Diaphorina citri psyllid: psy4041


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MFAFSGDYLCASISCATTVLMWMCDKPEVVIMYQVGEDKFVSYCMNQKTEKPVLSGQRIKTRKRDEKEKYDPAGFRDYILSGLNAAGTDLEAVSKFLDIAGSKVDYRRYGEALFDILIAGGLLGKTLDPTTRAGVMVCRICKTTACIFEAQEDMQSLKNFEQ
cccccccEEEEEEHHHHHHHHHHcccccEEEEEEEcccEEEEEEEccccccccccccEEECcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccHHHHHHHcc
**AFSGDYLCASISCATTVLMWMCDKPEVVIMYQVGEDKFVSYCMNQK*********************YDPAGFRDYILSGLNAAGTDLEAVSKFLDIAGSKVDYRRYGEALFDILIAGGLLGKTLD***RAGVMVCRICKTTACIFEAQEDMQ*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAFSGDYLCASISCATTVLMWMCDKPEVVIMYQVGEDKFVSYCMNQKTEKPVLSGQRIKTRKRDEKEKYDPAGFRDYILSGLNAAGTDLEAVSKFLDIAGSKVDYRRYGEALFDILIAGGLLGKTLDPTTRAGVMVCRICKTTACIFEAQEDMQSLKNFEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein extra bases May be involved in memory formation.confidentQ9VNE2
Basic leucine zipper and W2 domain-containing protein 1 Enhances histone H4 gene transcription but does not seem to bind DNA directly.confidentQ9CQC6
Basic leucine zipper and W2 domain-containing protein 1 Enhances histone H4 gene transcription but does not seem to bind DNA directly.confidentQ5ZLT7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0031369 [MF]translation initiation factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0017148 [BP]negative regulation of translationprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0050789, GO:0051248, GO:0010605, GO:0019222, GO:0010608, GO:0051246, GO:2000113, GO:0065007, GO:0031326, GO:0048519, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032269, GO:0032268, GO:0010556, GO:0006417, GO:0010558, GO:0048523
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted