BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy4031
(115 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1DJ2|A Chain A, Structures Of Adenylosuccinate Synthetase From Triticum
Aestivum And Arabidopsis Thaliana
pdb|1DJ2|B Chain B, Structures Of Adenylosuccinate Synthetase From Triticum
Aestivum And Arabidopsis Thaliana
Length = 443
Score = 29.3 bits (64), Expect = 0.51, Method: Composition-based stats.
Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
Query: 53 IHTPYPVSSQSDGTHSTYLDTAGRPMITLRAHNLVENHIE-DIEIEYEFSKSYLG 106
+H P + + DG S + GR +++ RAH L + H E D E E +KS++G
Sbjct: 93 VHLP-GLFKEIDGLESNGVSCKGRILVSDRAHLLFDFHQEVDGLRESELAKSFIG 146
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.133 0.406
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,586,626
Number of Sequences: 62578
Number of extensions: 133532
Number of successful extensions: 271
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 264
Number of HSP's gapped (non-prelim): 8
length of query: 115
length of database: 14,973,337
effective HSP length: 78
effective length of query: 37
effective length of database: 10,092,253
effective search space: 373413361
effective search space used: 373413361
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)