BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy4032
(84 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2FUG|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus
pdb|2FUG|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus
pdb|2FUG|O Chain O, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus
pdb|2FUG|X Chain X, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus
pdb|3I9V|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus, Oxidized, 2 MolASU
pdb|3I9V|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus, Oxidized, 2 MolASU
pdb|3IAM|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus, Reduced, 2 MolASU,
WITH BOUND NADH
pdb|3IAM|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus, Reduced, 2 MolASU,
WITH BOUND NADH
pdb|3IAS|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
RE-Refined To 3.15 Angstrom Resolution
pdb|3IAS|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
RE-Refined To 3.15 Angstrom Resolution
pdb|3IAS|O Chain O, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
RE-Refined To 3.15 Angstrom Resolution
pdb|3IAS|X Chain X, Crystal Structure Of The Hydrophilic Domain Of Respiratory
Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
RE-Refined To 3.15 Angstrom Resolution
pdb|3M9S|6 Chain 6, Crystal Structure Of Respiratory Complex I From Thermus
Thermophilus
pdb|3M9S|F Chain F, Crystal Structure Of Respiratory Complex I From Thermus
Thermophilus
pdb|2YBB|6 Chain 6, Fitted Model For Bovine Mitochondrial Supercomplex
I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
pdb|4HEA|6 Chain 6, Crystal Structure Of The Entire Respiratory Complex I From
Thermus Thermophilus
pdb|4HEA|G Chain G, Crystal Structure Of The Entire Respiratory Complex I From
Thermus Thermophilus
Length = 181
Score = 56.6 bits (135), Expect = 3e-09, Method: Compositional matrix adjust.
Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
Query: 9 QAMLGPVGVISMGGAAPNXXXXXXXXXXXXXXCDRIIPVDIYVPGCPPTAEALMYGILQL 68
+ M P VISMG A + D ++PVD+YVPGCPP EAL+Y ++QL
Sbjct: 97 EQMPDPKWVISMGACASSGGMFNNYAIVQN--VDSVVPVDVYVPGCPPRPEALIYAVMQL 154
Query: 69 QKKVK 73
QKKV+
Sbjct: 155 QKKVR 159
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.141 0.438
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,936,212
Number of Sequences: 62578
Number of extensions: 46621
Number of successful extensions: 130
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 129
Number of HSP's gapped (non-prelim): 7
length of query: 84
length of database: 14,973,337
effective HSP length: 52
effective length of query: 32
effective length of database: 11,719,281
effective search space: 375016992
effective search space used: 375016992
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)