Query         psy405
Match_columns 66
No_of_seqs    105 out of 363
Neff          5.9 
Searched_HMMs 46136
Date          Sat Aug 17 00:02:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy405.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/405hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 smart00501 BRIGHT BRIGHT, ARID  99.8 2.3E-20 4.9E-25  111.9   4.6   51   15-65      2-52  (93)
  2 PF01388 ARID:  ARID/BRIGHT DNA  99.8 7.1E-20 1.5E-24  108.9   4.5   55   11-65      2-56  (92)
  3 KOG2744|consensus               99.5 3.1E-15 6.7E-20  112.3   3.8   54   12-65    160-213 (512)
  4 KOG2510|consensus               98.6 2.5E-08 5.4E-13   75.3   3.8   53   13-65    291-343 (532)
  5 PRK02922 glycogen synthesis pr  70.7     2.8   6E-05   24.3   1.3   31   12-43      7-37  (67)
  6 cd07268 Glo_EDI_BRP_like_4 Thi  64.6     2.8   6E-05   27.7   0.5   44   15-59     10-53  (149)
  7 PF14475 Mso1_Sec1_bdg:  Sec1-b  61.2      15 0.00033   19.3   2.9   31    5-35      8-38  (41)
  8 COG0043 UbiD 3-polyprenyl-4-hy  56.1      16 0.00036   28.0   3.4   50    2-51     81-134 (477)
  9 PRK11700 hypothetical protein;  54.2     4.1   9E-05   27.8  -0.0   39   20-59     53-91  (187)
 10 PF06185 YecM:  YecM protein;    52.1      16 0.00035   24.8   2.6   39   18-57     46-84  (185)
 11 PF10281 Ish1:  Putative stress  49.7      20 0.00044   17.7   2.1   18   21-38      7-24  (38)
 12 cd07353 harmonin_N N-terminal   48.9      15 0.00033   21.7   1.8   23   10-32     16-38  (79)
 13 cd07356 HN_L-whirlin_R1_like F  48.8      23 0.00051   21.0   2.6   20   12-31     17-36  (78)
 14 cd01478 Sec23-like Sec23-like:  45.1      36 0.00079   23.7   3.6   48   13-61    203-250 (267)
 15 PF02639 DUF188:  Uncharacteriz  42.6      41 0.00089   21.3   3.2   25    4-28    105-129 (130)
 16 smart00805 AGTRAP Angiotensin   39.4      16 0.00035   24.4   1.0   21   43-63    101-121 (159)
 17 cd02879 GH18_plant_chitinase_c  39.1      42 0.00091   23.4   3.1   20   12-31     89-108 (299)
 18 PF08971 GlgS:  Glycogen synthe  38.9      14 0.00029   21.4   0.5   30   11-41      5-34  (66)
 19 PF12496 BNIP2:  Bcl2-/adenovir  38.5     6.5 0.00014   25.2  -0.9   26   36-61     95-124 (127)
 20 PHA03149 hypothetical protein;  38.5     9.7 0.00021   21.9  -0.1   29   25-57      6-34  (66)
 21 PF15643 Tox-PL-2:  Papain fold  38.0      33 0.00072   21.3   2.2   35   14-48     19-53  (100)
 22 PF14639 YqgF:  Holliday-juncti  37.4      36 0.00078   21.9   2.4   41   12-55     44-84  (150)
 23 cd00598 GH18_chitinase-like Th  36.4      53  0.0012   20.8   3.1   21   11-31     84-104 (210)
 24 PRK00124 hypothetical protein;  36.3      60  0.0013   21.3   3.3   26    4-29    121-146 (151)
 25 cd02876 GH18_SI-CLP Stabilin-1  36.1      52  0.0011   23.0   3.2   20   12-31     89-108 (318)
 26 cd06548 GH18_chitinase The GH1  35.2      50  0.0011   23.1   3.0   20   12-31    106-125 (322)
 27 cd06545 GH18_3CO4_chitinase Th  34.6      53  0.0011   22.1   3.0   20   12-31     80-99  (253)
 28 cd02873 GH18_IDGF The IDGF's (  33.3      58  0.0013   24.0   3.2   20   12-31    102-121 (413)
 29 COG1671 Uncharacterized protei  31.7      80  0.0017   20.9   3.3   27    3-29    119-145 (150)
 30 PF09441 Abp2:  ARS binding pro  31.7      35 0.00076   23.1   1.7   23   35-57     43-65  (175)
 31 PF00704 Glyco_hydro_18:  Glyco  31.6      47   0.001   22.7   2.4   27   13-47     97-123 (343)
 32 cd02874 GH18_CFLE_spore_hydrol  31.5      67  0.0015   22.2   3.2   19   13-31     85-103 (313)
 33 smart00636 Glyco_18 Glycosyl h  30.6      67  0.0015   22.2   3.0   19   13-31     89-107 (334)
 34 cd02878 GH18_zymocin_alpha Zym  30.1      72  0.0016   22.7   3.2   20   12-31     88-107 (345)
 35 cd06549 GH18_trifunctional GH1  29.0      78  0.0017   22.0   3.2   19   13-31     86-104 (298)
 36 PRK02363 DNA-directed RNA poly  28.6      79  0.0017   20.1   2.9   34   17-61      3-36  (129)
 37 PRK05089 cytochrome C oxidase   28.5      33 0.00072   23.3   1.2   18   45-62     32-49  (188)
 38 COG3175 COX11 Cytochrome oxida  28.1      31 0.00067   23.7   1.0   18   44-61     31-48  (195)
 39 PTZ00417 lysine-tRNA ligase; P  27.9 1.1E+02  0.0024   24.1   4.0   50   13-63    253-324 (585)
 40 PF00586 AIRS:  AIR synthase re  27.3   1E+02  0.0023   17.5   3.1   31    8-43     65-95  (96)
 41 PF15412 Nse4-Nse3_bdg:  Bindin  27.3      61  0.0013   17.5   1.9   22   11-32     23-44  (56)
 42 PF03823 Neurokinin_B:  Neuroki  26.5      30 0.00064   19.5   0.6   16   40-55     36-51  (59)
 43 cd02872 GH18_chitolectin_chito  26.5      93   0.002   21.9   3.2   19   13-31     94-112 (362)
 44 KOG4588|consensus               26.3      76  0.0017   22.8   2.7   32   13-44    201-232 (267)
 45 PF09153 DUF1938:  Domain of un  25.8      78  0.0017   19.1   2.3   24   12-35     29-56  (86)
 46 PHA02128 hypothetical protein   25.7      68  0.0015   20.7   2.2   42   24-65     39-80  (151)
 47 PF04442 CtaG_Cox11:  Cytochrom  25.6      23  0.0005   23.3   0.0   19   45-63      2-20  (152)
 48 PTZ00128 cytochrome c oxidase   25.5      42  0.0009   23.6   1.2   20   44-63     74-93  (232)
 49 cd06544 GH18_narbonin Narbonin  25.3      97  0.0021   21.5   3.1   18   14-31     96-113 (253)
 50 cd02875 GH18_chitobiase Chitob  25.2      93   0.002   22.4   3.1   20   12-31     93-112 (358)
 51 COG0317 SpoT Guanosine polypho  25.0      38 0.00083   27.3   1.1   48    7-58    209-256 (701)
 52 cd07347 harmonin_N_like N-term  25.0      98  0.0021   18.1   2.6   21   12-32     17-37  (78)
 53 PF00727 IL4:  Interleukin 4 Th  24.7      65  0.0014   20.4   1.9   16   15-30    100-115 (117)
 54 PLN00162 transport protein sec  24.4      95  0.0021   25.0   3.2   49   12-61    323-371 (761)
 55 PF09425 CCT_2:  Divergent CCT   24.3      56  0.0012   15.7   1.2   14   21-34      6-19  (27)
 56 KOG2265|consensus               24.2      60  0.0013   22.1   1.8   20   13-32    151-170 (179)
 57 cd06546 GH18_CTS3_chitinase GH  23.7 1.1E+02  0.0024   21.1   3.1   20   12-31     93-112 (256)
 58 PF05066 HARE-HTH:  HB1, ASXL,   23.6      41 0.00088   18.5   0.8   21   42-62     15-35  (72)
 59 PF02337 Gag_p10:  Retroviral G  23.3      73  0.0016   19.2   1.9   21   15-35      6-26  (90)
 60 PF06396 AGTRAP:  Angiotensin I  23.1      42 0.00091   22.3   0.9   21   42-62    100-120 (162)
 61 cd01468 trunk_domain trunk dom  23.1      73  0.0016   21.3   2.1   47   14-61    172-218 (239)
 62 PF03875 Statherin:  Statherin;  23.0      93   0.002   16.2   2.0   20   15-34      3-22  (42)
 63 PF07875 Coat_F:  Coat F domain  22.7      69  0.0015   17.3   1.6   14   48-61     48-61  (64)
 64 cd02871 GH18_chitinase_D-like   22.5 1.1E+02  0.0023   21.5   2.9   20   12-31     91-110 (312)
 65 COG1190 LysU Lysyl-tRNA synthe  22.0 1.7E+02  0.0038   22.9   4.1   48   15-63    182-251 (502)
 66 PF03808 Glyco_tran_WecB:  Glyc  21.8 1.3E+02  0.0029   19.2   3.0   53    2-58     20-72  (172)
 67 PRK12445 lysyl-tRNA synthetase  21.8 1.6E+02  0.0035   22.6   3.9   50   13-63    184-255 (505)
 68 PF10813 DUF2733:  Protein of u  20.6      42 0.00091   16.7   0.4   13   40-52     18-30  (32)
 69 cd01479 Sec24-like Sec24-like:  20.4 1.1E+02  0.0023   20.9   2.4   45   16-61    171-215 (244)
 70 cd06542 GH18_EndoS-like Endo-b  20.0 1.6E+02  0.0035   19.6   3.3   20   12-31     85-104 (255)

No 1  
>smart00501 BRIGHT BRIGHT, ARID (A/T-rich interaction domain) domain. DNA-binding domain containing a helix-turn-helix structure
Probab=99.81  E-value=2.3e-20  Score=111.94  Aligned_cols=51  Identities=45%  Similarity=0.812  Sum_probs=49.2

Q ss_pred             hHHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCcccceec
Q psy405           15 EKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGGWVKKCT   65 (66)
Q Consensus        15 ~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG~~~Vt~   65 (66)
                      +++.|+++|.+||+++|+|+.++|+|+|++||||+||.+|+++||+++||.
T Consensus         2 ~~~~F~~~L~~F~~~~g~~~~~~P~i~g~~vdL~~Ly~~V~~~GG~~~v~~   52 (93)
T smart00501        2 ERVLFLDRLYKFMEERGSPLKKIPVIGGKPLDLYRLYRLVQERGGYDQVTK   52 (93)
T ss_pred             cHHHHHHHHHHHHHHcCCcCCcCCeECCEeCcHHHHHHHHHHccCHHHHcC
Confidence            678999999999999999999999999999999999999999999999984


No 2  
>PF01388 ARID:  ARID/BRIGHT DNA binding domain;  InterPro: IPR001606 Members of the recently discovered ARID (AT-rich interaction domain; also known as BRIGHT domain)) family of DNA-binding proteins are found in fungi and invertebrate and vertebrate metazoans. ARID-encoding genes are involved in a variety of biological processes including embryonic development, cell lineage gene regulation and cell cycle control. Although the specific roles of this domain and of ARID-containing proteins in transcriptional regulation are yet to be elucidated, they include both positive and negative transcriptional regulation and a likely involvement in the modification of chromatin structure []. The basic structure of the ARID domain domain appears to be a series of six alpha-helices separated by beta-strands, loops, or turns, but the structured region may extend to an additional helix at either or both ends of the basic six. Based on primary sequence homology, they can be partitioned into three structural classes: Minimal ARID proteins that consist of a core domain formed by six alpha helices; ARID proteins that supplement the core domain with an N-terminal alpha-helix; and Extended-ARID proteins, which contain the core domain and additional alpha-helices at their N- and C-termini. The human SWI-SNF complex protein p270 is an ARID family member with non-sequence-specific DNA binding activity. The ARID consensus and other structural features are common to both p270 and yeast SWI1, suggesting that p270 is a human counterpart of SWI1 []. The approximately 100-residue ARID sequence is present in a series of proteins strongly implicated in the regulation of cell growth, development, and tissue-specific gene expression. Although about a dozen ARID proteins can be identified from database searches, to date, only Bright (a regulator of B-cell-specific gene expression), dead ringer (a Drosophila melanogaster gene product required for normal development), and MRF-2 (which represses expression from the Cytomegalovirus enhancer) have been analyzed directly in regard to their DNA binding properties. Each binds preferentially to AT-rich sites. In contrast, p270 shows no sequence preference in its DNA binding activity, thereby demonstrating that AT-rich binding is not an intrinsic property of ARID domains and that ARID family proteins may be involved in a wider range of DNA interactions [].; GO: 0003677 DNA binding, 0005622 intracellular; PDB: 1C20_A 1KQQ_A 2JRZ_A 2LM1_A 2YQE_A 2JXJ_A 2EH9_A 2CXY_A 2LI6_A 1KN5_A ....
Probab=99.79  E-value=7.1e-20  Score=108.88  Aligned_cols=55  Identities=49%  Similarity=0.824  Sum_probs=49.9

Q ss_pred             cchHhHHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCcccceec
Q psy405           11 AYFKEKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGGWVKKCT   65 (66)
Q Consensus        11 ~~~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG~~~Vt~   65 (66)
                      ....+++.|++.|.+||+++|+++.++|.|+|++||||+||.+|.++||+++||.
T Consensus         2 ~~~~~~~~F~~~L~~f~~~~g~~~~~~P~i~g~~vDL~~Ly~~V~~~GG~~~V~~   56 (92)
T PF01388_consen    2 ANTREREQFLEQLREFHESRGTPIDRPPVIGGKPVDLYKLYKAVMKRGGFDKVTK   56 (92)
T ss_dssp             SSCHHHHHHHHHHHHHHHHTTSSSSS-SEETTSE-SHHHHHHHHHHHTSHHHHHH
T ss_pred             CcchHHHHHHHHHHHHHHHcCCCCCCCCcCCCEeCcHHHHHHHHHhCcCcccCcc
Confidence            3568899999999999999999999999999999999999999999999999974


No 3  
>KOG2744|consensus
Probab=99.55  E-value=3.1e-15  Score=112.27  Aligned_cols=54  Identities=43%  Similarity=0.712  Sum_probs=51.2

Q ss_pred             chHhHHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCcccceec
Q psy405           12 YFKEKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGGWVKKCT   65 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG~~~Vt~   65 (66)
                      ...+++.||++|+.||+++|+|++++|+|+|++||||.||.+|+++||+++|+.
T Consensus       160 ~~~~~eeF~~dl~~f~~~~~~~~~~iPii~~~~ldL~~Ly~lV~s~GG~~~V~~  213 (512)
T KOG2744|consen  160 VPKSSEEFMEDLRRFMKKRGTKVKSIPIIGGQPLDLHWLYALVTSRGGLDEVTN  213 (512)
T ss_pred             ccccHHHHHHHHHHHHHHhCCcceeccccCCCcchHHHHHHHHhcCCchhHhhh
Confidence            345899999999999999999999999999999999999999999999999975


No 4  
>KOG2510|consensus
Probab=98.65  E-value=2.5e-08  Score=75.29  Aligned_cols=53  Identities=32%  Similarity=0.622  Sum_probs=50.8

Q ss_pred             hHhHHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCcccceec
Q psy405           13 FKEKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGGWVKKCT   65 (66)
Q Consensus        13 ~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG~~~Vt~   65 (66)
                      ..+++.++++|+.|++++.+|++-.|.++.|+||||+||..|.++||+..|+.
T Consensus       291 qp~r~~wvDR~raF~ee~~Sp~t~~p~~gakPldl~rlYvsvke~gg~~~v~k  343 (532)
T KOG2510|consen  291 QPERKEWVDRLRAFTEERASPMTNLPAVGAKPLDLYRLYVSVKEIGGLTQVNK  343 (532)
T ss_pred             CcchhhHHHHHHHHHHhhcCcccccccccccchhHHHHHHHHHHhccceeecc
Confidence            57889999999999999999999999999999999999999999999999975


No 5  
>PRK02922 glycogen synthesis protein GlgS; Provisional
Probab=70.65  E-value=2.8  Score=24.34  Aligned_cols=31  Identities=19%  Similarity=0.306  Sum_probs=24.7

Q ss_pred             chHhHHHHHHHHHHHHHhcCCCCCCCceecCe
Q psy405           12 YFKEKESFLRDLQHFHETRGTPCRHVPKIGGK   43 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk   43 (66)
                      +.-..-.|+.+-.+||+.+|.++. ++.|.|+
T Consensus         7 ys~~~~DFlAsS~A~Me~Qgr~Id-vd~V~gn   37 (67)
T PRK02922          7 YSLNNFDFLARSFARMHAEGRPVD-IQAVTGN   37 (67)
T ss_pred             ccccchhHHHHHHHHHHHcCCCcc-HHHHHhc
Confidence            334566899999999999999998 6666554


No 6  
>cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.
Probab=64.63  E-value=2.8  Score=27.70  Aligned_cols=44  Identities=16%  Similarity=0.044  Sum_probs=36.2

Q ss_pred             hHHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCc
Q psy405           15 EKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGG   59 (66)
Q Consensus        15 ~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG   59 (66)
                      ...+..+.+++-+.+.|+-+. .=+|+||||-||+|.+.+.-.|+
T Consensus        10 n~~~~A~~w~~~l~~~G~llS-en~INGRPI~l~~L~qPl~~~~~   53 (149)
T cd07268          10 NENQTAERWKEGLLQCGELLS-ENEINGRPIALIKLEKPLQFAGW   53 (149)
T ss_pred             CCHHHHHHHHHHHHHhchhhh-ccccCCeeEEEEEcCCCceeCCc
Confidence            445667788888888998887 78999999999999988875554


No 7  
>PF14475 Mso1_Sec1_bdg:  Sec1-binding region of Mso1
Probab=61.23  E-value=15  Score=19.27  Aligned_cols=31  Identities=16%  Similarity=0.325  Sum_probs=24.6

Q ss_pred             cCCCCccchHhHHHHHHHHHHHHHhcCCCCC
Q psy405            5 TKKDGDAYFKEKESFLRDLQHFHETRGTPCR   35 (66)
Q Consensus         5 ~~~~~~~~~~~~~~Fl~~L~~F~~~rg~p~~   35 (66)
                      +..+..+.+.+.-.-...|++|..++|.|+.
T Consensus         8 l~~E~DGdteddT~v~r~l~~yY~~k~~~~P   38 (41)
T PF14475_consen    8 LSSESDGDTEDDTHVHRVLRKYYTEKGRPFP   38 (41)
T ss_pred             cccccCCCCcchhHHHHHHHHHHHHcCCCCC
Confidence            4555566677777888999999999998875


No 8  
>COG0043 UbiD 3-polyprenyl-4-hydroxybenzoate decarboxylase and related decarboxylases [Coenzyme metabolism]
Probab=56.14  E-value=16  Score=28.04  Aligned_cols=50  Identities=24%  Similarity=0.284  Sum_probs=37.7

Q ss_pred             CcccCCCCccchHhHHHHHHHHHHHHHhcCCCCCCCc----eecCeecchhhHH
Q psy405            2 AKVTKKDGDAYFKEKESFLRDLQHFHETRGTPCRHVP----KIGGKEIDLYLLY   51 (66)
Q Consensus         2 ~~~~~~~~~~~~~~~~~Fl~~L~~F~~~rg~p~~~~P----~i~gk~lDL~~Ly   51 (66)
                      |..+.-+++....+...|+..+.+........+.+.|    ++.|..+||.+|-
T Consensus        81 ~~~~~~~~p~~~~~~~~~l~~~~~~~~~~p~~~~~~p~~~~v~~~~~v~L~~LP  134 (477)
T COG0043          81 ALLLEPPPPKSFKDILDFLRKAKDALKMPPKRVSRAPCQENVLEGDEVDLSRLP  134 (477)
T ss_pred             hhhcCCCCCccHHHHHHHHHHHHHhccCCCcccccCCccceecccccCCHhhCC
Confidence            4455567777888888888888888777666666667    7888889998774


No 9  
>PRK11700 hypothetical protein; Provisional
Probab=54.17  E-value=4.1  Score=27.78  Aligned_cols=39  Identities=15%  Similarity=0.009  Sum_probs=26.6

Q ss_pred             HHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCc
Q psy405           20 LRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGG   59 (66)
Q Consensus        20 l~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG   59 (66)
                      .+.+++-+.+.|+-+. .=+|+||||-||+|...+.-.|+
T Consensus        53 Ae~w~~~l~~~G~llS-en~INGRPI~l~~L~qPl~~~~w   91 (187)
T PRK11700         53 AERWRQGFLQCGELLS-ENIINGRPICLFELDQPLQVGHW   91 (187)
T ss_pred             HHHHHHHHHHhchhhh-ccccCCeeEEEEEcCCCceeCCc
Confidence            3344444444455553 56899999999999998875554


No 10 
>PF06185 YecM:  YecM protein;  InterPro: IPR010393 This family consists of several bacterial YecM proteins of unknown function.; PDB: 1K4N_A.
Probab=52.13  E-value=16  Score=24.83  Aligned_cols=39  Identities=15%  Similarity=0.056  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhc
Q psy405           18 SFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSN   57 (66)
Q Consensus        18 ~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~   57 (66)
                      +..+.+.+-+.+.|+-+. .-+|+|||+-+|+|-+.+...
T Consensus        46 ~~A~~~~~~l~~~G~llS-en~INGRPI~l~~L~qPL~~~   84 (185)
T PF06185_consen   46 ETAERWKQALLQCGELLS-ENMINGRPICLFKLNQPLQFG   84 (185)
T ss_dssp             HHHHHHHHHHTTTEEEEE-EEEETTEEEEEEEEEEEEEET
T ss_pred             HHHHHHHHHHHHhChhhh-hceeCCeeEEEEEcCCchhcC
Confidence            333444444444453333 458999999999987766433


No 11 
>PF10281 Ish1:  Putative stress-responsive nuclear envelope protein;  InterPro: IPR018803  This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues []. 
Probab=49.66  E-value=20  Score=17.75  Aligned_cols=18  Identities=22%  Similarity=0.508  Sum_probs=14.8

Q ss_pred             HHHHHHHHhcCCCCCCCc
Q psy405           21 RDLQHFHETRGTPCRHVP   38 (66)
Q Consensus        21 ~~L~~F~~~rg~p~~~~P   38 (66)
                      ++|++|+.++|.+..+..
T Consensus         7 ~~L~~wL~~~gi~~~~~~   24 (38)
T PF10281_consen    7 SDLKSWLKSHGIPVPKSA   24 (38)
T ss_pred             HHHHHHHHHcCCCCCCCC
Confidence            689999999998877443


No 12 
>cd07353 harmonin_N N-terminal protein-binding module of harmonin. Harmonin is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein, which organizes the Usher protein network of the inner ear and the retina. Harmonin contains a single copy of this domain, which is found at the N-terminus of all three harmonin isoform classes (a, b and c), and which preceeds the first PDZ protein-binding domain, PDZ1. This harmonin_N domain binds specifically to a short internal peptide fragment of the cadherin 23 cytoplasmic domain; cadherin 23 is a component of the Usher protein network.
Probab=48.93  E-value=15  Score=21.69  Aligned_cols=23  Identities=17%  Similarity=0.183  Sum_probs=19.2

Q ss_pred             ccchHhHHHHHHHHHHHHHhcCC
Q psy405           10 DAYFKEKESFLRDLQHFHETRGT   32 (66)
Q Consensus        10 ~~~~~~~~~Fl~~L~~F~~~rg~   32 (66)
                      .+.+.+++.|.+.|+.||++-..
T Consensus        16 ie~EaEkd~lY~~Lr~YHqSm~l   38 (79)
T cd07353          16 IDNEAEKDYLYDVLRMYHQSMNL   38 (79)
T ss_pred             hccHHHHHHHHHHHHHHHhccCH
Confidence            34568899999999999998763


No 13 
>cd07356 HN_L-whirlin_R1_like First harmonin_N_like domain (repeat 1) of the long isoform of whirlin, and related domains. This subgroup contains the first of two harmonin_N_like domains of the long isoform of whirlin, and related domains. Whirlin is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein which binds various components of the Usher protein network of the inner ear and the retina: erythrocyte protein p55, usherin, VlGR1, and myosin XVa. The long isoform of whirlin contains two harmonin_N_like domains, and three PDZ protein-binding domains, PDZ1-3. This first harmonin_N_like domain precedes PDZ1, and is a putative protein-binding module based on its sequence similarity to the N-terminal domain of harmonin. This first harmonin_N_like domain has been assayed for interaction with the cytoplasmic domain of cadherin 23 (a component of the Usher network and an interacting partner of the harmonin N-domain), however no interaction could be detected. Th
Probab=48.78  E-value=23  Score=21.03  Aligned_cols=20  Identities=30%  Similarity=0.542  Sum_probs=17.8

Q ss_pred             chHhHHHHHHHHHHHHHhcC
Q psy405           12 YFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ...+++.|...|..|+..|.
T Consensus        17 s~~Er~~f~h~Ln~Y~~~Rn   36 (78)
T cd07356          17 SEAEREEFIHCLNDYHAKRN   36 (78)
T ss_pred             cHHHHHHHHHHHHHHHhccc
Confidence            45789999999999999985


No 14 
>cd01478 Sec23-like Sec23-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles. The two main classes of vesicular carriers within the endocytic and the biosynthetic pathways are COP- and clathrin-coated vesicles. Formation of COPII vesicles requires the ordered assembly of the coat built from several cytosolic components GTPase Sar1, complexes of Sec23-Sec24 and Sec13-Sec31. The process is initiated by the conversion of GDP to GTP by the GTPase Sar1 which then recruits the heterodimeric complex of Sec23 and Sec24. This heterodimeric complex generates the pre-budding complex. The final step leading to membrane deformation and budding of COPII-coated vesicles is carried by the heterodimeric complex Sec13-Sec31. The members of this CD belong to the Sec23-like family. Sec 23 is very similar to Sec24. The Sec23 and Sec24 
Probab=45.11  E-value=36  Score=23.72  Aligned_cols=48  Identities=23%  Similarity=0.298  Sum_probs=40.1

Q ss_pred             hHhHHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCccc
Q psy405           13 FKEKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGGWV   61 (66)
Q Consensus        13 ~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG~~   61 (66)
                      -.....|++.|..=+.+.|..+. +=..+...+||+.+...+..-||.-
T Consensus       203 ~~~a~~fY~~la~~~~~~~vsvD-lF~~s~d~vglaem~~l~~~TGG~v  250 (267)
T cd01478         203 YKKAVKFYDSLAKRLAANGHAVD-IFAGCLDQVGLLEMKVLVNSTGGHV  250 (267)
T ss_pred             hhhHHHHHHHHHHHHHhCCeEEE-EEeccccccCHHHHHHHHHhcCcEE
Confidence            34567899999999988998877 5566778899999999999999964


No 15 
>PF02639 DUF188:  Uncharacterized BCR, YaiI/YqxD family COG1671;  InterPro: IPR003791 This entry describes proteins of unknown function.
Probab=42.61  E-value=41  Score=21.28  Aligned_cols=25  Identities=20%  Similarity=0.228  Sum_probs=17.5

Q ss_pred             ccCCCCccchHhHHHHHHHHHHHHH
Q psy405            4 VTKKDGDAYFKEKESFLRDLQHFHE   28 (66)
Q Consensus         4 ~~~~~~~~~~~~~~~Fl~~L~~F~~   28 (66)
                      .++.+++=...+++.|...|..+++
T Consensus       105 ~~~gpk~~~~~d~~~F~~~L~~~l~  129 (130)
T PF02639_consen  105 RTKGPKKFTKKDRQRFANALDRLLQ  129 (130)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHc
Confidence            3455555667788888888887765


No 16 
>smart00805 AGTRAP Angiotensin II, type I receptor-associated protein. This family consists of several angiotensin II, type I receptor-associated protein (AGTRAP) sequences. AGTRAP is known to interact specifically with the C-terminal cytoplasmic region of the angiotensin II type 1 (AT(1)) receptor to regulate different aspects of AT(1) receptor physiology. The function of this family is unclear.
Probab=39.39  E-value=16  Score=24.36  Aligned_cols=21  Identities=24%  Similarity=0.425  Sum_probs=18.7

Q ss_pred             eecchhhHHHHHHhcCcccce
Q psy405           43 KEIDLYLLYCLVTSNGGWVKK   63 (66)
Q Consensus        43 k~lDL~~Ly~~V~~~GG~~~V   63 (66)
                      ||+.++.||++-.+|||.-.|
T Consensus       101 rP~S~~lly~~~~eRGG~l~v  121 (159)
T smart00805      101 KPLSCCLVYHMYRERGGELPV  121 (159)
T ss_pred             HHHHHHHHHHHHHHccCcccc
Confidence            789999999999999997654


No 17 
>cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes.  The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others.  Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity.  Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway.  The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity.
Probab=39.11  E-value=42  Score=23.43  Aligned_cols=20  Identities=10%  Similarity=0.174  Sum_probs=17.3

Q ss_pred             chHhHHHHHHHHHHHHHhcC
Q psy405           12 YFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ....++.|.+++.+|+.+.|
T Consensus        89 ~~~~R~~fi~siv~~l~~~~  108 (299)
T cd02879          89 DPTARKAFINSSIKVARKYG  108 (299)
T ss_pred             CHHHHHHHHHHHHHHHHHhC
Confidence            34678999999999999986


No 18 
>PF08971 GlgS:  Glycogen synthesis protein;  InterPro: IPR015065 Members of this protein are involved in glycogen synthesis in Enterobacteria. The structure of the polypeptide chain comprises a bundle of two parallel amphipathic helices, alpha-1 and alpha-3, and a short hydrophobic helix alpha-2 sandwiched between them []. ; GO: 0005978 glycogen biosynthetic process; PDB: 1RRZ_A.
Probab=38.95  E-value=14  Score=21.39  Aligned_cols=30  Identities=23%  Similarity=0.227  Sum_probs=19.5

Q ss_pred             cchHhHHHHHHHHHHHHHhcCCCCCCCceec
Q psy405           11 AYFKEKESFLRDLQHFHETRGTPCRHVPKIG   41 (66)
Q Consensus        11 ~~~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~   41 (66)
                      -+.-..-.|+..=..||+.+|.++. +..|.
T Consensus         5 ~ys~~nfDFlAsS~ArMe~qgr~vd-~~~I~   34 (66)
T PF08971_consen    5 VYSHTNFDFLASSFARMEAQGRKVD-VDAIT   34 (66)
T ss_dssp             TTHHHHHHHHHHHHHHHHHHT-----HHHHH
T ss_pred             hhccccchHHHHHHHHHHHcCCCCC-HHHHh
Confidence            3455667899999999999999988 44333


No 19 
>PF12496 BNIP2:  Bcl2-/adenovirus E1B nineteen kDa-interacting protein 2;  InterPro: IPR022181  This domain family is found in eukaryotes, and is typically between 119 and 133 amino acids in length. There is a conserved HGGY sequence motif. This family is Bcl2-/adenovirus E1B nineteen kDa-interacting protein 2. It interacts with pro- and anti- apoptotic molecules in the cell. 
Probab=38.53  E-value=6.5  Score=25.18  Aligned_cols=26  Identities=35%  Similarity=0.554  Sum_probs=17.9

Q ss_pred             CCceecC--eecch--hhHHHHHHhcCccc
Q psy405           36 HVPKIGG--KEIDL--YLLYCLVTSNGGWV   61 (66)
Q Consensus        36 ~~P~i~g--k~lDL--~~Ly~~V~~~GG~~   61 (66)
                      |.=+|++  +.||+  ..-|+.|.++|||.
T Consensus        95 R~v~iG~qE~rIDMkvIEPYkrViSHGGYy  124 (127)
T PF12496_consen   95 RTVRIGEQEHRIDMKVIEPYKRVISHGGYY  124 (127)
T ss_pred             eEEEECCccEEEeeEecccceeeeccCCcc
Confidence            3445554  34665  45699999999994


No 20 
>PHA03149 hypothetical protein; Provisional
Probab=38.48  E-value=9.7  Score=21.92  Aligned_cols=29  Identities=21%  Similarity=0.218  Sum_probs=21.7

Q ss_pred             HHHHhcCCCCCCCceecCeecchhhHHHHHHhc
Q psy405           25 HFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSN   57 (66)
Q Consensus        25 ~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~   57 (66)
                      +-..+|..|+.    +.|++|||+.=|.++.+.
T Consensus         6 SiCkRr~nPlD----V~G~~Inv~~DFE~fsE~   34 (66)
T PHA03149          6 SICKRRPNPLD----TEGKVINLPDDFEELSET   34 (66)
T ss_pred             eeecCCCCCcc----CCCcEecchhhhhhhCcc
Confidence            33456667775    999999999999887543


No 21 
>PF15643 Tox-PL-2:  Papain fold toxin 2
Probab=37.97  E-value=33  Score=21.26  Aligned_cols=35  Identities=14%  Similarity=0.186  Sum_probs=26.1

Q ss_pred             HhHHHHHHHHHHHHHhcCCCCCCCceecCeecchh
Q psy405           14 KEKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLY   48 (66)
Q Consensus        14 ~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~   48 (66)
                      -++.+|.+.|.+|+.++|.|.+.+-.-.|-.-++|
T Consensus        19 ~qC~~cA~Al~~~L~~~gI~Gk~i~l~T~~~~~~~   53 (100)
T PF15643_consen   19 FQCVECASALKQFLKQAGIPGKIIRLYTGYHEGPF   53 (100)
T ss_pred             eehHHHHHHHHHHHHHCCCCceEEEEEecCCCCce
Confidence            35778999999999999988875555554444544


No 22 
>PF14639 YqgF:  Holliday-junction resolvase-like of SPT6 ; PDB: 3PSI_A 3PSF_A.
Probab=37.42  E-value=36  Score=21.94  Aligned_cols=41  Identities=24%  Similarity=0.253  Sum_probs=27.1

Q ss_pred             chHhHHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHH
Q psy405           12 YFKEKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVT   55 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~   55 (66)
                      ....++.|++.|.+|+.++...+   =.|+|-..+-.+|+..|.
T Consensus        44 ~~~~~~~~~~~l~~~i~~~kP~v---I~v~g~~~~s~~l~~~v~   84 (150)
T PF14639_consen   44 DRERKEEDMERLKKFIEKHKPDV---IAVGGNSRESRKLYDDVR   84 (150)
T ss_dssp             -SS-SHHHHHHHHHHHHHH--SE---EEE--SSTHHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHHHHcCCeE---EEEcCCChhHHHHHHHHH
Confidence            34556799999999999875433   357888888888888764


No 23 
>cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods.  Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.  The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins.  The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are inclu
Probab=36.41  E-value=53  Score=20.83  Aligned_cols=21  Identities=24%  Similarity=0.328  Sum_probs=17.6

Q ss_pred             cchHhHHHHHHHHHHHHHhcC
Q psy405           11 AYFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        11 ~~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      .....+++|.+++.+|+++.|
T Consensus        84 ~~~~~~~~f~~~~~~~v~~~~  104 (210)
T cd00598          84 SDPASRAAFANSLVSFLKTYG  104 (210)
T ss_pred             cCHHHHHHHHHHHHHHHHHcC
Confidence            345678999999999999986


No 24 
>PRK00124 hypothetical protein; Validated
Probab=36.34  E-value=60  Score=21.27  Aligned_cols=26  Identities=12%  Similarity=0.097  Sum_probs=22.0

Q ss_pred             ccCCCCccchHhHHHHHHHHHHHHHh
Q psy405            4 VTKKDGDAYFKEKESFLRDLQHFHET   29 (66)
Q Consensus         4 ~~~~~~~~~~~~~~~Fl~~L~~F~~~   29 (66)
                      .++.+++=..++++.|.+.|..++.+
T Consensus       121 ~t~Gp~~~~~~Dr~~F~~~L~~~l~~  146 (151)
T PRK00124        121 RTGGPKPFTQEDRSRFEAELDKLIRR  146 (151)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHH
Confidence            45667777889999999999999986


No 25 
>cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome.  SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2.  Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.
Probab=36.12  E-value=52  Score=22.96  Aligned_cols=20  Identities=15%  Similarity=0.130  Sum_probs=17.2

Q ss_pred             chHhHHHHHHHHHHHHHhcC
Q psy405           12 YFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ....++.|.+++.+|+++.|
T Consensus        89 ~~~~R~~fi~s~~~~~~~~~  108 (318)
T cd02876          89 DEQEREKLIKLLVTTAKKNH  108 (318)
T ss_pred             CHHHHHHHHHHHHHHHHHcC
Confidence            34568899999999999997


No 26 
>cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites.  The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
Probab=35.23  E-value=50  Score=23.13  Aligned_cols=20  Identities=15%  Similarity=0.179  Sum_probs=17.0

Q ss_pred             chHhHHHHHHHHHHHHHhcC
Q psy405           12 YFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ....++.|.+++.+|+++.|
T Consensus       106 ~~~~r~~Fi~siv~~l~~~~  125 (322)
T cd06548         106 TEASRAKFADSAVDFIRKYG  125 (322)
T ss_pred             CHHHHHHHHHHHHHHHHhcC
Confidence            34568899999999999985


No 27 
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
Probab=34.59  E-value=53  Score=22.14  Aligned_cols=20  Identities=0%  Similarity=0.112  Sum_probs=16.8

Q ss_pred             chHhHHHHHHHHHHHHHhcC
Q psy405           12 YFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ....++.|.+++.+|+++.|
T Consensus        80 ~~~~r~~fi~~lv~~~~~~~   99 (253)
T cd06545          80 DPAKRKALVDKIINYVVSYN   99 (253)
T ss_pred             CHHHHHHHHHHHHHHHHHhC
Confidence            44678899999999999876


No 28 
>cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster. The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes.
Probab=33.34  E-value=58  Score=23.97  Aligned_cols=20  Identities=15%  Similarity=0.341  Sum_probs=17.1

Q ss_pred             chHhHHHHHHHHHHHHHhcC
Q psy405           12 YFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ....++.|.+++.+|+.+.|
T Consensus       102 ~~~~R~~Fi~siv~~l~~~~  121 (413)
T cd02873         102 SSESRNAFINSAHSLLKTYG  121 (413)
T ss_pred             CHHHHHHHHHHHHHHHHHcC
Confidence            34668899999999999986


No 29 
>COG1671 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.69  E-value=80  Score=20.87  Aligned_cols=27  Identities=15%  Similarity=0.172  Sum_probs=21.6

Q ss_pred             cccCCCCccchHhHHHHHHHHHHHHHh
Q psy405            3 KVTKKDGDAYFKEKESFLRDLQHFHET   29 (66)
Q Consensus         3 ~~~~~~~~~~~~~~~~Fl~~L~~F~~~   29 (66)
                      +..+.+++-..++++.|.+.|..|+.+
T Consensus       119 ~~~~gp~~~~~rDr~~F~~~ldr~~~~  145 (150)
T COG1671         119 KKTGGPAAFSSRDRSRFANALDRLLSR  145 (150)
T ss_pred             cccCCCCccChHHHHHHHHHHHHHHHH
Confidence            345677777889999999999998764


No 30 
>PF09441 Abp2:  ARS binding protein 2;  InterPro: IPR018562  This DNA-binding protein binds to the autonomously replicating sequence (ARS) binding element. It may play a role in regulating the cell cycle response to stress signals []. 
Probab=31.66  E-value=35  Score=23.09  Aligned_cols=23  Identities=30%  Similarity=0.521  Sum_probs=20.2

Q ss_pred             CCCceecCeecchhhHHHHHHhc
Q psy405           35 RHVPKIGGKEIDLYLLYCLVTSN   57 (66)
Q Consensus        35 ~~~P~i~gk~lDL~~Ly~~V~~~   57 (66)
                      ..+|.-+||..+.|.||..|.+.
T Consensus        43 r~pPkS~Gk~Fs~~~Lf~LI~k~   65 (175)
T PF09441_consen   43 RSPPKSDGKSFSTFTLFELIRKL   65 (175)
T ss_pred             cCCCCcCCccchHHHHHHHHHHH
Confidence            34899999999999999998764


No 31 
>PF00704 Glyco_hydro_18:  Glycosyl hydrolases family 18;  InterPro: IPR001223 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Some members of this family, GH18 from CAZY, belong to the chitinase class II group which includes chitinase, chitodextrinase and the killer toxin of Kluyveromyces lactis. The chitinases hydrolyse chitin oligosaccharides. The family also includes various glycoproteins from mammals; cartilage glycoprotein and the oviduct-specific glycoproteins are two examples.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1ITX_A 3ALG_A 3ALF_A 1NAR_A 3QOK_A 3G6L_A 3G6M_A 2DT1_A 2B31_A 2O92_A ....
Probab=31.57  E-value=47  Score=22.66  Aligned_cols=27  Identities=22%  Similarity=0.534  Sum_probs=21.1

Q ss_pred             hHhHHHHHHHHHHHHHhcCCCCCCCceecCeecch
Q psy405           13 FKEKESFLRDLQHFHETRGTPCRHVPKIGGKEIDL   47 (66)
Q Consensus        13 ~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL   47 (66)
                      ...++.|.+++.+|+++.|        ++|-+||.
T Consensus        97 ~~~r~~f~~~i~~~l~~y~--------~DGidiD~  123 (343)
T PF00704_consen   97 PAKRQNFINNIVSFLKKYG--------FDGIDIDW  123 (343)
T ss_dssp             HHHHHHHHHHHHHHHHHHT---------SEEEEEE
T ss_pred             HHHHHHHHHhhhhhhcccC--------cceeeeee
Confidence            4568999999999999988        66666653


No 32 
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in  bacterial endospore germination.  CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells.  SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore.  As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex.  CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains.  In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
Probab=31.47  E-value=67  Score=22.20  Aligned_cols=19  Identities=5%  Similarity=0.293  Sum_probs=16.4

Q ss_pred             hHhHHHHHHHHHHHHHhcC
Q psy405           13 FKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        13 ~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ...++.|.+++.+|+++.|
T Consensus        85 ~~~r~~fi~~iv~~l~~~~  103 (313)
T cd02874          85 PEARQRLINNILALAKKYG  103 (313)
T ss_pred             HHHHHHHHHHHHHHHHHhC
Confidence            3567899999999999986


No 33 
>smart00636 Glyco_18 Glycosyl hydrolase family 18.
Probab=30.57  E-value=67  Score=22.24  Aligned_cols=19  Identities=16%  Similarity=0.392  Sum_probs=16.7

Q ss_pred             hHhHHHHHHHHHHHHHhcC
Q psy405           13 FKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        13 ~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ...++.|.+++.+|+.+.|
T Consensus        89 ~~~r~~fi~~i~~~~~~~~  107 (334)
T smart00636       89 PASRKKFIDSIVSFLKKYG  107 (334)
T ss_pred             HHHHHHHHHHHHHHHHHcC
Confidence            4678899999999999986


No 34 
>cd02878 GH18_zymocin_alpha Zymocin, alpha subunit.  Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest.  The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation.  The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
Probab=30.11  E-value=72  Score=22.72  Aligned_cols=20  Identities=10%  Similarity=0.267  Sum_probs=17.4

Q ss_pred             chHhHHHHHHHHHHHHHhcC
Q psy405           12 YFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ....++.|.+++.+|+++.|
T Consensus        88 ~~~~R~~Fi~si~~~~~~~~  107 (345)
T cd02878          88 KPANRDTFANNVVNFVNKYN  107 (345)
T ss_pred             CHHHHHHHHHHHHHHHHHcC
Confidence            35678999999999999986


No 35 
>cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
Probab=29.01  E-value=78  Score=22.02  Aligned_cols=19  Identities=11%  Similarity=0.321  Sum_probs=16.5

Q ss_pred             hHhHHHHHHHHHHHHHhcC
Q psy405           13 FKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        13 ~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ...++.|++++.+|+++.|
T Consensus        86 ~~~R~~fi~~iv~~~~~~~  104 (298)
T cd06549          86 PSARAKFIANIAAYLERNQ  104 (298)
T ss_pred             HHHHHHHHHHHHHHHHHhC
Confidence            3567889999999999987


No 36 
>PRK02363 DNA-directed RNA polymerase subunit delta; Reviewed
Probab=28.56  E-value=79  Score=20.10  Aligned_cols=34  Identities=12%  Similarity=0.071  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCccc
Q psy405           17 ESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGGWV   61 (66)
Q Consensus        17 ~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG~~   61 (66)
                      .++++.-+.++.+++.           ++.++.|++.|.+..|+.
T Consensus         3 ~S~idvAy~iL~~~~~-----------~m~f~dL~~ev~~~~~~s   36 (129)
T PRK02363          3 LSLIEVAYEILKEKKE-----------PMSFYDLVNEIQKYLGKS   36 (129)
T ss_pred             ccHHHHHHHHHHHcCC-----------cccHHHHHHHHHHHhCCC
Confidence            4567777778877654           455889999998888865


No 37 
>PRK05089 cytochrome C oxidase assembly protein; Provisional
Probab=28.53  E-value=33  Score=23.33  Aligned_cols=18  Identities=33%  Similarity=0.636  Sum_probs=15.8

Q ss_pred             cchhhHHHHHHhcCcccc
Q psy405           45 IDLYLLYCLVTSNGGWVK   62 (66)
Q Consensus        45 lDL~~Ly~~V~~~GG~~~   62 (66)
                      |-||++|+.|+..||-.+
T Consensus        32 VPLY~~fC~~TG~~G~t~   49 (188)
T PRK05089         32 VPLYDVFCEVTGINGTTQ   49 (188)
T ss_pred             hHHHHHHHHhhCCCceec
Confidence            569999999999999765


No 38 
>COG3175 COX11 Cytochrome oxidase assembly factor [Posttranslational modification, protein turnover, chaperones]
Probab=28.14  E-value=31  Score=23.75  Aligned_cols=18  Identities=44%  Similarity=0.835  Sum_probs=15.1

Q ss_pred             ecchhhHHHHHHhcCccc
Q psy405           44 EIDLYLLYCLVTSNGGWV   61 (66)
Q Consensus        44 ~lDL~~Ly~~V~~~GG~~   61 (66)
                      .|-||+||+.|..-||--
T Consensus        31 aVPLY~lfC~vTGygGtt   48 (195)
T COG3175          31 AVPLYKLFCRVTGYGGTT   48 (195)
T ss_pred             hhhHHHHHhhhhccCCEe
Confidence            367999999999999853


No 39 
>PTZ00417 lysine-tRNA ligase; Provisional
Probab=27.87  E-value=1.1e+02  Score=24.11  Aligned_cols=50  Identities=32%  Similarity=0.451  Sum_probs=32.4

Q ss_pred             hHhHHHHHHHHHHHHHhcC-----CCCCCCceecCee------------cchh-----hHHHHHHhcCcccce
Q psy405           13 FKEKESFLRDLQHFHETRG-----TPCRHVPKIGGKE------------IDLY-----LLYCLVTSNGGWVKK   63 (66)
Q Consensus        13 ~~~~~~Fl~~L~~F~~~rg-----~p~~~~P~i~gk~------------lDL~-----~Ly~~V~~~GG~~~V   63 (66)
                      -..+...+..+++|+.++|     ||+- .+.-+|-.            .|+|     .||..-.-.||+++|
T Consensus       253 fr~RS~Ii~aiR~Ff~~rGFlEVeTPiL-~~~~GGA~a~PF~T~~n~~d~~lYLriSpEL~lKrLlvgG~~rV  324 (585)
T PTZ00417        253 FITRTKIINYLRNFLNDRGFIEVETPTM-NLVAGGANARPFITHHNDLDLDLYLRIATELPLKMLIVGGIDKV  324 (585)
T ss_pred             HHHHHHHHHHHHHHHHHCCeEEEeCCee-eccCCcccceeEEecccCCCcceEEeecHHHHHHHHHHhCCCCE
Confidence            3567788999999999999     5554 22223322            1222     466666666888877


No 40 
>PF00586 AIRS:  AIR synthase related protein, N-terminal domain;  InterPro: IPR000728 This family includes Hydrogen expression/formation protein, HypE, which may be involved in the maturation of NifE hydrogenase; AIR synthase and FGAM synthase, which are involved in de novo purine biosynthesis; and selenide, water dikinase, an enzyme which synthesizes selenophosphate from selenide and ATP.; GO: 0003824 catalytic activity; PDB: 3VIU_A 2Z1T_A 2Z1U_A 3C9U_B 3C9S_A 3C9R_A 1VQV_A 3C9T_B 3M84_A 3QTY_A ....
Probab=27.31  E-value=1e+02  Score=17.45  Aligned_cols=31  Identities=16%  Similarity=0.340  Sum_probs=22.4

Q ss_pred             CCccchHhHHHHHHHHHHHHHhcCCCCCCCceecCe
Q psy405            8 DGDAYFKEKESFLRDLQHFHETRGTPCRHVPKIGGK   43 (66)
Q Consensus         8 ~~~~~~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk   43 (66)
                      +++.....-+++++.+.++.++-|     +|+++|+
T Consensus        65 ~~~~~~~~l~~~~~Gi~~~~~~~g-----~~ivGG~   95 (96)
T PF00586_consen   65 PNPESPEELKEIVKGIAEACREFG-----IPIVGGD   95 (96)
T ss_dssp             STTSBHHHHHHHHHHHHHHHHHHT------EEEEEE
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHhC-----CcEeCcC
Confidence            334455667888889999999888     6777775


No 41 
>PF15412 Nse4-Nse3_bdg:  Binding domain of Nse4/EID3 to Nse3-MAGE
Probab=27.30  E-value=61  Score=17.46  Aligned_cols=22  Identities=14%  Similarity=0.141  Sum_probs=17.4

Q ss_pred             cchHhHHHHHHHHHHHHHhcCC
Q psy405           11 AYFKEKESFLRDLQHFHETRGT   32 (66)
Q Consensus        11 ~~~~~~~~Fl~~L~~F~~~rg~   32 (66)
                      ...-+...|+..|..||.....
T Consensus        23 ~~~fd~deFv~~l~~fm~~~~~   44 (56)
T PF15412_consen   23 GSGFDVDEFVSKLKTFMGGNRF   44 (56)
T ss_pred             CCccCHHHHHHHHHHHhCcccC
Confidence            3445788999999999987654


No 42 
>PF03823 Neurokinin_B:  Neurokinin B;  InterPro: IPR003635 Tachykinins [, , ] are a group of biologically active peptides which excite neurons, evoke behavioral responses, are potent vasodilatators and contract (directly or indirectly) many smooth muscles. This family includes neurokinins, as well as many other peptides. Like other tachykinins, neurokinins are synthesized as larger protein precursors that are enzymatically converted to their mature forms.; GO: 0007217 tachykinin receptor signaling pathway
Probab=26.53  E-value=30  Score=19.53  Aligned_cols=16  Identities=31%  Similarity=0.258  Sum_probs=11.5

Q ss_pred             ecCeecchhhHHHHHH
Q psy405           40 IGGKEIDLYLLYCLVT   55 (66)
Q Consensus        40 i~gk~lDL~~Ly~~V~   55 (66)
                      -.+|+.|||+|-..+-
T Consensus        36 ~skKdsdLyqLPpslL   51 (59)
T PF03823_consen   36 HSKKDSDLYQLPPSLL   51 (59)
T ss_pred             ccccCcchhhCCHHHH
Confidence            3458999999866543


No 43 
>cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases.  The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases.  The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel.  The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding.  Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense.  Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the la
Probab=26.47  E-value=93  Score=21.92  Aligned_cols=19  Identities=16%  Similarity=0.408  Sum_probs=16.7

Q ss_pred             hHhHHHHHHHHHHHHHhcC
Q psy405           13 FKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        13 ~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ...++.|.+++.+|+++.|
T Consensus        94 ~~~r~~fi~~iv~~l~~~~  112 (362)
T cd02872          94 PENRKTFIKSAIAFLRKYG  112 (362)
T ss_pred             HHHHHHHHHHHHHHHHHcC
Confidence            4668899999999999986


No 44 
>KOG4588|consensus
Probab=26.27  E-value=76  Score=22.76  Aligned_cols=32  Identities=16%  Similarity=0.103  Sum_probs=26.7

Q ss_pred             hHhHHHHHHHHHHHHHhcCCCCCCCceecCee
Q psy405           13 FKEKESFLRDLQHFHETRGTPCRHVPKIGGKE   44 (66)
Q Consensus        13 ~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~   44 (66)
                      ......|++.++.|..+|.+.+...|+|+.-+
T Consensus       201 ~~~~~k~le~~R~~~~sr~sK~~sa~qidslp  232 (267)
T KOG4588|consen  201 ENFAAKILETLRKASGSRISKLFSAPQIDSLP  232 (267)
T ss_pred             hhHHHHHHHHHHHHhhhhhhhcccccccccCC
Confidence            45667899999999999999998899886544


No 45 
>PF09153 DUF1938:  Domain of unknown function (DUF1938);  InterPro: IPR015236 This domain, which is predominantly found in the archaeal protein O6-alkylguanine-DNA alkyltransferase, adopts a secondary structure consisting of a three stranded antiparallel beta-sheet and three alpha helices. The exact function has not, as yet, been defined, though it has been postulated that this domain may confer thermostability to the protein []. ; GO: 0005737 cytoplasm; PDB: 1MGT_A.
Probab=25.83  E-value=78  Score=19.14  Aligned_cols=24  Identities=33%  Similarity=0.576  Sum_probs=16.0

Q ss_pred             chHhHHHHHH----HHHHHHHhcCCCCC
Q psy405           12 YFKEKESFLR----DLQHFHETRGTPCR   35 (66)
Q Consensus        12 ~~~~~~~Fl~----~L~~F~~~rg~p~~   35 (66)
                      +.-+..+|++    .|..|+.+||..+.
T Consensus        29 fslDg~efl~eri~~L~~~L~kRgv~v~   56 (86)
T PF09153_consen   29 FSLDGEEFLRERISRLIEFLKKRGVSVS   56 (86)
T ss_dssp             EESSHHHHHH-HHHHHHHHHHHTT----
T ss_pred             EEeccHHHHHHHHHHHHHHHHhcCceeE
Confidence            4456677777    89999999998776


No 46 
>PHA02128 hypothetical protein
Probab=25.74  E-value=68  Score=20.67  Aligned_cols=42  Identities=21%  Similarity=0.196  Sum_probs=31.2

Q ss_pred             HHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCcccceec
Q psy405           24 QHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGGWVKKCT   65 (66)
Q Consensus        24 ~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG~~~Vt~   65 (66)
                      .+|+.++.+---.+-.+.||.--|..|-.+|...||..-+|.
T Consensus        39 ssflrehrtihlnlgr~tgkt~gl~~lane~~aqgg~r~itm   80 (151)
T PHA02128         39 SSFLREHRTIHLNLGRMTGKTTGLLHLANEVSAQGGARIITM   80 (151)
T ss_pred             hHHHhhcceeEeeecccccccchHHHHHHHHHhcCCeEEEEe
Confidence            345555544322367889999999999999999999876653


No 47 
>PF04442 CtaG_Cox11:  Cytochrome c oxidase assembly protein CtaG/Cox11;  InterPro: IPR007533 Cytochrome c oxidase assembly protein is essential for the assembly of functional cytochrome oxidase protein. In eukaryotes it is an integral protein of the mitochondrial inner membrane. Cox11 is essential for the insertion of Cu(I) ions to form the CuB site. This is essential for the stability of other structures in subunit I, for example haems a and a3, and the magnesium/manganese centre. Cox11 is probably only required in sub-stoichiometric amounts relative to the structural units []. The C-terminal region of the protein is known to form a dimer. Each monomer coordinates one Cu(I) ion via three conserved cysteine residues (111, 208 and 210) in Saccharomyces cerevisiae (P19516 from SWISSPROT). Met 224 is also thought to play a role in copper transfer or stabilising the copper site [].; GO: 0005507 copper ion binding; PDB: 1SO9_A 1SP0_A.
Probab=25.60  E-value=23  Score=23.27  Aligned_cols=19  Identities=32%  Similarity=0.644  Sum_probs=0.0

Q ss_pred             cchhhHHHHHHhcCcccce
Q psy405           45 IDLYLLYCLVTSNGGWVKK   63 (66)
Q Consensus        45 lDL~~Ly~~V~~~GG~~~V   63 (66)
                      |-||++|+.|...||-.+.
T Consensus         2 VPLY~~fC~vTG~~Gtt~~   20 (152)
T PF04442_consen    2 VPLYDVFCEVTGFNGTTQR   20 (152)
T ss_dssp             -------------------
T ss_pred             CchHHHHHHHhCCCCEeCc
Confidence            5699999999999997765


No 48 
>PTZ00128 cytochrome c oxidase assembly protein-like; Provisional
Probab=25.47  E-value=42  Score=23.63  Aligned_cols=20  Identities=40%  Similarity=0.657  Sum_probs=16.5

Q ss_pred             ecchhhHHHHHHhcCcccce
Q psy405           44 EIDLYLLYCLVTSNGGWVKK   63 (66)
Q Consensus        44 ~lDL~~Ly~~V~~~GG~~~V   63 (66)
                      -|-||++|+.|+..||-.+.
T Consensus        74 ~VPLY~~fC~~TG~~Gtt~~   93 (232)
T PTZ00128         74 FVPLYRLFCQSTGYGGDADK   93 (232)
T ss_pred             HhHHHHHHHHhcCCCccccc
Confidence            36799999999999996544


No 49 
>cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L.) cotyledons with unknown function.  Narbonin has a glycosyl hydrolase family 18 (GH18) domain without the conserved catalytic residues and with no known enzymatic activity.  Narbonin amounts to up to 3% of the total seed globulins of mature seeds and was thought to be a storage protein but was found to degrade too slowly during germination.  This family also includes the VfNOD32 nodulin from Vicia faba.
Probab=25.34  E-value=97  Score=21.46  Aligned_cols=18  Identities=11%  Similarity=0.010  Sum_probs=14.9

Q ss_pred             HhHHHHHHHHHHHHHhcC
Q psy405           14 KEKESFLRDLQHFHETRG   31 (66)
Q Consensus        14 ~~~~~Fl~~L~~F~~~rg   31 (66)
                      .-+++|.+++.+|+++.|
T Consensus        96 ~~~~~fv~S~~~~l~~~~  113 (253)
T cd06544          96 SWVSNAVSSLTSIIQTYN  113 (253)
T ss_pred             hHHHHHHHHHHHHHHHhC
Confidence            345677999999999998


No 50 
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.
Probab=25.24  E-value=93  Score=22.44  Aligned_cols=20  Identities=0%  Similarity=0.016  Sum_probs=17.3

Q ss_pred             chHhHHHHHHHHHHHHHhcC
Q psy405           12 YFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ....++.|.+++.+|+++.|
T Consensus        93 ~~~~R~~fi~siv~~~~~~g  112 (358)
T cd02875          93 NPTYRTQWIQQKVELAKSQF  112 (358)
T ss_pred             CHHHHHHHHHHHHHHHHHhC
Confidence            44678899999999999996


No 51 
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription]
Probab=25.04  E-value=38  Score=27.33  Aligned_cols=48  Identities=13%  Similarity=0.217  Sum_probs=37.6

Q ss_pred             CCCccchHhHHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcC
Q psy405            7 KDGDAYFKEKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNG   58 (66)
Q Consensus         7 ~~~~~~~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~G   58 (66)
                      ..-.+...-=..|.+.|..-+++.|....    |.||+=-+|..|+.-+..|
T Consensus       209 e~r~~re~~i~~~~~~l~~~L~~~gi~a~----v~gR~KhiYSIyrKM~~k~  256 (701)
T COG0317         209 EKRLEREQYIENVVSELREELKAAGIKAE----VSGRPKHIYSIYRKMQKKK  256 (701)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHcCCeEE----EEcCCCcccHHHHHHHHcc
Confidence            33344445557799999999999998855    9999999999999866543


No 52 
>cd07347 harmonin_N_like N-terminal protein-binding module of harmonin and similar domains. This domain is found in harmonin, and similar proteins such as delphilin, and whirlin. These are postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold proteins. Harmonin and whirlin are organizers of the Usher protein network of the inner ear and the retina, delphilin is found at the cerebellar parallel fiber-Purkinje cell synapses. This harmonin_N_like domain is found in either one or two copies. Harmonin contains a single copy, which is found at its N-terminus and binds specifically to a short internal peptide fragment of the cadherin 23 cytoplasmic domain; cadherin 23 is a component of the Usher protein network. Whirlin contains two copies of the harmonin_N_like domain; the first of these has been assayed for interaction with the cytoplasmic domain of cadherin 23 and no interaction could be detected.
Probab=24.97  E-value=98  Score=18.14  Aligned_cols=21  Identities=29%  Similarity=0.487  Sum_probs=17.7

Q ss_pred             chHhHHHHHHHHHHHHHhcCC
Q psy405           12 YFKEKESFLRDLQHFHETRGT   32 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg~   32 (66)
                      ...++..|...|..|++.++.
T Consensus        17 ~~~Er~~~~~~L~~Y~~~~~V   37 (78)
T cd07347          17 TDAEREQVTRALERYHQERNV   37 (78)
T ss_pred             CHHHHHHHHHHHHHHHhcCCH
Confidence            356899999999999999853


No 53 
>PF00727 IL4:  Interleukin 4 This family is a subset of the SCOP family;  InterPro: IPR002354 Cytokines are protein messengers that carry information from cell to cell []. Interleukin is one such molecule, and participates in several B-cell activation processes: e.g., it enhances production and secretion of IgG1 and IgE []; it induces expression of class II major histocompatability complex (MHC) molecules on resting B-cells; and it regulates expression of the low affinity Fc receptor for IgE on lymphocytes and monocytes. Interleukin-4 (IL4) has a compact, globular fold (similar to other cytokines), stabilised by 3 disulphide bonds []. One half of the structure is dominated by a 4 alpha-helix bundle with a left-handed twist []. The helices are anti-parallel, with 2 overhand connections, which fall into a 2-stranded anti-parallel beta-sheet [].; GO: 0005136 interleukin-4 receptor binding, 0008083 growth factor activity, 0006955 immune response, 0005576 extracellular region; PDB: 1HIK_A 1HZI_A 1ITI_A 2INT_A 1RCB_A 1CYL_A 3QB7_A 1BBN_A 2B8Z_A 1ITM_A ....
Probab=24.74  E-value=65  Score=20.43  Aligned_cols=16  Identities=19%  Similarity=0.414  Sum_probs=13.0

Q ss_pred             hHHHHHHHHHHHHHhc
Q psy405           15 EKESFLRDLQHFHETR   30 (66)
Q Consensus        15 ~~~~Fl~~L~~F~~~r   30 (66)
                      .=+.|++.|..+|+++
T Consensus       100 tLkdFLe~Lk~imq~k  115 (117)
T PF00727_consen  100 TLKDFLERLKTIMQEK  115 (117)
T ss_dssp             EHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHhh
Confidence            3578999999999864


No 54 
>PLN00162 transport protein sec23; Provisional
Probab=24.42  E-value=95  Score=25.00  Aligned_cols=49  Identities=20%  Similarity=0.278  Sum_probs=40.7

Q ss_pred             chHhHHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCccc
Q psy405           12 YFKEKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGGWV   61 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG~~   61 (66)
                      .-.....|+++|..=..+.|..+. +=..+...+||+.+-..+..-||.-
T Consensus       323 ~~~~a~~fY~~la~~~~~~gisvD-lF~~s~dqvglaem~~l~~~TGG~v  371 (761)
T PLN00162        323 YYKKAVKFYEGLAKQLVAQGHVLD-VFACSLDQVGVAEMKVAVERTGGLV  371 (761)
T ss_pred             hcchHHHHHHHHHHHHHHcCceEE-EEEccccccCHHHHhhhHhhcCcEE
Confidence            445677899999999999998877 5456678899999999999999964


No 55 
>PF09425 CCT_2:  Divergent CCT motif;  InterPro: IPR018467 The short CCT (CO, COL, TOC1) motif is found in a number of plant proteins, including Constans (CO), Constans-like (COL) and TOC1. The CCT motif is about 45 amino acids long and contains a putative nuclear localisation signal within the second half of the CCT motif []. The CCT motif is found in the Arabidopsis circadian rhythm protein TOC1, an autoregulatory response regulator homologue the controls the photoperiodic flowering through its clock function []. ; GO: 0005515 protein binding; PDB: 3OGK_V 3OGL_S 3OGM_W.
Probab=24.28  E-value=56  Score=15.65  Aligned_cols=14  Identities=36%  Similarity=0.411  Sum_probs=8.4

Q ss_pred             HHHHHHHHhcCCCC
Q psy405           21 RDLQHFHETRGTPC   34 (66)
Q Consensus        21 ~~L~~F~~~rg~p~   34 (66)
                      .+|+.|+++|..-+
T Consensus         6 ~SLqRFLeKRK~R~   19 (27)
T PF09425_consen    6 ASLQRFLEKRKDRL   19 (27)
T ss_dssp             HHHHHHHHHH----
T ss_pred             HHHHHHHHHHHHhh
Confidence            57899999886443


No 56 
>KOG2265|consensus
Probab=24.17  E-value=60  Score=22.07  Aligned_cols=20  Identities=10%  Similarity=0.069  Sum_probs=17.6

Q ss_pred             hHhHHHHHHHHHHHHHhcCC
Q psy405           13 FKEKESFLRDLQHFHETRGT   32 (66)
Q Consensus        13 ~~~~~~Fl~~L~~F~~~rg~   32 (66)
                      ..+...+++.|.+||.+.|.
T Consensus       151 ~sde~~~~d~Lkk~~~~~~~  170 (179)
T KOG2265|consen  151 TSDELKKHDMLKKFMDQHPE  170 (179)
T ss_pred             CCchhhHHHHHHHHHHhCCC
Confidence            56778899999999999986


No 57 
>cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii.  CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
Probab=23.72  E-value=1.1e+02  Score=21.06  Aligned_cols=20  Identities=20%  Similarity=0.310  Sum_probs=16.9

Q ss_pred             chHhHHHHHHHHHHHHHhcC
Q psy405           12 YFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ....++.|...+.+|+.+-|
T Consensus        93 ~~~~r~~f~~s~~~~~~~~~  112 (256)
T cd06546          93 DDEDFERYYGQLRDMIRRRG  112 (256)
T ss_pred             CHHHHHHHHHHHHHHHHHhC
Confidence            45678899999999998876


No 58 
>PF05066 HARE-HTH:  HB1, ASXL, restriction endonuclease HTH domain;  InterPro: IPR007759 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. The delta protein is a dispensable subunit of Bacillus subtilis RNA polymerase (RNAP) that has major effects on the biochemical properties of the purified enzyme. In the presence of delta, RNAP displays an increased specificity of transcription, a decreased affinity for nucleic acids, and an increased efficiency of RNA synthesis because of enhanced recycling []. The delta protein, contains two distinct regions, an N-terminal domain and a glutamate and aspartate residue-rich C-terminal region [].; GO: 0003677 DNA binding, 0006351 transcription, DNA-dependent; PDB: 2KRC_A.
Probab=23.61  E-value=41  Score=18.49  Aligned_cols=21  Identities=14%  Similarity=0.333  Sum_probs=15.0

Q ss_pred             CeecchhhHHHHHHhcCcccc
Q psy405           42 GKEIDLYLLYCLVTSNGGWVK   62 (66)
Q Consensus        42 gk~lDL~~Ly~~V~~~GG~~~   62 (66)
                      |+|+..-.++..+.++|++..
T Consensus        15 ~~pm~~~eI~~~i~~~~~~~~   35 (72)
T PF05066_consen   15 GRPMTFKEIWEEIQERGLYKK   35 (72)
T ss_dssp             -S-EEHHHHHHHHHHHHTS--
T ss_pred             CCCcCHHHHHHHHHHhCCCCc
Confidence            466778899999999999874


No 59 
>PF02337 Gag_p10:  Retroviral GAG p10 protein;  InterPro: IPR003322 Retroviral matrix proteins (or major core proteins) are components of envelope-associated capsids, which line the inner surface of virus envelopes and are associated with viral membranes []. Matrix proteins are produced as part of Gag precursor polyproteins. During viral maturation, the Gag polyprotein is cleaved into major structural proteins by the viral protease, yielding the matrix (MA), capsid (CA), nucleocapsid (NC), and some smaller peptides. Gag-derived proteins govern the entire assembly and release of the virus particles, with matrix proteins playing key roles in Gag stability, capsid assembly, transport and budding. Although matrix proteins from different retroviruses appear to perform similar functions and can have similar structural folds, their primary sequences can be very different. This entry represents matrix proteins from beta-retroviruses such as Mason-Pfizer monkey virus (MPMV) (Simian Mason-Pfizer virus) and Mouse mammary tumor virus (MMTV) [, ]. This entry also identifies matrix proteins from several eukaryotic endogenous retroviruses, which arise when one or more copies of the retroviral genome becomes integrated into the host genome [].; GO: 0005198 structural molecule activity, 0019028 viral capsid; PDB: 2F77_X 2F76_X.
Probab=23.25  E-value=73  Score=19.17  Aligned_cols=21  Identities=29%  Similarity=0.564  Sum_probs=14.8

Q ss_pred             hHHHHHHHHHHHHHhcCCCCC
Q psy405           15 EKESFLRDLQHFHETRGTPCR   35 (66)
Q Consensus        15 ~~~~Fl~~L~~F~~~rg~p~~   35 (66)
                      .++.|+..|...+..||..++
T Consensus         6 S~~~fv~~Lk~lLk~rGi~v~   26 (90)
T PF02337_consen    6 SKQPFVSILKHLLKERGIRVK   26 (90)
T ss_dssp             -HHHHHHHHHHHHHCCT----
T ss_pred             hhhHHHHHHHHHHHHcCeeec
Confidence            337999999999999997776


No 60 
>PF06396 AGTRAP:  Angiotensin II, type I receptor-associated protein (AGTRAP);  InterPro: IPR009436 This family consists of several angiotensin II, type I receptor-associated protein (AGTRAP) sequences. AGTRAP is known to interact specifically with the C-terminal cytoplasmic region of the angiotensin II type 1 (AT(1)) receptor to regulate different aspects of AT(1) receptor physiology. The function of this family is unclear.
Probab=23.14  E-value=42  Score=22.33  Aligned_cols=21  Identities=29%  Similarity=0.490  Sum_probs=17.8

Q ss_pred             CeecchhhHHHHHHhcCcccc
Q psy405           42 GKEIDLYLLYCLVTSNGGWVK   62 (66)
Q Consensus        42 gk~lDL~~Ly~~V~~~GG~~~   62 (66)
                      =||+-++.||++=.+|||.-.
T Consensus       100 lKP~s~~~l~r~~reRGG~l~  120 (162)
T PF06396_consen  100 LKPISCFFLYRMYRERGGELS  120 (162)
T ss_pred             HHHHHHHHHHHHHHhcCCcee
Confidence            368899999999999999544


No 61 
>cd01468 trunk_domain trunk domain. COPII-coated vesicles carry proteins from the endoplasmic reticulum to the Golgi complex. This vesicular transport can be reconstituted by using three cytosolic components containing five proteins: the small GTPase Sar1p, the Sec23p/24p complex, and the Sec13p/Sec31p complex. This domain is known as the trunk domain and has an alpha/beta vWA fold and forms the dimer interface. Some members of this family possess a partial MIDAS motif that is a characteristic feature of most vWA domain proteins.
Probab=23.11  E-value=73  Score=21.35  Aligned_cols=47  Identities=23%  Similarity=0.222  Sum_probs=38.5

Q ss_pred             HhHHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCccc
Q psy405           14 KEKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGGWV   61 (66)
Q Consensus        14 ~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG~~   61 (66)
                      .....|+++|..-..+.|..+. +=..+...+|+..|-..+..-||.-
T Consensus       172 ~~a~~fY~~la~~~~~~~isvd-lF~~~~~~~dl~~l~~l~~~TGG~v  218 (239)
T cd01468         172 KPATKFYKSLAKECVKSGICVD-LFAFSLDYVDVATLKQLAKSTGGQV  218 (239)
T ss_pred             cccHHHHHHHHHHHHHcCeEEE-EEeccccccCHHHhhhhhhcCCceE
Confidence            3457899999999999998777 4455677899999999999989863


No 62 
>PF03875 Statherin:  Statherin;  InterPro: IPR005575  Statherin functions biologically to inhibit the nucleation and growth of calcium phosphate minerals. The N terminus of statherin is highly charged, the glutamic acids of which have been shown to be important in the recognition hydroxyapatite [].
Probab=23.02  E-value=93  Score=16.25  Aligned_cols=20  Identities=40%  Similarity=0.566  Sum_probs=14.7

Q ss_pred             hHHHHHHHHHHHHHhcCCCC
Q psy405           15 EKESFLRDLQHFHETRGTPC   34 (66)
Q Consensus        15 ~~~~Fl~~L~~F~~~rg~p~   34 (66)
                      .++.|+..|..|-.-|=-|.
T Consensus         3 seekflrrl~r~~~grygpy   22 (42)
T PF03875_consen    3 SEEKFLRRLGRFFYGRYGPY   22 (42)
T ss_pred             hHHHHHHHHHhhcccccCCc
Confidence            45699999999987753333


No 63 
>PF07875 Coat_F:  Coat F domain;  InterPro: IPR012851 The Coat F proteins contribute to the Bacillales spore coat. They occur multiple times in the genomes in which they are found. Bacillus subtilis endospore protein coats protect them and may play a role in their germination []. Spore coat protein F, on the outer surface of the endospore, is one of a suite of proteins that could be used to differentiate between members of the Bacillus genus [].
Probab=22.71  E-value=69  Score=17.27  Aligned_cols=14  Identities=21%  Similarity=0.491  Sum_probs=9.5

Q ss_pred             hhHHHHHHhcCccc
Q psy405           48 YLLYCLVTSNGGWV   61 (66)
Q Consensus        48 ~~Ly~~V~~~GG~~   61 (66)
                      +.||....++|+|+
T Consensus        48 ~~l~~~m~~kGwY~   61 (64)
T PF07875_consen   48 YELFNYMNQKGWYQ   61 (64)
T ss_pred             HHHHHHHHHcCCcC
Confidence            56677777777764


No 64 
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD).  ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins.  The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain.  This family includes exochitinase Chi36 from Bacillus cereus.
Probab=22.51  E-value=1.1e+02  Score=21.52  Aligned_cols=20  Identities=10%  Similarity=0.267  Sum_probs=17.0

Q ss_pred             chHhHHHHHHHHHHHHHhcC
Q psy405           12 YFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ....++.|.+.|.+|+.+.|
T Consensus        91 ~~~~~~~fa~sl~~~~~~~g  110 (312)
T cd02871          91 HTAQEDNFVDSIVAIIKEYG  110 (312)
T ss_pred             CHHHHHHHHHHHHHHHHHhC
Confidence            45678999999999998886


No 65 
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis]
Probab=22.05  E-value=1.7e+02  Score=22.86  Aligned_cols=48  Identities=33%  Similarity=0.635  Sum_probs=32.4

Q ss_pred             hHHHHHHHHHHHHHhcC-----CCCCCCceecC------------eecchh-----hHHHHHHhcCcccce
Q psy405           15 EKESFLRDLQHFHETRG-----TPCRHVPKIGG------------KEIDLY-----LLYCLVTSNGGWVKK   63 (66)
Q Consensus        15 ~~~~Fl~~L~~F~~~rg-----~p~~~~P~i~g------------k~lDL~-----~Ly~~V~~~GG~~~V   63 (66)
                      .+..-++.++.|+..+|     ||+- -|+-||            -++|||     .||..=.-.||+++|
T Consensus       182 ~Rs~ii~~iR~fl~~~gFlEVETP~l-q~i~GGA~ArPF~ThhNald~dlyLRIApELyLKRliVGG~erV  251 (502)
T COG1190         182 KRSKIIRAIREFLDDRGFLEVETPML-QPIPGGAAARPFITHHNALDMDLYLRIAPELYLKRLIVGGFERV  251 (502)
T ss_pred             HHHHHHHHHHHHHHHCCCeEeccccc-cccCCCcccccceeeecccCCceEEeeccHHHHHHHHhcCchhh
Confidence            44555778999999998     6665 333333            234555     477776677999887


No 66 
>PF03808 Glyco_tran_WecB:  Glycosyl transferase WecB/TagA/CpsF family;  InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway.; GO: 0009058 biosynthetic process
Probab=21.83  E-value=1.3e+02  Score=19.24  Aligned_cols=53  Identities=19%  Similarity=0.083  Sum_probs=39.4

Q ss_pred             CcccCCCCccchHhHHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcC
Q psy405            2 AKVTKKDGDAYFKEKESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNG   58 (66)
Q Consensus         2 ~~~~~~~~~~~~~~~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~G   58 (66)
                      ++.++.+-+ ..-...+|+..|.+..++++.++.   .+||++-.+-++.....+..
T Consensus        20 ~~~~g~~~~-~rv~g~dl~~~l~~~~~~~~~~if---llG~~~~~~~~~~~~l~~~y   72 (172)
T PF03808_consen   20 ARLLGRPLP-ERVTGSDLFPDLLRRAEQRGKRIF---LLGGSEEVLEKAAANLRRRY   72 (172)
T ss_pred             HHHcCCCCC-cccCHHHHHHHHHHHHHHcCCeEE---EEeCCHHHHHHHHHHHHHHC
Confidence            455644444 566778899999999999987555   79999988888777766654


No 67 
>PRK12445 lysyl-tRNA synthetase; Reviewed
Probab=21.81  E-value=1.6e+02  Score=22.57  Aligned_cols=50  Identities=30%  Similarity=0.531  Sum_probs=31.9

Q ss_pred             hHhHHHHHHHHHHHHHhcC-----CCCCCCceecC---ee---------cchh-----hHHHHHHhcCcccce
Q psy405           13 FKEKESFLRDLQHFHETRG-----TPCRHVPKIGG---KE---------IDLY-----LLYCLVTSNGGWVKK   63 (66)
Q Consensus        13 ~~~~~~Fl~~L~~F~~~rg-----~p~~~~P~i~g---k~---------lDL~-----~Ly~~V~~~GG~~~V   63 (66)
                      -..+...+..+++|+.++|     ||+- .|+-+|   +|         .++|     .||..-.-.||+++|
T Consensus       184 ~r~Rs~i~~~iR~f~~~~gFiEVeTPiL-~~~~gGa~a~pF~t~~~~~~~~~yL~~SpELylKrlivgG~~rV  255 (505)
T PRK12445        184 FVVRSKILAAIRQFMVARGFMEVETPMM-QVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERV  255 (505)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEeeCCee-EecCCCCcccceecccccCCcceeeecCHHHHHHHHHhccCCcE
Confidence            3567788899999999998     4433 122222   12         2233     377766667888887


No 68 
>PF10813 DUF2733:  Protein of unknown function (DUF2733);  InterPro: IPR024360 The UL11 gene product of herpes simplex virus is a membrane-associated tegument protein that is incorporated into the HSV virion and functions in viral envelopment []. UL11 is acylated, which is crucial for lipid raft association [].
Probab=20.57  E-value=42  Score=16.74  Aligned_cols=13  Identities=31%  Similarity=0.588  Sum_probs=10.4

Q ss_pred             ecCeecchhhHHH
Q psy405           40 IGGKEIDLYLLYC   52 (66)
Q Consensus        40 i~gk~lDL~~Ly~   52 (66)
                      +.|++|||+.=|.
T Consensus        18 v~G~~Inl~~dFe   30 (32)
T PF10813_consen   18 VKGNPINLYKDFE   30 (32)
T ss_pred             cCCCEEechhccc
Confidence            8899999987553


No 69 
>cd01479 Sec24-like Sec24-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles. The two main classes of vesicular carriers within the endocytic and the biosynthetic pathways are COP- and clathrin-coated vesicles. Formation of COPII vesicles requires the ordered assembly of the coat built from several cytosolic components GTPase Sar1, complexes of Sec23-Sec24 and Sec13-Sec31. The process is initiated by the conversion of GDP to GTP by the GTPase Sar1 which then recruits the heterodimeric complex of Sec23 and Sec24. This heterodimeric complex generates the pre-budding complex. The final step leading to membrane deformation and budding of COPII-coated vesicles is carried by the heterodimeric complex Sec13-Sec31. The members of this CD belong to the Sec23-like family. Sec 24 is very similar to Sec23. The Sec23 and Sec24 
Probab=20.37  E-value=1.1e+02  Score=20.88  Aligned_cols=45  Identities=20%  Similarity=0.257  Sum_probs=37.8

Q ss_pred             HHHHHHHHHHHHHhcCCCCCCCceecCeecchhhHHHHHHhcCccc
Q psy405           16 KESFLRDLQHFHETRGTPCRHVPKIGGKEIDLYLLYCLVTSNGGWV   61 (66)
Q Consensus        16 ~~~Fl~~L~~F~~~rg~p~~~~P~i~gk~lDL~~Ly~~V~~~GG~~   61 (66)
                      ...|+++|..-+.+.|..+. +=......+||..+-..+..-||.-
T Consensus       171 ~~~fY~~la~~~~~~~isvD-lF~~~~~~~dla~l~~l~~~TGG~v  215 (244)
T cd01479         171 QTDFYKKLALECVKSQISVD-LFLFSNQYVDVATLGCLSRLTGGQV  215 (244)
T ss_pred             chHHHHHHHHHHHHcCeEEE-EEEccCcccChhhhhhhhhhcCceE
Confidence            46899999999999998877 4455677899999999999999953


No 70 
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain.  Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522).  Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and  EndoH from Flavobacterium meningosepticum, and  EndoE from Enterococcus faecalis.  EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues.  EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
Probab=20.03  E-value=1.6e+02  Score=19.59  Aligned_cols=20  Identities=5%  Similarity=0.110  Sum_probs=16.9

Q ss_pred             chHhHHHHHHHHHHHHHhcC
Q psy405           12 YFKEKESFLRDLQHFHETRG   31 (66)
Q Consensus        12 ~~~~~~~Fl~~L~~F~~~rg   31 (66)
                      ....++.|.+.+.+++.+-|
T Consensus        85 ~~~~~~~fa~~l~~~v~~yg  104 (255)
T cd06542          85 SDAAAKAYAKAIVDTVDKYG  104 (255)
T ss_pred             CHHHHHHHHHHHHHHHHHhC
Confidence            44668999999999998876


Done!