BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy4031
         (115 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1DJ2|A Chain A, Structures Of Adenylosuccinate Synthetase From Triticum
           Aestivum And Arabidopsis Thaliana
 pdb|1DJ2|B Chain B, Structures Of Adenylosuccinate Synthetase From Triticum
           Aestivum And Arabidopsis Thaliana
          Length = 443

 Score = 29.3 bits (64), Expect = 0.51,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 53  IHTPYPVSSQSDGTHSTYLDTAGRPMITLRAHNLVENHIE-DIEIEYEFSKSYLG 106
           +H P  +  + DG  S  +   GR +++ RAH L + H E D   E E +KS++G
Sbjct: 93  VHLP-GLFKEIDGLESNGVSCKGRILVSDRAHLLFDFHQEVDGLRESELAKSFIG 146


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.133    0.406 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,586,626
Number of Sequences: 62578
Number of extensions: 133532
Number of successful extensions: 271
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 264
Number of HSP's gapped (non-prelim): 8
length of query: 115
length of database: 14,973,337
effective HSP length: 78
effective length of query: 37
effective length of database: 10,092,253
effective search space: 373413361
effective search space used: 373413361
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)