene suc1) a single isoform is known, while mammals have two highly related isoforms. The regulatory subunits exist as hexamers, formed by the symmetrical assembly of 3 interlocked homodimers, creating an unusual 12-stranded beta-barrel structure []. Through the barrel centre runs a 12A diameter tunnel, lined by 6 exposed helix pairs []. Six kinase units can be modelled to bind the hexameric structure, which may thus act as a hub for cyclin-dependent protein kinase multimerisation [, ].; GO: 0016538 cyclin-dependent protein kinase regulator activity, 0007049 cell cycle; PDB: 1CKS_C 3QY2_B 1QB3_C 1SCE_B 1PUC_A 1DKS_B 2AST_C 1BUH_B 1DKT_B 2ASS_C.
Probab=87.68  E-value=0.2  Score=37.41  Aligned_cols=12  Identities=75%  Similarity=1.328  Sum_probs=10.8

Q ss_pred             ecceEEeeeCCC
Q psy4005          14 LEPHVLLFRRPK   25 (202)
Q Consensus        14 ~~~~~~~~~~~~   25 (202)
                      -|||+||||||+
T Consensus        58 pephiLlFrRp~   69 (70)
T PF01111_consen   58 PEPHILLFRRPL   69 (70)
T ss_dssp             SSTTEEEEEEEC
T ss_pred             CCCcEEEEecCC
Confidence            489999999996


No 8  
>PF13783 DUF4177:  Domain of unknown function (DUF4177)
Probab=75.96  E-value=3.1  Score=28.62  Aligned_cols=52  Identities=17%  Similarity=0.227  Sum_probs=34.4

Q ss_pred             ceeEEEEEcChHHHhhCCCCCCCCHHHHhhhccccCCCeeEeeecCC---------CceeEEEecc
Q psy4005          96 NYIYRHVMLPPDLAKQVPKTHLMTETEWRNLGVQQSPGWIHYMLHLP---------GNENWVKNRY  152 (202)
Q Consensus        96 ~YEYRHViLPkel~K~VPK~rLLsE~EWR~LGIQQS~GW~HYmiHkP---------EPHILLFRRP  152 (202)
                      .|||+.|.++......++...  -|++...+|   ..||+=-.+..+         +..+|+|+|+
T Consensus         1 ~~EYk~v~~~~~~~~~~~~~~--~~~~Ln~~g---~eGWeLV~~~~~~~~~~~g~~~~~~~ifkRe   61 (61)
T PF13783_consen    1 KWEYKVVEVPTGGFFGIDPED--LEEILNEYG---KEGWELVSIIPPFEPGGYGGTEGYVLIFKRE   61 (61)
T ss_pred             CcceEEEEEecccccCCCHHH--HHHHHHHHH---hCCcEEEEEEcCCcccCCCCcceEEEEEEcC
Confidence            489999998875443322211  145566666   569987777666         2578999986


No 9  
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]
Probab=37.71  E-value=15  Score=34.61  Aligned_cols=21  Identities=38%  Similarity=0.534  Sum_probs=18.7

Q ss_pred             cCCcccccccccCCccceeee
Q psy4005         162 RDFSVLSQQDKQGGHVGYARL  182 (202)
Q Consensus       162 ~dp~~~~~q~~q~~~~~~~~~  182 (202)
                      ..|.|+-++.+-||||||--=
T Consensus       300 ~np~v~l~~t~~GGHvGfl~~  320 (345)
T COG0429         300 LNPNVLLQLTEHGGHVGFLGG  320 (345)
T ss_pred             CCCceEEEeecCCceEEeccC
Confidence            789999999999999999653


No 10 
>PF05972 APC_15aa:  APC 15 residue motif;  InterPro: IPR009240 The 15 aa repeat is found in the APC protein family. It is involved in binding beta-catenin [] along with the IPR009223 from INTERPRO repeats. Many human cancer mutations map to the region around these motifs, and may be involved in disrupting their binding of beta-catenin.; GO: 0008013 beta-catenin binding, 0016055 Wnt receptor signaling pathway; PDB: 1JPP_C.
Probab=34.44  E-value=19  Score=20.60  Aligned_cols=13  Identities=38%  Similarity=0.698  Sum_probs=6.4

Q ss_pred             CCeeecCCcCCCc
Q psy4005          84 DDIRYSDKYEDDN   96 (202)
Q Consensus        84 ~~I~YS~KY~DD~   96 (202)
                      .+|.||.||..++
T Consensus         4 qP~dyS~kY~e~~   16 (16)
T PF05972_consen    4 QPIDYSLKYSEEQ   16 (16)
T ss_dssp             ----CCCCTTT--
T ss_pred             cccchhhhccccC
Confidence            3588999998763


No 11 
>TIGR02011 IscA iron-sulfur cluster assembly protein IscA. This clade is limited to the proteobacteria.
Probab=33.59  E-value=30  Score=26.02  Aligned_cols=17  Identities=29%  Similarity=0.835  Sum_probs=12.2

Q ss_pred             EEeeeCCCCCCCcccccCC
Q psy4005          18 VLLFRRPKQPTPTSCSCGN   36 (202)
Q Consensus        18 ~~~~~~~~~~~~~~~~~gn   36 (202)
                      -+.|..|.  .+.+|+||+
T Consensus        85 ~F~~~nPn--a~~~CgCg~  101 (105)
T TIGR02011        85 GFKFTNPN--VKDECGCGE  101 (105)
T ss_pred             eEEEECCC--CCccCCCCC
Confidence            35666766  468999994


No 12 
>PRK09502 iscA iron-sulfur cluster assembly protein; Provisional
Probab=32.27  E-value=32  Score=25.98  Aligned_cols=17  Identities=29%  Similarity=0.806  Sum_probs=12.6

Q ss_pred             EEeeeCCCCCCCcccccCC
Q psy4005          18 VLLFRRPKQPTPTSCSCGN   36 (202)
Q Consensus        18 ~~~~~~~~~~~~~~~~~gn   36 (202)
                      -+.|..|..  ..+|+||+
T Consensus        87 ~F~f~NPna--~~~CgCG~  103 (107)
T PRK09502         87 GFKFTNPNV--KDECGCGE  103 (107)
T ss_pred             eEEEECCCC--CCccCCCC
Confidence            456777765  57999995


No 13 
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1. This model represents type 1 of two non-homologous families of the enzyme isopentenyl-diphosphate delta-isomerase (IPP isomerase). IPP is an essential building block for many compounds, including enzyme cofactors, sterols, and prenyl groups. This inzyme interconverts isopentenyl diphosphate and dimethylallyl diphosphate.
Probab=28.26  E-value=89  Score=24.62  Aligned_cols=27  Identities=11%  Similarity=0.074  Sum_probs=19.6

Q ss_pred             eeecCCCceeEEEecccccccCCCccC
Q psy4005         137 YMLHLPGNENWVKNRYETLVRLRGKRD  163 (202)
Q Consensus       137 YmiHkPEPHILLFRRPl~~~~l~g~~d  163 (202)
                      -.+...+.+|||-||..+....+|.-|
T Consensus        32 v~v~~~~g~vLl~kR~~~k~~~PG~W~   58 (158)
T TIGR02150        32 VFLFNEEGQLLLQRRALSKITWPGVWT   58 (158)
T ss_pred             EEEEcCCCeEEEEeccCCCcCCCCCcc
Confidence            457788899999999876555555444


No 14 
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional
Probab=25.29  E-value=1e+02  Score=24.89  Aligned_cols=29  Identities=14%  Similarity=0.029  Sum_probs=19.8

Q ss_pred             cccCCCeeEee----ecCCCceeEEEecccccc
Q psy4005         128 VQQSPGWIHYM----LHLPGNENWVKNRYETLV  156 (202)
Q Consensus       128 IQQS~GW~HYm----iHkPEPHILLFRRPl~~~  156 (202)
                      +++..|..|..    +..++-+|||-||+.+..
T Consensus        26 ~~~~~~~~h~av~v~i~~~~g~vLL~rR~~~~~   58 (184)
T PRK03759         26 AHTADTPLHLAFSCYLFDADGRLLVTRRALSKK   58 (184)
T ss_pred             HHhcCCCeeeEEEEEEEcCCCeEEEEEccCCCC
Confidence            34455655655    667788999999976544


No 15 
>PF09355 Phage_Gp19:  Phage protein Gp19/Gp15/Gp42;  InterPro: IPR018963 This entry is represented by Mycobacteriophage D29, Gp19. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=23.14  E-value=52  Score=26.06  Aligned_cols=21  Identities=19%  Similarity=0.210  Sum_probs=16.6

Q ss_pred             CCCCCCHHHHhhhccccCCCe
Q psy4005         114 KTHLMTETEWRNLGVQQSPGW  134 (202)
Q Consensus       114 K~rLLsE~EWR~LGIQQS~GW  134 (202)
                      .+-.++.+||+.||+...+-+
T Consensus        88 G~L~i~~~E~~~LGl~~~r~g  108 (116)
T PF09355_consen   88 GGLYITDSELARLGLSRQRYG  108 (116)
T ss_pred             CCEEECHHHHHHhCcccCcce
Confidence            345799999999999886543


No 16 
>PTZ00235 DNA polymerase epsilon subunit B; Provisional
Probab=22.39  E-value=39  Score=31.08  Aligned_cols=49  Identities=14%  Similarity=0.269  Sum_probs=37.3

Q ss_pred             ecceEEeeeCC-CCC-------CCcccccCC--CccccchhhhhHHHhhhhcCCCcccc
Q psy4005          14 LEPHVLLFRRP-KQP-------TPTSCSCGN--NSVQEESAYGKFEFCRAAAAPSLIPV   62 (202)
Q Consensus        14 ~~~~~~~~~~~-~~~-------~~~~~~~gn--~sv~~ds~Y~~~e~~~~~~kp~f~PV   62 (202)
                      =-|+.++.-.. -++       +.+.|.|-|  ||..++..+..|.-++..++.-+.||
T Consensus       233 PlPd~ivL~D~s~~~~~~~~~~~~~~~~~~Np~gsF~~~~sF~~Y~~~~~~~~~~~~~~  291 (291)
T PTZ00235        233 PLPHFICVCDNSCNSFISYASEDTSDCIISNSDMSFTRKKTFTVYSALHHEAKRYVVPL  291 (291)
T ss_pred             CCCCEEEEecCCCCccceeecccCCceEEECCCCccCCCceEEEEehhcceeheeeccC
Confidence            35777666555 455       778999999  59999988888888888888766664


No 17 
>PF07254 DUF1434:  Protein of unknown function (DUF1434);  InterPro: IPR009883 This family consists of several hypothetical bacterial proteins of around 135 residues in length. Members of this family all appear to be Enterobacterial proteins. The function of this family is unknown.
Probab=21.56  E-value=48  Score=27.07  Aligned_cols=11  Identities=45%  Similarity=0.999  Sum_probs=9.6

Q ss_pred             CCCHHHHhhhc
Q psy4005         117 LMTETEWRNLG  127 (202)
Q Consensus       117 LLsE~EWR~LG  127 (202)
                      =|+|+|||.|.
T Consensus       116 sm~~~ewR~Lr  126 (132)
T PF07254_consen  116 SMSDEEWRHLR  126 (132)
T ss_pred             CCCHHHHHHHH
Confidence            58999999885


No 18 
>TIGR00049 Iron-sulfur cluster assembly accessory protein. Proteins in this subfamily appear to be associated with the process of FeS-cluster assembly. The HesB proteins are associated with the nif gene cluster and the Rhizobium gene IscN has been shown to be required for nitrogen fixation. Nitrogenase includes multiple FeS clusters and many genes for their assembly. The E. coli SufA protein is associated with SufS, a NifS homolog and SufD which are involved in the FeS cluster assembly of the FhnF protein. The Azotobacter protein IscA (homologs of which are also found in E.coli) is associated which IscS, another NifS homolog and IscU, a nifU homolog as well as other factors consistent with a role in FeS cluster chemistry. A homolog from Geobacter contains a selenocysteine in place of an otherwise invariant cysteine, further suggesting a role in redox chemistry.
Probab=21.05  E-value=72  Score=23.38  Aligned_cols=17  Identities=29%  Similarity=0.931  Sum_probs=11.8

Q ss_pred             EeeeCCCCCCCcccccCCC
Q psy4005          19 LLFRRPKQPTPTSCSCGNN   37 (202)
Q Consensus        19 ~~~~~~~~~~~~~~~~gn~   37 (202)
                      +.|..|.+  +.+|+||..
T Consensus        86 f~i~nPn~--~~~c~cg~s  102 (105)
T TIGR00049        86 FTFTNPNA--KGTCGCGKS  102 (105)
T ss_pred             EEEECCCC--CccCCCCcC
Confidence            45566664  688999964


No 19 
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate 
Probab=20.57  E-value=1.8e+02  Score=21.56  Aligned_cols=21  Identities=14%  Similarity=-0.047  Sum_probs=15.8

Q ss_pred             EeeecCCCceeEEEecccccc
Q psy4005         136 HYMLHLPGNENWVKNRYETLV  156 (202)
Q Consensus       136 HYmiHkPEPHILLFRRPl~~~  156 (202)
                      +-.++.+..+|||-||..+..
T Consensus         4 ~v~i~~~~~~iLl~~R~~~~~   24 (126)
T cd04697           4 YIFVFNSEGKLCVHKRTLTKD   24 (126)
T ss_pred             EEEEEcCCCeEEEEECCCCCC
Confidence            456778888999988876544


No 20 
>PF13975 gag-asp_proteas:  gag-polyprotein putative aspartyl protease
Probab=20.35  E-value=64  Score=22.57  Aligned_cols=18  Identities=17%  Similarity=0.326  Sum_probs=15.5

Q ss_pred             CCCCHHHHhhhccccCCC
Q psy4005         116 HLMTETEWRNLGVQQSPG  133 (202)
Q Consensus       116 rLLsE~EWR~LGIQQS~G  133 (202)
                      -||+++.|+.||++.++.
T Consensus        31 ~fis~~~a~rLgl~~~~~   48 (72)
T PF13975_consen   31 NFISESLAKRLGLPLEKP   48 (72)
T ss_pred             eecCHHHHHHhCCCcccC
Confidence            599999999999987653


No 21 
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belong to this superfamily requires a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate spe
Probab=20.19  E-value=1.4e+02  Score=23.74  Aligned_cols=33  Identities=21%  Similarity=0.280  Sum_probs=23.9

Q ss_pred             cCCCeeEeeec------CCC--ceeEEEecccccccCCCcc
Q psy4005         130 QSPGWIHYMLH------LPG--NENWVKNRYETLVRLRGKR  162 (202)
Q Consensus       130 QS~GW~HYmiH------kPE--PHILLFRRPl~~~~l~g~~  162 (202)
                      ...|..|..+|      +.+  .++||-||..+..--+|.-
T Consensus        26 ~~~g~~h~~v~~~~~~~~~~~~~~l~lqrRs~~K~~~Pg~w   66 (180)
T cd03676          26 RLFGLVTYGVHLNGYVRDEDGGLRIWIPRRSPTKATWPGML   66 (180)
T ss_pred             ccCCceEEEEEEEEEEEcCCCCeEEEEEeccCCCCCCCCce
Confidence            35789999888      554  8999999998765333333


No 22 
>PF10738 Lpp-LpqN:  Probable lipoprotein LpqN;  InterPro: IPR019674  This protein is conserved in Mycobacteriaceae and is likely to be a lipoprotein []. 
Probab=20.13  E-value=70  Score=27.01  Aligned_cols=42  Identities=21%  Similarity=0.249  Sum_probs=27.8

Q ss_pred             hccccCCCeeEeeecCCCceeEE--Eeccc---------ccccCCCccCCccc
Q psy4005         126 LGVQQSPGWIHYMLHLPGNENWV--KNRYE---------TLVRLRGKRDFSVL  167 (202)
Q Consensus       126 LGIQQS~GW~HYmiHkPEPHILL--FRRPl---------~~~~l~g~~dp~~~  167 (202)
                      +-|.+-+||+++.--.+++--++  .+...         ....|+|..||+-+
T Consensus        33 v~lP~P~GW~~~~~~~~~~a~~vi~~~~~~~~~~Pnavv~V~kL~G~~Dp~e~   85 (175)
T PF10738_consen   33 VSLPTPPGWEPAPDPNPPWAYAVIVDPQADGGFPPNAVVTVSKLTGDFDPAEA   85 (175)
T ss_pred             EeccCCcCcccCCCCCCCceEEEEEeccccCCCCCceEEEEEeccCCCCHHHH
Confidence            56889999999876666553333  33311         12278999999765


Done!