Query         psy4056
Match_columns 227
No_of_seqs    214 out of 1412
Neff          6.1 
Searched_HMMs 46136
Date          Sat Aug 17 00:13:22 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4056.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4056hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1235|consensus              100.0   1E-47 2.2E-52  367.6  13.4  176   52-227    60-235 (538)
  2 COG0661 AarF Predicted unusual 100.0 2.9E-46 6.3E-51  357.3  18.7  148   80-227    52-202 (517)
  3 TIGR01982 UbiB 2-polyprenylphe 100.0 4.6E-42 9.9E-47  323.1  17.9  143   84-226    48-193 (437)
  4 PRK04750 ubiB putative ubiquin 100.0 2.2E-41 4.7E-46  325.3  18.2  143   84-226    50-196 (537)
  5 KOG1236|consensus              100.0 2.5E-32 5.5E-37  253.4   9.4  142   83-225   118-276 (565)
  6 PF03109 ABC1:  ABC1 family;  I  99.9 1.4E-28 3.1E-33  194.2   4.4   85  143-227     1-87  (119)
  7 KOG1234|consensus               99.8 3.2E-22   7E-27  178.2   3.7  120  107-226     2-122 (363)
  8 cd05145 RIO1_like RIO kinase f  97.5 0.00017 3.8E-09   60.1   5.5   32  159-190     3-34  (190)
  9 cd05147 RIO1_euk RIO kinase fa  97.2 0.00062 1.3E-08   57.3   5.0   32  159-190     3-34  (190)
 10 cd05119 RIO RIO kinase family,  96.5  0.0023 4.9E-08   52.2   3.2   33  159-191     3-35  (187)
 11 smart00090 RIO RIO-like kinase  96.3   0.007 1.5E-07   52.8   5.3   31  159-189    34-66  (237)
 12 cd05144 RIO2_C RIO kinase fami  95.4   0.014   3E-07   48.6   3.1   32  158-189    20-51  (198)
 13 cd06657 STKc_PAK4 Catalytic do  94.5   0.049 1.1E-06   47.7   4.4   46  142-187     2-55  (292)
 14 cd07878 STKc_p38beta_MAPK11 Ca  93.6    0.11 2.3E-06   46.4   4.7   48  142-189     3-52  (343)
 15 cd07879 STKc_p38delta_MAPK13 C  93.2    0.14 3.1E-06   45.9   4.9   60  143-202     4-70  (342)
 16 cd00180 PKc Catalytic domain o  92.2    0.29 6.3E-06   38.4   4.9   44  161-204     1-49  (215)
 17 KOG1187|consensus               92.1    0.23   5E-06   46.1   4.8   48  155-202    76-127 (361)
 18 cd05085 PTKc_Fer Catalytic dom  91.8    0.42 9.1E-06   40.0   5.7   36  159-194     1-36  (250)
 19 smart00221 STYKc Protein kinas  91.8    0.32   7E-06   39.4   4.9   44  159-202     5-53  (225)
 20 cd05151 ChoK Choline Kinase (C  91.8    0.37   8E-06   38.2   5.1   47  158-205     3-51  (170)
 21 KOG0667|consensus               91.3    0.31 6.6E-06   48.3   4.9   46  158-203   191-239 (586)
 22 cd05084 PTKc_Fes Catalytic dom  91.2    0.52 1.1E-05   39.5   5.7   44  159-202     1-49  (252)
 23 cd06635 STKc_TAO1 Catalytic do  91.0    0.47   1E-05   41.9   5.5   47  139-187    13-60  (317)
 24 PF03881 Fructosamin_kin:  Fruc  91.0    0.25 5.4E-06   44.6   3.7   69  134-207     2-70  (288)
 25 cd05581 STKc_PDK1 Catalytic do  90.8    0.36 7.9E-06   40.8   4.4   29  159-187     7-36  (280)
 26 cd06629 STKc_MAPKKK_Bck1_like   90.5     0.4 8.7E-06   40.7   4.4   35  153-187     1-36  (272)
 27 KOG4236|consensus               90.4    0.31 6.6E-06   48.3   3.9   58  147-204   558-621 (888)
 28 PRK10593 hypothetical protein;  90.3    0.64 1.4E-05   41.8   5.7   64  135-205     2-66  (297)
 29 cd05069 PTKc_Yes Catalytic dom  90.2    0.52 1.1E-05   39.9   4.9   44  159-202    12-57  (260)
 30 PLN00034 mitogen-activated pro  90.0    0.49 1.1E-05   42.6   4.8   44  159-202    80-128 (353)
 31 cd06632 STKc_MEKK1_plant Catal  89.9    0.55 1.2E-05   39.2   4.7   31  158-188     5-36  (258)
 32 cd07860 STKc_CDK2_3 Catalytic   89.6    0.61 1.3E-05   39.9   4.9   45  159-203     6-56  (284)
 33 KOG0192|consensus               89.6    0.53 1.1E-05   43.9   4.7   41  161-202    49-95  (362)
 34 cd05122 PKc_STE Catalytic doma  89.3    0.69 1.5E-05   38.0   4.8   44  158-201     5-52  (253)
 35 cd07880 STKc_p38gamma_MAPK12 C  89.3    0.54 1.2E-05   42.2   4.4   48  141-188     2-51  (343)
 36 cd05067 PTKc_Lck_Blk Catalytic  88.9    0.67 1.5E-05   39.1   4.6   43  159-201    12-56  (260)
 37 cd07835 STKc_CDK1_like Catalyt  88.8    0.75 1.6E-05   39.3   4.8   44  159-202     5-54  (283)
 38 cd05112 PTKc_Itk Catalytic dom  88.7    0.87 1.9E-05   38.2   5.1   45  159-203    10-56  (256)
 39 cd07877 STKc_p38alpha_MAPK14 C  88.7    0.58 1.3E-05   42.0   4.2   32  158-189    22-54  (345)
 40 cd05070 PTKc_Fyn_Yrk Catalytic  88.6     0.8 1.7E-05   38.7   4.8   44  159-202    12-57  (260)
 41 cd07847 STKc_CDKL1_4 Catalytic  88.5    0.77 1.7E-05   39.1   4.7   45  159-203     7-57  (286)
 42 KOG0595|consensus               88.3    0.69 1.5E-05   44.0   4.6   43  161-203    18-66  (429)
 43 smart00219 TyrKc Tyrosine kina  88.3    0.85 1.8E-05   37.9   4.7   44  159-202     5-57  (258)
 44 PRK14879 serine/threonine prot  88.2    0.98 2.1E-05   37.2   5.0   30  159-189     2-31  (211)
 45 PRK09188 serine/threonine prot  87.7    0.93   2E-05   42.4   5.0   46  158-203    23-78  (365)
 46 cd06606 STKc_MAPKKK Catalytic   87.7     1.1 2.4E-05   36.9   5.0   32  158-189     5-37  (260)
 47 cd06637 STKc_TNIK Catalytic do  87.6     1.4 2.9E-05   37.3   5.7   54  148-203     3-59  (272)
 48 cd08224 STKc_Nek6_Nek7 Catalyt  87.5    0.94   2E-05   38.0   4.6   45  158-202     7-58  (267)
 49 cd06917 STKc_NAK1_like Catalyt  87.4     1.2 2.7E-05   37.8   5.3   45  159-203     7-56  (277)
 50 cd05120 APH_ChoK_like Aminogly  87.3     1.8   4E-05   32.3   5.7   47  158-205     3-50  (155)
 51 cd07840 STKc_CDK9_like Catalyt  87.3       1 2.2E-05   38.2   4.7   45  159-203     5-55  (287)
 52 cd07861 STKc_CDK1_euk Catalyti  87.2     1.1 2.5E-05   38.1   5.0   44  159-202     6-55  (285)
 53 cd05034 PTKc_Src_like Catalyti  87.2     1.1 2.3E-05   37.8   4.7   44  159-202    12-57  (261)
 54 cd06630 STKc_MEKK1 Catalytic d  87.2     1.3 2.8E-05   37.4   5.2   44  159-202     6-59  (268)
 55 cd07863 STKc_CDK4 Catalytic do  87.0     1.3 2.9E-05   37.9   5.3   46  159-204     6-57  (288)
 56 cd07864 STKc_CDK12 Catalytic d  86.8     1.2 2.6E-05   38.4   4.9   44  159-202    13-62  (302)
 57 cd05154 ACAD10_11_like Acyl-Co  86.7     1.1 2.4E-05   36.7   4.5   49  157-205     2-54  (223)
 58 cd07833 STKc_CDKL Catalytic do  86.5       1 2.3E-05   38.3   4.3   45  159-203     7-57  (288)
 59 PTZ00263 protein kinase A cata  86.3    0.87 1.9E-05   40.6   3.9   30  158-187    23-53  (329)
 60 cd06626 STKc_MEKK4 Catalytic d  86.1     1.1 2.5E-05   37.5   4.3   44  159-202     6-55  (264)
 61 cd07836 STKc_Pho85 Catalytic d  86.1     1.5 3.2E-05   37.4   5.1   44  159-202     6-54  (284)
 62 cd06631 STKc_YSK4 Catalytic do  86.0     1.4   3E-05   37.2   4.8   30  159-188     6-35  (265)
 63 cd06638 STKc_myosinIIIA Cataly  85.9     1.7 3.6E-05   37.2   5.3   46  159-204    24-72  (286)
 64 KOG1166|consensus               85.9    0.59 1.3E-05   48.9   2.9   31  159-189   704-734 (974)
 65 cd05575 STKc_SGK Catalytic dom  85.6     1.5 3.3E-05   38.8   5.1   29  160-188     2-31  (323)
 66 cd06642 STKc_STK25-YSK1 Cataly  85.6     1.4   3E-05   37.7   4.7   39  149-189     2-41  (277)
 67 smart00220 S_TKc Serine/Threon  85.4     1.7 3.7E-05   35.2   5.0   38  165-202     1-43  (244)
 68 cd05626 STKc_LATS2 Catalytic d  85.3     1.1 2.4E-05   40.8   4.2   29  159-187     7-36  (381)
 69 cd07851 STKc_p38 Catalytic dom  85.3     1.3 2.8E-05   39.6   4.5   31  158-188    20-51  (343)
 70 cd06639 STKc_myosinIIIB Cataly  85.3     1.8 3.8E-05   37.3   5.2   45  159-203    28-75  (291)
 71 cd07869 STKc_PFTAIRE1 Catalyti  85.2     1.5 3.2E-05   38.2   4.7   30  158-187    10-40  (303)
 72 cd05603 STKc_SGK2 Catalytic do  85.1     1.7 3.7E-05   38.3   5.2   29  160-188     2-31  (321)
 73 cd05604 STKc_SGK3 Catalytic do  85.1     1.7 3.7E-05   38.5   5.1   30  160-189     2-32  (325)
 74 cd05600 STKc_Sid2p_Dbf2p Catal  84.9     1.7 3.7E-05   38.6   5.0   31  159-189     7-38  (333)
 75 cd05096 PTKc_DDR1 Catalytic do  84.7     1.4 3.1E-05   38.3   4.4   35  158-192    10-61  (304)
 76 cd06646 STKc_MAP4K5 Catalytic   84.6     1.7 3.8E-05   36.7   4.8   31  159-189    15-46  (267)
 77 cd06614 STKc_PAK Catalytic dom  84.4     1.7 3.8E-05   37.2   4.8   52  148-201    16-70  (286)
 78 cd05612 STKc_PRKX_like Catalyt  84.3     1.4 2.9E-05   38.4   4.1   29  159-187     7-36  (291)
 79 cd07871 STKc_PCTAIRE3 Catalyti  84.2     1.7 3.8E-05   37.6   4.7   44  159-202    11-59  (288)
 80 cd07832 STKc_CCRK Catalytic do  84.1     1.7 3.6E-05   37.0   4.5   45  159-203     6-56  (286)
 81 KOG0574|consensus               84.0    0.18 3.9E-06   46.8  -1.6   78  136-215    18-102 (502)
 82 cd06641 STKc_MST3 Catalytic do  84.0     2.8   6E-05   35.8   5.8   39  149-189     2-41  (277)
 83 cd05611 STKc_Rim15_like Cataly  84.0       1 2.3E-05   37.9   3.1   30  159-188     2-32  (260)
 84 cd05068 PTKc_Frk_like Catalyti  83.9       2 4.3E-05   36.2   4.9   45  159-203    12-58  (261)
 85 cd06633 STKc_TAO3 Catalytic do  83.5     2.1 4.6E-05   37.6   5.0   40  146-187    16-56  (313)
 86 cd05072 PTKc_Lyn Catalytic dom  83.4     2.3   5E-05   35.8   5.0   30  159-188    12-41  (261)
 87 cd05073 PTKc_Hck Catalytic dom  83.4     2.1 4.5E-05   36.2   4.8   45  158-202    11-57  (260)
 88 cd05041 PTKc_Fes_like Catalyti  83.1       2 4.3E-05   35.8   4.5   31  160-190     2-32  (251)
 89 cd05103 PTKc_VEGFR2 Catalytic   83.1     2.1 4.5E-05   38.3   4.9   46  158-203    12-67  (343)
 90 cd07848 STKc_CDKL5 Catalytic d  83.1     1.9 4.1E-05   37.0   4.4   43  159-201     7-55  (287)
 91 cd07837 STKc_CdkB_plant Cataly  83.0     2.1 4.6E-05   36.7   4.7   45  159-203     7-57  (295)
 92 PF07714 Pkinase_Tyr:  Protein   83.0     1.9 4.2E-05   36.7   4.5   32  160-191     6-42  (259)
 93 cd07867 STKc_CDC2L6 Catalytic   83.0     2.1 4.6E-05   37.2   4.8   47  156-202     4-54  (317)
 94 cd06645 STKc_MAP4K3 Catalytic   82.7     1.9 4.2E-05   36.4   4.3   32  159-190    15-47  (267)
 95 cd05599 STKc_NDR_like Catalyti  82.6     1.8 3.9E-05   38.8   4.3   29  159-187     7-36  (364)
 96 cd06605 PKc_MAPKK Catalytic do  82.5     2.2 4.7E-05   35.9   4.5   43  159-201     7-54  (265)
 97 cd07873 STKc_PCTAIRE1 Catalyti  82.5     2.4 5.1E-05   36.8   4.9   44  158-201    11-59  (301)
 98 cd05627 STKc_NDR2 Catalytic do  82.4     1.9 4.2E-05   38.8   4.4   29  159-187     7-36  (360)
 99 PTZ00284 protein kinase; Provi  82.4     2.2 4.8E-05   40.2   4.9   45  159-203   135-182 (467)
100 cd05573 STKc_ROCK_NDR_like Cat  82.4       2 4.4E-05   38.0   4.5   30  159-188     7-37  (350)
101 cd07838 STKc_CDK4_6_like Catal  82.3     2.7 5.8E-05   35.7   5.0   45  159-203     5-55  (287)
102 cd05590 STKc_nPKC_eta Catalyti  82.3     2.4 5.2E-05   37.6   4.9   29  160-188     2-31  (320)
103 cd00192 PTKc Catalytic domain   82.2     3.3   7E-05   34.3   5.4   34  159-192     1-38  (262)
104 cd06608 STKc_myosinIII_like Ca  82.1       3 6.6E-05   34.9   5.3   45  159-203    12-59  (275)
105 PHA02988 hypothetical protein;  82.1     2.5 5.4E-05   36.8   4.9   31  157-188    24-54  (283)
106 cd06636 STKc_MAP4K4_6 Catalyti  82.0     2.9 6.3E-05   35.7   5.2   30  159-188    22-52  (282)
107 cd08229 STKc_Nek7 Catalytic do  81.9       2 4.3E-05   36.2   4.1   28  159-186     8-36  (267)
108 cd06611 STKc_SLK_like Catalyti  81.8     2.9 6.2E-05   35.7   5.1   34  159-192    11-45  (280)
109 cd07845 STKc_CDK10 Catalytic d  81.8       2 4.3E-05   37.4   4.2   44  159-202    13-62  (309)
110 cd07868 STKc_CDK8 Catalytic do  81.7     3.1 6.7E-05   36.3   5.3   48  156-203     4-55  (317)
111 cd06628 STKc_MAPKKK_Byr2_like   81.5     2.8 6.1E-05   35.3   4.9   30  159-188     6-36  (267)
112 cd05597 STKc_DMPK_like Catalyt  81.4     2.1 4.5E-05   38.2   4.2   29  159-187     7-36  (331)
113 cd05040 PTKc_Ack_like Catalyti  81.3     2.4 5.2E-05   35.5   4.4   32  160-191     2-37  (257)
114 cd07859 STKc_TDY_MAPK_plant Ca  81.3     2.5 5.4E-05   37.1   4.6   29  159-187     6-35  (338)
115 cd06649 PKc_MEK2 Catalytic dom  81.1     2.5 5.5E-05   37.5   4.7   43  159-201    11-58  (331)
116 cd05631 STKc_GRK4 Catalytic do  81.0     2.4 5.3E-05   36.6   4.4   31  159-189     6-37  (285)
117 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  80.9     3.1 6.7E-05   35.5   5.0   44  159-202    10-61  (284)
118 cd07862 STKc_CDK6 Catalytic do  80.8     3.1 6.6E-05   35.7   4.9   44  159-202     7-57  (290)
119 cd07853 STKc_NLK Catalytic dom  80.8     2.8   6E-05   37.9   4.9   29  159-187     6-35  (372)
120 cd05620 STKc_nPKC_delta Cataly  80.8       3 6.5E-05   36.9   5.0   30  160-189     2-32  (316)
121 cd06607 STKc_TAO Catalytic dom  80.8     2.9 6.3E-05   36.4   4.8   38  148-187    12-50  (307)
122 cd07842 STKc_CDK8_like Catalyt  80.8     2.8   6E-05   36.3   4.7   44  159-202     6-58  (316)
123 cd06617 PKc_MKK3_6 Catalytic d  80.7     2.2 4.7E-05   36.3   3.9   32  159-190     7-39  (283)
124 cd06623 PKc_MAPKK_plant_like C  80.7     3.5 7.5E-05   34.4   5.1   32  159-190     7-39  (264)
125 cd05571 STKc_PKB Catalytic dom  80.5     2.5 5.4E-05   37.5   4.4   29  160-188     2-31  (323)
126 cd07841 STKc_CDK7 Catalytic do  80.5     2.7 5.9E-05   36.2   4.5   43  159-201     6-57  (298)
127 KOG1163|consensus               80.5     1.4   3E-05   40.0   2.6   32  159-190    21-53  (341)
128 PF00069 Pkinase:  Protein kina  80.5     3.4 7.4E-05   34.4   5.0   36  159-194     5-41  (260)
129 cd06627 STKc_Cdc7_like Catalyt  80.5     4.2 9.1E-05   33.6   5.5   33  158-190     5-38  (254)
130 cd06610 STKc_OSR1_SPAK Catalyt  80.5       4 8.7E-05   34.1   5.4   31  158-188     6-37  (267)
131 cd05598 STKc_LATS Catalytic do  80.3     2.9 6.3E-05   37.8   4.8   29  159-187     7-36  (376)
132 cd05063 PTKc_EphR_A2 Catalytic  80.2       3 6.6E-05   35.2   4.6   34  158-191    10-47  (268)
133 cd05632 STKc_GRK5 Catalytic do  80.2     2.9 6.2E-05   36.1   4.5   30  159-188     6-36  (285)
134 cd05628 STKc_NDR1 Catalytic do  80.0     2.5 5.4E-05   38.2   4.3   29  159-187     7-36  (363)
135 cd05587 STKc_cPKC Catalytic do  79.9     2.7 5.9E-05   37.1   4.4   31  159-189     6-37  (324)
136 cd07872 STKc_PCTAIRE2 Catalyti  79.9     2.9 6.3E-05   36.5   4.5   31  158-188    11-42  (309)
137 cd05602 STKc_SGK1 Catalytic do  79.8     3.6 7.8E-05   36.4   5.1   29  160-188     2-31  (325)
138 cd05102 PTKc_VEGFR3 Catalytic   79.4     2.4 5.2E-05   37.5   3.9   45  159-203    13-67  (338)
139 cd05608 STKc_GRK1 Catalytic do  79.4     2.8   6E-05   36.1   4.2   28  161-188     1-29  (280)
140 cd07839 STKc_CDK5 Catalytic do  79.3     2.8 6.1E-05   35.7   4.2   44  159-202     6-55  (284)
141 PTZ00036 glycogen synthase kin  79.2     3.7 8.1E-05   38.6   5.3   62  138-202    53-115 (440)
142 PLN00009 cyclin-dependent kina  79.2     3.2   7E-05   35.7   4.5   45  159-203     8-58  (294)
143 cd06625 STKc_MEKK3_like Cataly  79.1       5 0.00011   33.6   5.6   31  158-188     7-38  (263)
144 cd06640 STKc_MST4 Catalytic do  79.1     4.2 9.1E-05   34.7   5.2   36  150-187     3-39  (277)
145 cd05579 STKc_MAST_like Catalyt  78.9     5.7 0.00012   32.9   5.9   28  161-188     1-29  (265)
146 cd08225 STKc_Nek5 Catalytic do  78.8     3.2 6.9E-05   34.6   4.3   44  158-201     5-54  (257)
147 cd07876 STKc_JNK2 Catalytic do  78.7     3.1 6.8E-05   37.3   4.5   30  159-188    27-57  (359)
148 cd07870 STKc_PFTAIRE2 Catalyti  78.7     3.8 8.3E-05   35.2   4.8   45  158-202    10-59  (291)
149 cd05592 STKc_nPKC_theta_delta   78.6     1.8   4E-05   38.2   2.9   30  160-189     2-32  (316)
150 cd05591 STKc_nPKC_epsilon Cata  78.5     1.7 3.7E-05   38.4   2.6   29  160-188     2-31  (321)
151 cd05570 STKc_PKC Catalytic dom  78.3     3.6 7.8E-05   36.3   4.7   29  160-188     2-31  (318)
152 cd05615 STKc_cPKC_alpha Cataly  78.3       2 4.4E-05   38.1   3.1   30  159-188     6-36  (323)
153 cd05059 PTKc_Tec_like Catalyti  78.1     3.8 8.3E-05   34.5   4.6   44  159-202    10-55  (256)
154 KOG0600|consensus               78.1     2.8   6E-05   41.1   4.1   53  150-204   116-174 (560)
155 cd07846 STKc_CDKL2_3 Catalytic  78.1     3.9 8.4E-05   34.8   4.7   44  159-202     7-56  (286)
156 cd05107 PTKc_PDGFR_beta Cataly  78.1     3.2   7E-05   38.7   4.5   32  159-190    43-80  (401)
157 cd05617 STKc_aPKC_zeta Catalyt  78.1     3.8 8.3E-05   36.4   4.8   30  160-189     2-32  (327)
158 cd07874 STKc_JNK3 Catalytic do  78.0     4.6 9.9E-05   36.1   5.3   37  152-188    15-53  (355)
159 PTZ00024 cyclin-dependent prot  77.9     3.2 6.8E-05   36.7   4.2   30  159-188    15-45  (335)
160 TIGR03724 arch_bud32 Kae1-asso  77.8     4.5 9.7E-05   33.0   4.8   27  161-188     2-28  (199)
161 cd05038 PTKc_Jak_rpt2 Catalyti  77.7     3.8 8.2E-05   34.7   4.5   44  159-202    10-62  (284)
162 KOG0199|consensus               77.6     2.1 4.5E-05   43.9   3.1   38  160-197   117-158 (1039)
163 cd05064 PTKc_EphR_A10 Catalyti  77.4     3.5 7.6E-05   35.1   4.2   32  159-190    11-46  (266)
164 cd05589 STKc_PKN Catalytic dom  77.3     3.3 7.2E-05   36.6   4.1   30  159-188     5-35  (324)
165 KOG0193|consensus               77.3     1.9 4.2E-05   43.1   2.8   52  149-202   387-444 (678)
166 cd05104 PTKc_Kit Catalytic dom  77.1     3.7 8.1E-05   37.4   4.5   46  158-203    40-95  (375)
167 cd05605 STKc_GRK4_like Catalyt  77.1     3.9 8.4E-05   35.3   4.4   30  159-188     6-36  (285)
168 cd07866 STKc_BUR1 Catalytic do  77.0     4.2 9.1E-05   35.0   4.6   43  159-201    14-62  (311)
169 cd06653 STKc_MEKK3_like_1 Cata  76.9       4 8.6E-05   34.5   4.4   30  158-187     7-37  (264)
170 cd05071 PTKc_Src Catalytic dom  76.9     4.8  0.0001   34.1   4.9   43  160-202    13-57  (262)
171 cd07844 STKc_PCTAIRE_like Cata  76.9       4 8.7E-05   35.0   4.5   44  159-202    11-59  (291)
172 cd06620 PKc_MAPKK_Byr1_like Ca  76.9     3.9 8.5E-05   35.1   4.4   43  159-201    11-58  (284)
173 cd05123 STKc_AGC Catalytic dom  76.9     4.3 9.3E-05   33.6   4.5   29  161-189     1-30  (250)
174 cd06612 STKc_MST1_2 Catalytic   76.7     4.1 8.8E-05   33.9   4.3   44  159-202     9-54  (256)
175 cd05049 PTKc_Trk Catalytic dom  76.6       4 8.6E-05   34.6   4.3   43  159-201    11-63  (280)
176 cd05588 STKc_aPKC Catalytic do  76.5     4.4 9.6E-05   36.0   4.7   29  160-188     2-31  (329)
177 cd05618 STKc_aPKC_iota Catalyt  76.5     4.9 0.00011   35.8   5.0   30  160-189     2-32  (329)
178 cd05074 PTKc_Tyro3 Catalytic d  76.4     3.4 7.5E-05   34.9   3.9   32  159-190     5-40  (273)
179 cd08228 STKc_Nek6 Catalytic do  76.4     3.9 8.3E-05   34.4   4.1   29  159-187     8-37  (267)
180 cd05584 STKc_p70S6K Catalytic   76.3     4.9 0.00011   35.6   4.9   29  159-187     2-34  (323)
181 cd05114 PTKc_Tec_Rlk Catalytic  76.3     5.3 0.00011   33.5   5.0   45  159-203    10-56  (256)
182 cd07865 STKc_CDK9 Catalytic do  76.2     4.7  0.0001   34.6   4.7   29  158-186    17-46  (310)
183 KOG0583|consensus               76.1     4.4 9.6E-05   37.8   4.8   47  158-204    22-77  (370)
184 cd05108 PTKc_EGFR Catalytic do  75.9     5.3 0.00011   35.0   5.0   33  158-190    12-49  (316)
185 cd05625 STKc_LATS1 Catalytic d  75.8     3.8 8.2E-05   37.2   4.2   29  159-187     7-36  (382)
186 cd07854 STKc_MAPK4_6 Catalytic  75.7     4.8  0.0001   35.9   4.8   44  158-201    10-57  (342)
187 PF04655 APH_6_hur:  Aminoglyco  75.7       3 6.5E-05   37.1   3.4   32  159-190     8-39  (253)
188 cd06624 STKc_ASK Catalytic dom  75.3       7 0.00015   33.0   5.5   34  158-191    13-47  (268)
189 cd05050 PTKc_Musk Catalytic do  75.3     5.7 0.00012   34.0   5.0   43  159-201    11-63  (288)
190 cd07850 STKc_JNK Catalytic dom  75.2     4.8  0.0001   36.0   4.6   29  158-186    21-50  (353)
191 cd05113 PTKc_Btk_Bmx Catalytic  75.1       5 0.00011   33.9   4.5   43  159-201    10-54  (256)
192 cd06650 PKc_MEK1 Catalytic dom  74.8     5.1 0.00011   35.7   4.7   44  159-202    11-59  (333)
193 cd05578 STKc_Yank1 Catalytic d  74.7     4.8  0.0001   33.7   4.3   29  159-187     6-35  (258)
194 cd05629 STKc_NDR_like_fungal C  74.3     4.3 9.4E-05   36.7   4.2   29  159-187     7-36  (377)
195 cd05593 STKc_PKB_gamma Catalyt  74.2     6.8 0.00015   34.8   5.3   30  160-189     2-32  (328)
196 cd07829 STKc_CDK_like Catalyti  74.0     5.8 0.00013   33.5   4.6   44  159-202     5-54  (282)
197 cd05572 STKc_cGK_PKG Catalytic  73.9     5.6 0.00012   33.4   4.5   28  161-188     1-29  (262)
198 cd06609 STKc_MST3_like Catalyt  73.8     6.1 0.00013   33.5   4.8   30  159-188     7-37  (274)
199 cd05080 PTKc_Tyk2_rpt2 Catalyt  73.7     6.1 0.00013   33.8   4.7   31  159-189    10-45  (283)
200 cd05109 PTKc_HER2 Catalytic do  73.6     8.7 0.00019   32.7   5.7   34  159-192    13-51  (279)
201 cd05586 STKc_Sck1_like Catalyt  73.6     3.2   7E-05   36.7   3.1   27  161-187     1-28  (330)
202 cd05105 PTKc_PDGFR_alpha Catal  73.5     5.6 0.00012   37.1   4.8   33  159-191    43-81  (400)
203 cd05607 STKc_GRK7 Catalytic do  73.4       6 0.00013   34.0   4.6   27  161-187     1-28  (277)
204 cd05115 PTKc_Zap-70 Catalytic   73.3       8 0.00017   32.7   5.4   33  161-193     3-38  (257)
205 cd05614 STKc_MSK2_N N-terminal  73.3     6.1 0.00013   34.9   4.8   30  159-188     6-39  (332)
206 cd05610 STKc_MASTL Catalytic d  73.2     4.1   9E-05   40.7   4.0   30  159-188    10-40  (669)
207 cd07849 STKc_ERK1_2_like Catal  72.9     6.1 0.00013   35.0   4.7   30  159-188    11-41  (336)
208 PF01636 APH:  Phosphotransfera  72.8     8.8 0.00019   31.2   5.4   46  159-205     3-49  (239)
209 PHA03209 serine/threonine kina  72.8     4.8  0.0001   36.4   4.0   30  159-188    72-102 (357)
210 cd05035 PTKc_Axl_like Catalyti  72.8       6 0.00013   33.2   4.4   31  159-189     5-39  (273)
211 cd07855 STKc_ERK5 Catalytic do  72.7     6.4 0.00014   34.9   4.8   30  159-188    11-41  (334)
212 cd05630 STKc_GRK6 Catalytic do  72.5     5.7 0.00012   34.3   4.4   31  159-189     6-37  (285)
213 cd07858 STKc_TEY_MAPK_plant Ca  72.4       7 0.00015   34.7   4.9   31  158-188    10-41  (337)
214 cd05118 STKc_CMGC Catalytic do  72.3     7.1 0.00015   33.0   4.8   44  159-202     5-54  (283)
215 cd05585 STKc_YPK1_like Catalyt  72.2     5.6 0.00012   34.9   4.3   27  161-187     1-28  (312)
216 cd06618 PKc_MKK7 Catalytic dom  72.2       6 0.00013   34.2   4.4   31  158-188    20-51  (296)
217 cd05083 PTKc_Chk Catalytic dom  72.1     5.3 0.00011   33.5   3.9   41  159-200    12-53  (254)
218 cd05033 PTKc_EphR Catalytic do  71.9     6.4 0.00014   33.2   4.4   38  158-195     9-50  (266)
219 cd05580 STKc_PKA Catalytic dom  71.8     5.8 0.00012   34.2   4.2   30  159-188     7-37  (290)
220 cd05601 STKc_CRIK Catalytic do  71.7     4.9 0.00011   35.5   3.8   30  159-188     7-37  (330)
221 cd06621 PKc_MAPKK_Pek1_like Ca  71.7     6.5 0.00014   33.8   4.5   43  159-201     7-54  (287)
222 cd05633 STKc_GRK3 Catalytic do  71.6     3.9 8.4E-05   35.3   3.0   30  160-189     1-31  (279)
223 cd05616 STKc_cPKC_beta Catalyt  71.4     3.2 6.9E-05   36.7   2.5   31  159-189     6-37  (323)
224 cd06616 PKc_MKK4 Catalytic dom  71.4       7 0.00015   33.4   4.6   31  159-189    10-41  (288)
225 cd06634 STKc_TAO2 Catalytic do  71.3     7.4 0.00016   34.0   4.8   39  147-187    11-50  (308)
226 PLN03225 Serine/threonine-prot  70.9     8.5 0.00018   37.9   5.6   31  158-188   137-172 (566)
227 PRK10345 hypothetical protein;  70.8       7 0.00015   33.5   4.4   46  157-204     6-54  (210)
228 cd06651 STKc_MEKK3 Catalytic d  70.6     8.4 0.00018   32.5   4.9   31  158-188     7-38  (266)
229 cd05039 PTKc_Csk_like Catalyti  70.1     9.1  0.0002   32.0   4.9   44  158-202    11-56  (256)
230 cd07875 STKc_JNK1 Catalytic do  70.1     7.5 0.00016   34.9   4.7   30  159-188    30-60  (364)
231 cd05583 STKc_MSK_N N-terminal   70.0     7.6 0.00016   33.3   4.5   29  159-187     6-38  (288)
232 cd05613 STKc_MSK1_N N-terminal  70.0       8 0.00017   33.1   4.7   45  159-203     6-61  (290)
233 cd05619 STKc_nPKC_theta Cataly  69.7       4 8.6E-05   36.2   2.8   30  160-189     2-32  (316)
234 cd06644 STKc_STK10_LOK Catalyt  69.4      11 0.00023   32.4   5.4   42  149-192    10-52  (292)
235 cd05595 STKc_PKB_beta Catalyti  69.4     9.9 0.00022   33.6   5.2   30  160-189     2-32  (323)
236 KOG0594|consensus               69.3       3 6.6E-05   38.6   1.9   55  150-206    10-70  (323)
237 PTZ00283 serine/threonine prot  69.0     4.3 9.2E-05   39.0   3.0   31  158-188    37-68  (496)
238 cd07856 STKc_Sty1_Hog1 Catalyt  68.9     8.7 0.00019   34.1   4.8   46  158-203    15-66  (328)
239 cd07843 STKc_CDC2L1 Catalytic   68.9     8.5 0.00018   33.0   4.6   30  159-188    11-41  (293)
240 cd05606 STKc_beta_ARK Catalyti  68.8     5.1 0.00011   34.4   3.2   29  160-188     1-30  (278)
241 cd08227 PK_STRAD_alpha Pseudok  68.5     6.6 0.00014   34.7   3.9   28  161-188     6-36  (327)
242 cd06613 STKc_MAP4K3_like Catal  68.5     8.7 0.00019   32.0   4.5   31  159-189     9-40  (262)
243 cd05052 PTKc_Abl Catalytic dom  67.8      10 0.00022   32.0   4.8   31  159-189    12-43  (263)
244 cd08217 STKc_Nek2 Catalytic do  67.7      11 0.00023   31.3   4.8   29  159-187     6-35  (265)
245 cd05574 STKc_phototropin_like   67.4     8.6 0.00019   33.5   4.4   30  159-188     7-37  (316)
246 cd05077 PTK_Jak1_rpt1 Pseudoki  67.3      10 0.00022   32.2   4.8   32  160-191     2-46  (262)
247 KOG4721|consensus               67.3     2.9 6.2E-05   42.1   1.4   67  114-203   103-169 (904)
248 cd05101 PTKc_FGFR2 Catalytic d  66.5      11 0.00023   32.7   4.8   46  158-203    20-77  (304)
249 cd05596 STKc_ROCK Catalytic do  66.2     8.2 0.00018   35.1   4.1   29  159-187    49-78  (370)
250 PTZ00426 cAMP-dependent protei  66.0     9.5 0.00021   34.3   4.5   28  159-186    36-65  (340)
251 cd08226 PK_STRAD_beta Pseudoki  66.0      11 0.00025   33.1   4.9   25  164-188    11-36  (328)
252 cd05624 STKc_MRCK_beta Catalyt  66.0      14 0.00029   32.9   5.4   29  159-187     7-36  (331)
253 cd05060 PTKc_Syk_like Catalyti  65.8      11 0.00024   31.5   4.6   31  161-191     3-37  (257)
254 cd05047 PTKc_Tie Catalytic dom  65.8      12 0.00026   31.7   4.9   44  160-203     2-52  (270)
255 cd06658 STKc_PAK5 Catalytic do  65.6      12 0.00027   32.4   5.0   36  150-187    21-57  (292)
256 cd05079 PTKc_Jak1_rpt2 Catalyt  65.5     9.3  0.0002   32.7   4.2   32  160-191    11-47  (284)
257 cd05594 STKc_PKB_alpha Catalyt  65.4      13 0.00028   32.8   5.2   29  160-188     2-31  (325)
258 cd08529 STKc_FA2-like Catalyti  65.4     9.8 0.00021   31.6   4.2   29  159-187     6-35  (256)
259 cd05148 PTKc_Srm_Brk Catalytic  65.2     9.7 0.00021   31.8   4.1   43  159-201    12-57  (261)
260 PHA03212 serine/threonine kina  65.1     8.3 0.00018   35.6   4.0   42  159-203    98-140 (391)
261 cd06619 PKc_MKK5 Catalytic dom  65.1      15 0.00032   31.4   5.4   31  159-189     7-38  (279)
262 cd06622 PKc_MAPKK_PBS2_like Ca  65.0      12 0.00026   31.9   4.7   43  159-201     7-54  (286)
263 cd05116 PTKc_Syk Catalytic dom  64.7     9.8 0.00021   32.0   4.1   28  161-188     3-33  (257)
264 KOG0575|consensus               64.6      11 0.00023   37.7   4.7   46  159-204    24-76  (592)
265 PHA03207 serine/threonine kina  64.6     9.2  0.0002   35.0   4.2   43  159-203    98-143 (392)
266 cd07834 STKc_MAPK Catalytic do  64.5      13 0.00028   32.6   5.0   45  159-203     6-56  (330)
267 cd06648 STKc_PAK_II Catalytic   64.0      13 0.00028   32.0   4.8   29  158-186    24-53  (285)
268 cd06654 STKc_PAK1 Catalytic do  63.7     9.6 0.00021   33.1   3.9   30  159-188    26-56  (296)
269 cd05048 PTKc_Ror Catalytic Dom  63.6      11 0.00024   32.0   4.2   34  159-192    11-50  (283)
270 KOG0032|consensus               63.4      11 0.00025   35.3   4.6   46  159-204    41-93  (382)
271 cd05577 STKc_GRK Catalytic dom  63.3      11 0.00025   32.0   4.3   28  161-188     1-29  (277)
272 cd06655 STKc_PAK2 Catalytic do  63.2      13 0.00029   32.2   4.8   28  159-186    25-53  (296)
273 cd05037 PTK_Jak_rpt1 Pseudokin  63.1      11 0.00024   31.3   4.1   41  160-200     2-55  (259)
274 PRK09550 mtnK methylthioribose  62.8      21 0.00046   33.9   6.3   58  131-190     6-64  (401)
275 cd06652 STKc_MEKK2 Catalytic d  62.7      11 0.00025   31.6   4.1   29  159-187     8-37  (265)
276 KOG3653|consensus               62.5     6.4 0.00014   38.4   2.7   42  159-201   216-257 (534)
277 cd05110 PTKc_HER4 Catalytic do  62.4      20 0.00043   31.2   5.7   33  159-191    13-50  (303)
278 PRK13184 pknD serine/threonine  62.3     9.5 0.00021   40.1   4.1   31  159-189     8-39  (932)
279 cd07830 STKc_MAK_like Catalyti  62.2      14  0.0003   31.3   4.6   31  159-189     5-36  (283)
280 cd05098 PTKc_FGFR1 Catalytic d  62.1      15 0.00032   32.0   4.8   46  158-203    23-80  (307)
281 cd05087 PTKc_Aatyk1_Aatyk3 Cat  62.0      13 0.00028   31.4   4.4   30  160-189     2-34  (269)
282 cd08223 STKc_Nek4 Catalytic do  61.9      16 0.00036   30.3   4.9   28  159-186     6-34  (257)
283 cd05057 PTKc_EGFR_like Catalyt  61.8      16 0.00035   31.1   4.9   32  159-190    13-49  (279)
284 cd05051 PTKc_DDR Catalytic dom  61.5      17 0.00037   31.1   5.0   33  159-191    11-60  (296)
285 cd06659 STKc_PAK6 Catalytic do  61.3      28 0.00061   30.2   6.5   29  160-188    28-57  (297)
286 cd08218 STKc_Nek1 Catalytic do  60.8      13 0.00027   31.1   4.0   28  159-186     6-34  (256)
287 cd05088 PTKc_Tie2 Catalytic do  60.8      15 0.00033   31.9   4.7   45  159-203    13-64  (303)
288 cd06647 STKc_PAK_I Catalytic d  60.4      16 0.00035   31.6   4.8   28  159-186    25-53  (293)
289 PRK05231 homoserine kinase; Pr  60.2      43 0.00093   29.6   7.5   49  130-186     5-54  (319)
290 KOG0658|consensus               60.0     9.3  0.0002   35.9   3.3   44  157-201    28-72  (364)
291 cd05622 STKc_ROCK1 Catalytic d  60.0      12 0.00026   34.1   4.0   29  159-187    49-78  (371)
292 KOG0587|consensus               59.6     9.6 0.00021   39.7   3.6   54  147-202    15-71  (953)
293 cd05609 STKc_MAST Catalytic do  59.5      24 0.00051   30.6   5.7   30  159-188     7-37  (305)
294 cd05089 PTKc_Tie1 Catalytic do  59.5      19 0.00041   31.1   5.1   46  158-203     7-59  (297)
295 cd06656 STKc_PAK3 Catalytic do  59.4      18  0.0004   31.3   4.9   30  159-188    25-55  (297)
296 cd06643 STKc_SLK Catalytic dom  58.5      24 0.00051   30.1   5.4   34  159-192    11-45  (282)
297 KOG0196|consensus               58.4     8.2 0.00018   40.1   2.8   73  125-199   603-679 (996)
298 KOG1094|consensus               58.4      12 0.00025   37.9   3.8   39  159-197   544-582 (807)
299 cd05082 PTKc_Csk Catalytic dom  58.1      19 0.00042   30.1   4.7   43  159-202    12-55  (256)
300 cd05061 PTKc_InsR Catalytic do  57.9      23 0.00049   30.4   5.2   31  159-189    12-48  (288)
301 cd05056 PTKc_FAK Catalytic dom  57.9      13 0.00028   31.4   3.7   33  158-190    11-47  (270)
302 cd05076 PTK_Tyk2_rpt1 Pseudoki  57.3      13 0.00029   31.8   3.7   30  161-190     3-57  (274)
303 KOG0597|consensus               57.3      11 0.00024   38.0   3.4   50  159-210     8-58  (808)
304 cd05054 PTKc_VEGFR Catalytic d  57.2      17 0.00037   32.5   4.5   30  159-188    13-48  (337)
305 PHA03211 serine/threonine kina  57.0      14 0.00029   35.4   4.0   42  158-202   174-216 (461)
306 cd05623 STKc_MRCK_alpha Cataly  57.0      11 0.00023   33.6   3.0   28  159-186     7-35  (332)
307 KOG0581|consensus               56.5      16 0.00034   34.4   4.1   45  159-203    85-134 (364)
308 cd08219 STKc_Nek3 Catalytic do  56.4      17 0.00038   30.2   4.2   28  159-186     6-34  (255)
309 cd07831 STKc_MOK Catalytic dom  56.4      12 0.00026   31.6   3.1   31  159-189     5-36  (282)
310 cd05106 PTKc_CSF-1R Catalytic   56.1      22 0.00047   32.4   5.0   46  158-203    43-98  (374)
311 cd08215 STKc_Nek Catalytic dom  55.9      24 0.00052   28.9   4.9   30  159-188     6-36  (258)
312 cd08530 STKc_CNK2-like Catalyt  55.8      19 0.00042   29.7   4.3   30  159-188     6-36  (256)
313 cd05091 PTKc_Ror2 Catalytic do  55.5      26 0.00056   29.8   5.2   35  159-193    11-51  (283)
314 cd05582 STKc_RSK_N N-terminal   55.2      16 0.00035   32.0   4.0   30  159-188     2-35  (318)
315 cd05036 PTKc_ALK_LTK Catalytic  55.2      29 0.00063   29.5   5.4   33  159-191    12-50  (277)
316 cd05097 PTKc_DDR_like Catalyti  55.2      14  0.0003   31.9   3.4   34  159-192    11-59  (295)
317 PF08667 BetR:  BetR domain;  I  54.8      26 0.00056   28.9   4.7   90   83-177     4-93  (147)
318 KOG0577|consensus               54.6     7.5 0.00016   39.4   1.8   72  136-213    14-87  (948)
319 PLN00113 leucine-rich repeat r  54.5      15 0.00032   37.9   4.0   30  158-187   695-725 (968)
320 cd05095 PTKc_DDR2 Catalytic do  54.1      19  0.0004   31.1   4.1   44  159-202    11-75  (296)
321 cd06615 PKc_MEK Catalytic doma  54.0      30 0.00065   30.2   5.4   34  159-192     7-41  (308)
322 cd05621 STKc_ROCK2 Catalytic d  53.7      19 0.00042   32.8   4.3   28  159-186    49-77  (370)
323 cd08220 STKc_Nek8 Catalytic do  52.5      25 0.00055   29.0   4.5   44  159-202     6-55  (256)
324 cd05111 PTK_HER3 Pseudokinase   51.8      25 0.00055   30.0   4.5   31  159-189    13-48  (279)
325 cd05075 PTKc_Axl Catalytic dom  51.7      33 0.00071   28.8   5.1   31  159-189     5-38  (272)
326 cd05065 PTKc_EphR_B Catalytic   51.7      36 0.00077   28.6   5.4   33  159-191    10-46  (269)
327 COG3105 Uncharacterized protei  51.5   1E+02  0.0022   25.1   7.4   42   72-117    51-93  (138)
328 PRK06148 hypothetical protein;  51.5      46   0.001   35.3   7.1   57  125-189     4-60  (1013)
329 KOG4250|consensus               51.4     9.5 0.00021   38.8   2.0   50  155-204    15-69  (732)
330 PF12844 HTH_19:  Helix-turn-he  51.4      62  0.0014   21.5   5.6   63   86-157     1-63  (64)
331 KOG0197|consensus               51.4      16 0.00034   35.6   3.4   43  161-203   214-258 (468)
332 cd05066 PTKc_EphR_A Catalytic   51.2      30 0.00065   29.1   4.8   32  159-190    10-45  (267)
333 cd05090 PTKc_Ror1 Catalytic do  51.2      38 0.00082   28.8   5.5   31  159-189    11-46  (283)
334 cd05044 PTKc_c-ros Catalytic d  51.2      14  0.0003   31.1   2.7   30  160-189     2-38  (269)
335 KOG0593|consensus               51.1      20 0.00044   33.5   3.9   43  160-202     9-57  (396)
336 KOG3622|consensus               51.0 2.2E+02  0.0047   31.0  11.4  120   18-145   569-692 (1572)
337 KOG0660|consensus               50.4      18 0.00039   34.0   3.5   29  158-186    27-56  (359)
338 cd07857 STKc_MPK1 Catalytic do  50.1      33 0.00072   30.2   5.1   45  159-203     6-58  (332)
339 cd05053 PTKc_FGFR Catalytic do  49.4      34 0.00075   29.1   5.0   32  159-190    18-55  (293)
340 cd07852 STKc_MAPK15 Catalytic   49.2      29 0.00064   30.6   4.6   29  159-187    13-42  (337)
341 PRK11768 serine/threonine prot  48.1 1.1E+02  0.0023   27.7   8.2   70  129-205     8-79  (325)
342 cd05058 PTKc_Met_Ron Catalytic  47.7      41 0.00088   28.0   5.1   28  160-187     2-33  (262)
343 PF13443 HTH_26:  Cro/C1-type H  47.7      45 0.00098   22.2   4.4   59   89-155     2-60  (63)
344 cd05055 PTKc_PDGFR Catalytic d  47.6      30 0.00065   30.1   4.4   46  158-203    40-95  (302)
345 cd05046 PTK_CCK4 Pseudokinase   45.7      36 0.00077   28.7   4.5   45  159-203    11-65  (275)
346 COG3001 Uncharacterized protei  45.7      74  0.0016   28.9   6.4   67  134-206     2-68  (286)
347 cd05043 PTK_Ryk Pseudokinase d  45.7      32  0.0007   29.1   4.2   34  159-192    12-50  (280)
348 KOG0201|consensus               44.6      23 0.00049   34.3   3.3   53  147-201     9-66  (467)
349 KOG0580|consensus               44.5      23 0.00049   32.0   3.0   45  155-199    23-75  (281)
350 KOG0668|consensus               44.3      36 0.00079   30.8   4.3   30  175-204    61-90  (338)
351 cd05062 PTKc_IGF-1R Catalytic   44.3      53  0.0011   27.8   5.3   31  159-189    12-48  (277)
352 PHA02882 putative serine/threo  43.7      20 0.00044   31.1   2.7   29  159-187    18-50  (294)
353 cd08221 STKc_Nek9 Catalytic do  43.6      39 0.00084   28.0   4.3   28  159-186     6-34  (256)
354 KOG0200|consensus               43.2      48   0.001   32.9   5.5   32  160-191   303-342 (609)
355 KOG1035|consensus               41.8      17 0.00037   39.4   2.1   56  151-206   476-534 (1351)
356 COG1718 RIO1 Serine/threonine   41.5      28  0.0006   31.5   3.1   35  160-194    55-89  (268)
357 cd05100 PTKc_FGFR3 Catalytic d  40.7      60  0.0013   28.6   5.3   46  158-203    17-74  (334)
358 PHA03390 pk1 serine/threonine-  40.5      40 0.00087   28.7   4.0   28  161-188    24-52  (267)
359 PLN03224 probable serine/threo  40.1      26 0.00056   34.3   3.0   31  158-188   150-197 (507)
360 KOG0983|consensus               39.7      27 0.00058   32.4   2.8   40  160-199    99-143 (391)
361 PF02520 DUF148:  Domain of unk  38.6 1.7E+02  0.0038   22.1   7.9   63   76-140    43-105 (113)
362 PF15508 NAAA-beta:  beta subun  38.4 1.3E+02  0.0028   22.3   6.1   30   99-128    49-78  (95)
363 cd08528 STKc_Nek10 Catalytic d  37.8      56  0.0012   27.3   4.5   29  159-187     6-36  (269)
364 KOG0582|consensus               37.0      78  0.0017   31.0   5.6   50  161-213    34-85  (516)
365 KOG2052|consensus               37.0      46   0.001   32.5   4.0   45  159-204   217-261 (513)
366 cd05045 PTKc_RET Catalytic dom  36.9      67  0.0015   27.4   4.8   32  159-190     6-43  (290)
367 KOG1164|consensus               36.5      49  0.0011   29.6   4.1   48  158-205    23-75  (322)
368 KOG4717|consensus               36.4      20 0.00044   35.9   1.6   22  166-187    26-53  (864)
369 PF11932 DUF3450:  Protein of u  35.8 2.7E+02  0.0059   24.2   8.5   76  100-193   111-195 (251)
370 KOG0591|consensus               35.6      52  0.0011   30.6   4.0   34  159-192    25-60  (375)
371 PF03298 Stanniocalcin:  Stanni  34.9      26 0.00056   30.5   1.9   66   95-164   140-205 (208)
372 COG1718 RIO1 Serine/threonine   34.6      66  0.0014   29.1   4.5   42  181-225   213-254 (268)
373 KOG0198|consensus               34.5      60  0.0013   29.9   4.3   44  159-202    23-70  (313)
374 cd05032 PTKc_InsR_like Catalyt  33.4 1.1E+02  0.0023   25.7   5.5   32  159-190    12-49  (277)
375 PRK10359 lipopolysaccharide co  33.4      88  0.0019   27.5   5.0   33  159-192    37-69  (232)
376 cd08216 PK_STRAD Pseudokinase   33.1      66  0.0014   27.7   4.2   26  162-188    11-36  (314)
377 smart00811 Alpha_kinase Alpha-  33.0 1.7E+02  0.0038   24.9   6.7   58  153-210    11-76  (198)
378 cd05042 PTKc_Aatyk Catalytic d  32.6      67  0.0015   26.9   4.1   30  161-190     3-35  (269)
379 KOG0588|consensus               32.2      37 0.00079   34.8   2.7   46  159-204    18-70  (786)
380 cd05150 APH Aminoglycoside 3'-  31.5      86  0.0019   26.4   4.6   42  164-206    10-51  (244)
381 PF12162 STAT1_TAZ2bind:  STAT1  31.4      30 0.00064   19.7   1.1   18  123-140     1-18  (23)
382 KOG0661|consensus               30.8      55  0.0012   32.2   3.5   55  161-218    18-73  (538)
383 cd05576 STKc_RPK118_like Catal  30.4      54  0.0012   27.2   3.1   25  164-188     4-29  (237)
384 cd05099 PTKc_FGFR4 Catalytic d  29.9      94   0.002   27.0   4.7   33  158-190    17-57  (314)
385 cd05078 PTK_Jak2_Jak3_rpt1 Pse  29.6      34 0.00073   28.7   1.7   30  159-188     1-38  (258)
386 PF08277 PAN_3:  PAN-like domai  29.1      47   0.001   22.7   2.1   21  164-184    51-71  (71)
387 PTZ00266 NIMA-related protein   28.7      71  0.0015   34.2   4.2   29  159-187    19-48  (1021)
388 cd05157 ETNK_euk Ethanolamine   28.4      83  0.0018   26.2   3.9   47  158-204     3-53  (235)
389 KOG0663|consensus               28.0      47   0.001   31.5   2.4   31  159-189    82-113 (419)
390 PRK09605 bifunctional UGMP fam  27.3      79  0.0017   30.6   4.0   32  156-188   336-367 (535)
391 KOG0592|consensus               27.2      30 0.00065   34.5   1.1   27  159-185    79-106 (604)
392 PF01163 RIO1:  RIO1 family;  I  27.1      57  0.0012   27.5   2.7   21  169-189     2-22  (188)
393 TIGR00270 conserved hypothetic  26.9 3.6E+02  0.0077   22.1   8.8   71   79-158    64-134 (154)
394 COG2334 Putative homoserine ki  26.1 3.2E+02  0.0069   25.2   7.6   64  133-205    13-77  (331)
395 PRK01964 4-oxalocrotonate taut  24.7      55  0.0012   22.2   1.8   33  135-167    22-54  (64)
396 cd08222 STKc_Nek11 Catalytic d  24.4 1.2E+02  0.0026   25.2   4.2   29  159-187     6-35  (260)
397 TIGR02721 ycfN_thiK thiamine k  23.8 1.5E+02  0.0033   25.3   4.8   46  159-205     2-50  (256)
398 TIGR02172 Fb_sc_TIGR02172 Fibr  22.4 1.7E+02  0.0036   25.0   4.7   45  158-205     6-51  (226)
399 PF11517 Nab2:  Nuclear abundan  22.3      28 0.00061   27.0  -0.1   43  115-157    47-94  (107)
400 TIGR00013 taut 4-oxalocrotonat  22.3      63  0.0014   21.5   1.7   33  135-167    22-54  (63)
401 cd05086 PTKc_Aatyk2 Catalytic   22.2 1.7E+02  0.0037   24.5   4.8   30  160-189     2-34  (268)
402 KOG0610|consensus               22.1      82  0.0018   30.5   2.9   30  159-188    83-113 (459)
403 PRK00745 4-oxalocrotonate taut  21.9      70  0.0015   21.3   1.9   33  135-167    22-54  (62)
404 cd06461 M2_ACE Peptidase famil  21.9 2.6E+02  0.0056   27.3   6.4   81   69-150    44-131 (477)
405 KOG0615|consensus               21.4      81  0.0018   30.6   2.7   46  159-204   178-234 (475)
406 PF13565 HTH_32:  Homeodomain-l  21.4   2E+02  0.0044   19.7   4.3   35  115-149    32-66  (77)
407 PF14875 PIP49_N:  N-term cyste  20.9      72  0.0016   26.5   2.0   22  161-183    78-99  (158)
408 PLN02756 S-methyl-5-thioribose  20.7 1.9E+02   0.004   27.9   5.1   58  128-190     5-68  (418)
409 COG2112 Predicted Ser/Thr prot  20.3 1.1E+02  0.0023   26.6   3.0   43  161-204    30-73  (201)
410 cd00491 4Oxalocrotonate_Tautom  20.0      76  0.0016   20.7   1.7   33  135-167    21-53  (58)

No 1  
>KOG1235|consensus
Probab=100.00  E-value=1e-47  Score=367.58  Aligned_cols=176  Identities=39%  Similarity=0.617  Sum_probs=160.1

Q ss_pred             HHHHHHHHHhhcCCCCCCCcHHHHHHHHHHHHHHHHHHHHHHHhcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCC
Q psy4056          52 NIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPM  131 (227)
Q Consensus        52 ~i~~~y~~~l~~~~~~~~~~~~~~~~~~~~h~~~a~~l~~~~~~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~  131 (227)
                      .+.++|.........+...++...+....+|.+.|++|+++|++|||+|||+||++|+++|++|+||.++|+.|||++||
T Consensus        60 ~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~a~~L~e~~~~nGg~yIKlGQ~lst~~dllP~Eyv~~L~~LqD~~Pp  139 (538)
T KOG1235|consen   60 PGVLDYKHSLSALAVSLASSESRLSKLSKVLLSAAERLLELFLRNGGTYIKLGQHLSTRPDLLPKEYVKTLSELQDQAPP  139 (538)
T ss_pred             ceEEehhhhcchhhccccchhhhHHHHHHHHHHHHHHHHHHHHHcCCeEEEechhhccccccCcHHHHHHHHHHhccCCC
Confidence            34455554442222324455656677788899999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEecCCCEEEEEecCCCcHHHHHHHHHHHHHHHHHHHHhC
Q psy4056         132 SPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVF  211 (227)
Q Consensus       132 ~~~~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~~  211 (227)
                      .|++++.++|++|||.+++++|.+||++||||||+||||+|+|++|++|||||||||+++.+..|+.+++.++.+++++|
T Consensus       140 ~~~ee~~~i~e~ElG~~ie~if~~f~~~piaaASlaQVhrA~L~~G~~VaVKVQ~P~l~~~~~~Dl~~~~~~~~~l~k~~  219 (538)
T KOG1235|consen  140 FPWEEAFKIFEEELGAPIEDIFSEFDEEPIAAASLAQVHRARLKNGEDVAVKVQHPGLEKLIMLDLRNLRLLAKVLQKFF  219 (538)
T ss_pred             CCHHHHHHHHHHHhCCCHHHHHHhcCcchhhhcchhheEEEEecCCCEEEEEecCcChHHHHHHHHHHHHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcchHHHHHHhcC
Q psy4056         212 PEFKFLWLVDETKRNI  227 (227)
Q Consensus       212 p~~~~~~l~~E~~~~l  227 (227)
                      |++++.|++||++++|
T Consensus       220 p~~~~~~lvdE~~~~L  235 (538)
T KOG1235|consen  220 PDFDLVWLVDEIAKSL  235 (538)
T ss_pred             cCCchhhHHHHHHhhh
Confidence            9999999999999876


No 2  
>COG0661 AarF Predicted unusual protein kinase [General function prediction only]
Probab=100.00  E-value=2.9e-46  Score=357.35  Aligned_cols=148  Identities=30%  Similarity=0.550  Sum_probs=143.1

Q ss_pred             HHHHHHHHHHHHHHHhcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCChhhhccccCcc
Q psy4056          80 KVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPN  159 (227)
Q Consensus        80 ~~h~~~a~~l~~~~~~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd~~  159 (227)
                      ...++.+++|++++++|||+|||+||++|||+|++|++|+++|++|||++||+|+++++++|++|||.+++++|++||++
T Consensus        52 ~~~~~~~~rL~~~L~~LGPtfIK~GQ~LStR~Dl~p~e~~~eL~~LQD~vpp~~~~~~~~iie~eLG~~iee~F~eF~~~  131 (517)
T COG0661          52 ELREKRAERLRLALEELGPTFIKLGQILSTRPDLVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPE  131 (517)
T ss_pred             HHhHhHHHHHHHHHHHhCCchhhhhhHHhcCccccCHHHHHHHHHhhcCCCCCCHHHHHHHHHHHhCCCHHHHHHHcCCC
Confidence            44567789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccceeeccceEEEEecCCCEEEEEecCCCcHHHHHHHHHHHHHHHHHHHHhCCC---CCcchHHHHHHhcC
Q psy4056         160 PMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPE---FKFLWLVDETKRNI  227 (227)
Q Consensus       160 PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~~p~---~~~~~l~~E~~~~l  227 (227)
                      |+|||||||||+|+|++|++||||||||||++.+..||.+|+.+++++++++|.   +++.++++|+.++|
T Consensus       132 PiAsASIaQVH~A~L~sG~~VAVKVqrPgi~~~i~~DL~il~~~a~~~~~~~~~~~~l~~~~vv~e~~~~l  202 (517)
T COG0661         132 PIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEADLKLLRRLARLIKRLPPGGRRLDLVEVVDEFEKRL  202 (517)
T ss_pred             chhhhhHhhheeEEecCCCEEEEEecCCChHHHHHHHHHHHHHHHHHHHHcCCccccCChHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999998   88899999998864


No 3  
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase. This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol - 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species.
Probab=100.00  E-value=4.6e-42  Score=323.07  Aligned_cols=143  Identities=29%  Similarity=0.431  Sum_probs=137.5

Q ss_pred             HHHHHHHHHHHhcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCChhhhccccCccccce
Q psy4056          84 EAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGA  163 (227)
Q Consensus        84 ~~a~~l~~~~~~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd~~Pias  163 (227)
                      ..|++++++++++||+|||+||++|+|+|++|++||++|++|||++||+|++++++++++|||.+++++|.+||++|+||
T Consensus        48 ~~~~~l~~~l~~lGp~fiKlGQ~lS~r~dllp~~~~~~L~~Lqd~v~p~~~~~~~~~l~~elg~~~~~~F~~fd~~plas  127 (437)
T TIGR01982        48 SRGERLRLALEELGPTFIKFGQTLSTRADLLPADIAEELSLLQDRVPPFDFKVARKVIEAALGGPLEELFAEFEEKPLAA  127 (437)
T ss_pred             cHHHHHHHHHHHcCchhHHHhHHHHhCcccCCHHHHHHHHHHhcCCCCCCHHHHHHHHHHHhCcCHHHHHhhCCCcceee
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeccceEEEEecCCCEEEEEecCCCcHHHHHHHHHHHHHHHHHHHHhCCC---CCcchHHHHHHhc
Q psy4056         164 ASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPE---FKFLWLVDETKRN  226 (227)
Q Consensus       164 ASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~~p~---~~~~~l~~E~~~~  226 (227)
                      |||||||+|+++||++|||||||||+.+.+..|+.+|+.+++++++++|.   +++.++++|+++.
T Consensus       128 aSigQVh~A~l~~G~~VaVKv~rp~i~~~i~~Dl~~l~~~~~~~~~~~~~~~~~~~~~~~~e~~~~  193 (437)
T TIGR01982       128 ASIAQVHRARLVDGKEVAVKVLRPGIEKTIAADIALLYRLARIVERLSPDSRRLRPTEVVKEFEKT  193 (437)
T ss_pred             eehhheEEEEecCCCEEEEEeeCCCcHHHHHHHHHHHHHHHHHHHHhCccccccCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999886   4568889988764


No 4  
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed
Probab=100.00  E-value=2.2e-41  Score=325.34  Aligned_cols=143  Identities=24%  Similarity=0.346  Sum_probs=137.3

Q ss_pred             HHHHHHHHHHHhcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCChhhhccccCccccce
Q psy4056          84 EAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGA  163 (227)
Q Consensus        84 ~~a~~l~~~~~~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd~~Pias  163 (227)
                      ..|++++.+++++||+|||+||++|||+|++|++|+++|++|||++||+|++++++++++|||.+++++|.+||++|+||
T Consensus        50 ~~~~rlr~aLe~LGp~fIKlGQ~LStR~DllP~~~~~eL~~Lqd~vpp~~~~~~~~~ie~elG~~~~~~F~~fd~~Plas  129 (537)
T PRK04750         50 PRGERLRLALEELGPIFVKFGQMLSTRRDLFPPDIADELALLQDRVPPFDGALARAIIEKALGGPVEEWFDDFDIKPLAS  129 (537)
T ss_pred             cHHHHHHHHHHHcCcHHHHHHHHHHcCcccCCHHHHHHHHHHHcCCCCCCHHHHHHHHHHHhCCCHHHHHHhcChhhhcC
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeccceEEEEecC-CCEEEEEecCCCcHHHHHHHHHHHHHHHHHHHHhCCCC---CcchHHHHHHhc
Q psy4056         164 ASLAQVHKATLHD-GSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEF---KFLWLVDETKRN  226 (227)
Q Consensus       164 ASIaQVHrA~L~~-G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~~p~~---~~~~l~~E~~~~  226 (227)
                      |||||||+|++++ |++|||||||||+++.|..|+.+|+.+++++++++|+.   +..++++|++++
T Consensus       130 aSiaQVh~A~l~~~G~~VAVKV~rP~i~~~I~~Dl~~l~~~a~~l~~~~~~~~~l~~~~~v~e~~~~  196 (537)
T PRK04750        130 ASIAQVHFARLKDNGREVVVKVLRPDILPVIDADLALMYRLARWVERLLPDGRRLKPREVVAEFEKT  196 (537)
T ss_pred             CCccEEEEEEECCCCCEEEEEEeCcchHHHHHHHHHHHHHHHHHHHHhCcccccCCHHHHHHHHHHH
Confidence            9999999999997 99999999999999999999999999999999999864   567889888765


No 5  
>KOG1236|consensus
Probab=99.97  E-value=2.5e-32  Score=253.40  Aligned_cols=142  Identities=25%  Similarity=0.365  Sum_probs=131.3

Q ss_pred             HHHHHHHHHHHHhcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCC-ChhhhccccCcccc
Q psy4056          83 KEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGK-DPSEIFASIEPNPM  161 (227)
Q Consensus        83 ~~~a~~l~~~~~~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~-~~~~~F~~fd~~Pi  161 (227)
                      .-+-+-|+..++..||+|||+|||+|||+|+||+++|..|++||.+++|+||...++.+++++|. +++++|.+|++.||
T Consensus       118 ~lW~~~L~kaLE~aGPtFIKLGQWAsTR~DlFs~afC~qLSKLHs~vt~Hs~a~T~k~l~qa~~~~~~~eiF~efn~~PI  197 (565)
T KOG1236|consen  118 TLWLRLLLKALETAGPTFIKLGQWASTRRDLFSKAFCAQLSKLHSNVTPHSFAFTKKKLRQAFGVKKIEEIFSEFNREPI  197 (565)
T ss_pred             HHHHHHHHHHHHhcCCceEEecccccccccccCHHHHHHHHHHhccCCCCchHHHHHHHHHHHCcCcHHHHHHhcCCccc
Confidence            34566899999999999999999999999999999999999999999999999999999999998 89999999999999


Q ss_pred             ceeeccceEEEEec-------C---------CCEEEEEecCCCcHHHHHHHHHHHHHHHHHHHHhCCCCCcchHHHHHHh
Q psy4056         162 GAASLAQVHKATLH-------D---------GSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKR  225 (227)
Q Consensus       162 asASIaQVHrA~L~-------~---------G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~~p~~~~~~l~~E~~~  225 (227)
                      |||||||||+|+++       +         .+.|||||.||+++++|+.|+.+|.+.+++.++ .|++.|-.+.+|.++
T Consensus       198 GsG~IAQVY~atl~~a~lekd~~~~~~~~~~tq~~AiKv~Hp~V~~~ir~Dl~Il~f~Akl~~~-vP~l~wL~l~~~vkq  276 (565)
T KOG1236|consen  198 GSGCIAQVYRATLKTAYLEKDSGKEYVQKLGTQSCAIKVLHPNVEKQIRLDLGILGFGAKLINN-VPDLSWLSLPLEVKQ  276 (565)
T ss_pred             ccchhhhhhhhhhhHHHhhcccchhhhcCCccceeeeeccCccHHHHHHHHHHHHhhhhhhhhh-cCccccccCcchHHH
Confidence            99999999999996       2         158999999999999999999999999999995 699988777666653


No 6  
>PF03109 ABC1:  ABC1 family;  InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli []. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex [] and E. coli AarF is required for ubiquinone production []. It has been suggested that members of the ABC1 family are novel chaperonins []. These proteins are unrelated to the ABC transporter proteins.
Probab=99.95  E-value=1.4e-28  Score=194.22  Aligned_cols=85  Identities=34%  Similarity=0.619  Sum_probs=81.3

Q ss_pred             HhcCCChhhhccccCccccceeeccceEEEEecCCCEEEEEecCCCcHHHHHHHHHHHHHHHHHHHHhCCC--CCcchHH
Q psy4056         143 EDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPE--FKFLWLV  220 (227)
Q Consensus       143 ~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~~p~--~~~~~l~  220 (227)
                      +|||.+++++|++||++|+|||||||||+|+|++|++|||||||||+++.+..||.+|+.+++++++++|.  +++.+++
T Consensus         1 e~lG~~~~~~F~~fd~~PlasASiaQVh~a~l~~g~~VaVKV~rP~i~~~i~~Dl~~l~~~~~~~~~~~~~~~~~~~~~~   80 (119)
T PF03109_consen    1 EELGKPIDEIFDEFDPEPLASASIAQVHRARLKDGEEVAVKVQRPGIEEQIEADLRILRRLARLLERLPPFRRLDLEEIV   80 (119)
T ss_pred             CCcCCCHHHHHHHCCcchhhheehhhheeeeecccchhhhhhcchHHHHHHHHHHHHHHHHHHHHHHcccccccCHHHHH
Confidence            58999999999999999999999999999999999999999999999999999999999999999999887  7889999


Q ss_pred             HHHHhcC
Q psy4056         221 DETKRNI  227 (227)
Q Consensus       221 ~E~~~~l  227 (227)
                      +|++.+|
T Consensus        81 ~e~~~~l   87 (119)
T PF03109_consen   81 DEFRDSL   87 (119)
T ss_pred             HHHHHHH
Confidence            9998764


No 7  
>KOG1234|consensus
Probab=99.85  E-value=3.2e-22  Score=178.20  Aligned_cols=120  Identities=24%  Similarity=0.394  Sum_probs=106.3

Q ss_pred             HHcCC-CCCcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEecCCCEEEEEec
Q psy4056         107 IGALE-YLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQ  185 (227)
Q Consensus       107 lstr~-dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq  185 (227)
                      ||-++ .++|++..+.|++.++.+..||..++++++..++|.+|.+-|++||+.|.|+|||||||+|+++||.+||||||
T Consensus         2 LSiQD~~ll~p~l~qi~erVrqsAd~MP~~Ql~~vm~~~lG~nW~~Kf~~fd~~P~AaASIGQVHrArl~~g~eVavKiQ   81 (363)
T KOG1234|consen    2 LSIQDGSLLPPTLGQILERVRQSADFMPPKQLEPVMWGELGGNWAQKFSSFDDGPFAAASIGQVHRARLADGPEVAVKIQ   81 (363)
T ss_pred             cccccCCccCHHHHHHHHHhcCccccCChhhhhHHHhhhhchhHHHHHHhhccCccccccHHHHHHHHhcCCCeeeeecC
Confidence            34443 48999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcHHHHHHHHHHHHHHHHHHHHhCCCCCcchHHHHHHhc
Q psy4056         186 HRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRN  226 (227)
Q Consensus       186 ~P~i~~~i~~Dl~~l~~l~~~~~~~~p~~~~~~l~~E~~~~  226 (227)
                      |||+.+.|.+|+.++..+++.-+-+..++-+..+++-.++.
T Consensus        82 YPGva~sI~SD~~nl~~lLn~s~llPkGLFLd~~i~~ArkE  122 (363)
T KOG1234|consen   82 YPGVARSIDSDANNLSRLLNFSGLLPKGLFLDVLIEVARKE  122 (363)
T ss_pred             CCchhhhccCcHHHHHHHHhhcccccccccHHHHHHHHHHh
Confidence            99999999999999999998866442345566666555554


No 8  
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=97.51  E-value=0.00017  Score=60.08  Aligned_cols=32  Identities=22%  Similarity=0.263  Sum_probs=29.7

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~  190 (227)
                      .|+|+||.||||+|+..+|++||||+.+|+..
T Consensus         3 ~~ig~G~~~~Vy~a~~~~g~~vavKv~~~~~~   34 (190)
T cd05145           3 GCISTGKEANVYHARTGDGEELAVKIYKTSTL   34 (190)
T ss_pred             ceeecCCCcEEEEEEcCCCCEEEEEEEEcCcc
Confidence            58999999999999988999999999999853


No 9  
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=97.17  E-value=0.00062  Score=57.28  Aligned_cols=32  Identities=22%  Similarity=0.260  Sum_probs=29.4

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~  190 (227)
                      ..||+||.|+||+|+..+|++||||+.+|+..
T Consensus         3 ~~ig~G~~~~Vy~a~~~~g~~vAvKv~~~~~~   34 (190)
T cd05147           3 GCISTGKEANVYHATTANGEERAIKIYKTSIL   34 (190)
T ss_pred             CccccccceEEEEEECCCCCEEEEEEEEeccc
Confidence            47999999999999999999999999999853


No 10 
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=96.50  E-value=0.0023  Score=52.23  Aligned_cols=33  Identities=27%  Similarity=0.367  Sum_probs=29.7

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVRD  191 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~  191 (227)
                      +++++++.|+||+|+..+|++||||+.+|+...
T Consensus         3 ~~lg~G~~g~Vy~a~~~~~~~vavKv~~~~~~~   35 (187)
T cd05119           3 GPIGTGKEADVYLALDGDGEPVAVKIYRTGRTS   35 (187)
T ss_pred             cccccccceeEEEEECCCCCEEEEEEEecCccc
Confidence            579999999999999988999999999987644


No 11 
>smart00090 RIO RIO-like kinase.
Probab=96.31  E-value=0.007  Score=52.79  Aligned_cols=31  Identities=19%  Similarity=0.147  Sum_probs=28.2

Q ss_pred             cccceeeccceEEEE--ecCCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKAT--LHDGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~--L~~G~~VAVKVq~P~i  189 (227)
                      ++++.|+.||||+|+  .++|++||||+.+++.
T Consensus        34 ~~Lg~G~~g~Vy~a~~~~~~g~~vaiK~~~~~~   66 (237)
T smart00090       34 GCISTGKEANVYHALDFDGSGKERAVKIYRTGT   66 (237)
T ss_pred             CeeccCcceeEEEEEecCCCCcEEEEEEEEcCc
Confidence            489999999999998  6799999999999864


No 12 
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=95.37  E-value=0.014  Score=48.61  Aligned_cols=32  Identities=28%  Similarity=0.306  Sum_probs=28.7

Q ss_pred             ccccceeeccceEEEEecCCCEEEEEecCCCc
Q psy4056         158 PNPMGAASLAQVHKATLHDGSTIALKVQHRNV  189 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i  189 (227)
                      .++++.++.|+||+|+.++|+.||||+.+++.
T Consensus        20 ~~~i~~G~~g~Vy~~~~~~g~~vavK~~~~~~   51 (198)
T cd05144          20 GNQIGVGKESDVYLALDPDGNPVALKFHRLGR   51 (198)
T ss_pred             CCccccCcceEEEEEEcCCCCEEEEEEEeccc
Confidence            47899999999999999899999999977654


No 13 
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=94.53  E-value=0.049  Score=47.73  Aligned_cols=46  Identities=22%  Similarity=0.280  Sum_probs=34.3

Q ss_pred             HHhcCCChhhhccccCcc-------ccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         142 KEDLGKDPSEIFASIEPN-------PMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       142 ~~elG~~~~~~F~~fd~~-------PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      ++|+|.+..-++...++.       .++.++.|+||+|+.+ +|+.||||+.+-
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~lg~g~~g~v~~~~~~~~~~~v~iK~~~~   55 (292)
T cd06657           2 HEQFRAALQMVVDPGDPRTYLDNFIKIGEGSTGIVCIATVKSSGKLVAVKKMDL   55 (292)
T ss_pred             hhHhhhhceEeecCCChHHHhhhHHHcCCCCCeEEEEEEEcCCCeEEEEEEecc
Confidence            355565555555555543       4999999999999996 899999998653


No 14 
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=93.60  E-value=0.11  Score=46.41  Aligned_cols=48  Identities=21%  Similarity=0.247  Sum_probs=35.5

Q ss_pred             HHhcCCChhhhccccC-ccccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         142 KEDLGKDPSEIFASIE-PNPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       142 ~~elG~~~~~~F~~fd-~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      ++|+++...++...+. ..++|+++.|+||+|+.. +|+.||||+.....
T Consensus         3 ~~~~~~~~~~~~~~y~~~~~lg~G~~g~V~~~~~~~~~~~vavK~~~~~~   52 (343)
T cd07878           3 RQELNKTVWEVPERYQNLTPVGSGAYGSVCSAYDTRLRQKVAVKKLSRPF   52 (343)
T ss_pred             HHHHhHHHhhhhhhhhhheecccCCCeEEEEEEECCCCCEEEEEEeCchh
Confidence            4566654444444444 378999999999999975 78999999987543


No 15 
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=93.21  E-value=0.14  Score=45.85  Aligned_cols=60  Identities=18%  Similarity=0.244  Sum_probs=41.0

Q ss_pred             HhcCCChhhhccccC-ccccceeeccceEEEEec-CCCEEEEEecCCCc-----HHHHHHHHHHHHH
Q psy4056         143 EDLGKDPSEIFASIE-PNPMGAASLAQVHKATLH-DGSTIALKVQHRNV-----RDNANIDIKCMEA  202 (227)
Q Consensus       143 ~elG~~~~~~F~~fd-~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-----~~~i~~Dl~~l~~  202 (227)
                      +|+++.+.++...|. .++++.++.|.||+|+.+ +|+.||||+.+...     ...+..++.+++.
T Consensus         4 ~~~~~~~~~~~~~y~~~~~ig~g~~g~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~e~~~l~~   70 (342)
T cd07879           4 EEVNKTVWELPERYTSLKQVGSGAYGSVCSAIDKRTGEKVAIKKLSRPFQSEIFAKRAYRELTLLKH   70 (342)
T ss_pred             hhhhhhhhccccceEEEEEeeecCCeEEEEEEeCCCCcEEEEEEecCccccccchhHHHHHHHHHHh
Confidence            355555544444553 589999999999999976 79999999876432     2334455665543


No 16 
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=92.19  E-value=0.29  Score=38.44  Aligned_cols=44  Identities=18%  Similarity=0.312  Sum_probs=36.2

Q ss_pred             cceeeccceEEEEecC-CCEEEEEecCCCcH----HHHHHHHHHHHHHH
Q psy4056         161 MGAASLAQVHKATLHD-GSTIALKVQHRNVR----DNANIDIKCMEALV  204 (227)
Q Consensus       161 iasASIaQVHrA~L~~-G~~VAVKVq~P~i~----~~i~~Dl~~l~~l~  204 (227)
                      +++++.|+||+++..+ |++++||+.+++-.    +.+...+..++.+.
T Consensus         1 l~~g~~~~v~~~~~~~~~~~~~~K~~~~~~~~~~~~~~~~e~~~~~~l~   49 (215)
T cd00180           1 LGEGGFGTVYLARDKKTGKKVAIKIIKKEDSSSLLEELLREIEILKKLN   49 (215)
T ss_pred             CCcCCceEEEEEEecCCCcEEEEEEeccccchhHHHHHHHHHHHHHhcC
Confidence            5789999999999964 99999999999976    57777777776654


No 17 
>KOG1187|consensus
Probab=92.10  E-value=0.23  Score=46.13  Aligned_cols=48  Identities=21%  Similarity=0.322  Sum_probs=38.9

Q ss_pred             ccCc-cccceeeccceEEEEecCCCEEEEEecCCCcH---HHHHHHHHHHHH
Q psy4056         155 SIEP-NPMGAASLAQVHKATLHDGSTIALKVQHRNVR---DNANIDIKCMEA  202 (227)
Q Consensus       155 ~fd~-~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~---~~i~~Dl~~l~~  202 (227)
                      .|++ +-++.+..|-||+|.+.||+.||||...++-.   +.+..++.++..
T Consensus        76 ~Fs~~~~ig~Ggfg~VYkG~l~~~~~vAVK~~~~~~~~~~~eF~~Ei~~ls~  127 (361)
T KOG1187|consen   76 NFSESNLIGEGGFGTVYKGVLSDGTVVAVKRLSSNSGQGEREFLNEVEILSR  127 (361)
T ss_pred             CCchhcceecCCCeEEEEEEECCCCEEEEEEecCCCCcchhHHHHHHHHHhc
Confidence            4554 77999999999999999999999998888774   457777766643


No 18 
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=91.78  E-value=0.42  Score=39.97  Aligned_cols=36  Identities=22%  Similarity=0.428  Sum_probs=30.7

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNAN  194 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~  194 (227)
                      ++++.++.|+||+|.+.+|+.||+|+.+++......
T Consensus         1 ~~ig~g~~g~vy~~~~~~~~~~a~K~~~~~~~~~~~   36 (250)
T cd05085           1 ELLGKGNFGEVFKGTLKDKTPVAVKTCKEDLPQELK   36 (250)
T ss_pred             CccCCCCCceEEEEEecCCcEEEEEecCCcCCHHHH
Confidence            368999999999999989999999999888765443


No 19 
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=91.77  E-value=0.32  Score=39.42  Aligned_cols=44  Identities=18%  Similarity=0.313  Sum_probs=34.0

Q ss_pred             cccceeeccceEEEEecC-CCEEEEEecCCCcH----HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHD-GSTIALKVQHRNVR----DNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~-G~~VAVKVq~P~i~----~~i~~Dl~~l~~  202 (227)
                      +++++++.|+||+++..+ |++|++|+.+.+..    +.+..++..++.
T Consensus         5 ~~i~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~e~~~~~~   53 (225)
T smart00221        5 KKLGEGAFGKVYLARDKGTGELVAVKVLKKEKTEKQREEFLREIRILKK   53 (225)
T ss_pred             eEeecCCCeEEEEEEEcCCCcEEEEEeeccccchHHHHHHHHHHHHHHh
Confidence            679999999999999984 89999999998743    344444444443


No 20 
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=91.76  E-value=0.37  Score=38.17  Aligned_cols=47  Identities=4%  Similarity=0.060  Sum_probs=38.5

Q ss_pred             ccccceeeccceEEEEecCCCEEEEEecCCCc--HHHHHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLHDGSTIALKVQHRNV--RDNANIDIKCMEALVH  205 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i--~~~i~~Dl~~l~~l~~  205 (227)
                      -+|+++|..++||+.+. +|++|+||+-+++.  ...+..+..+++.+..
T Consensus         3 ~~~l~~G~~~~vy~~~~-~~~~~~lK~~~~~~~~~~~~~~E~~~l~~l~~   51 (170)
T cd05151           3 ISPLKGGMTNKNYRVEV-ANKKYVVRIPGNGTELLINRENEAENSKLAAE   51 (170)
T ss_pred             eeecCCcccCceEEEEE-CCeEEEEEeCCCCcccccCHHHHHHHHHHHHH
Confidence            36899999999999997 58899999988885  3456778888887765


No 21 
>KOG0667|consensus
Probab=91.27  E-value=0.31  Score=48.29  Aligned_cols=46  Identities=35%  Similarity=0.504  Sum_probs=33.9

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCCcH--HHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRNVR--DNANIDIKCMEAL  203 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~--~~i~~Dl~~l~~l  203 (227)
                      .+.||.||.|||-+|.-+ +|+.|||||.+-.-+  .+-...+.+|..+
T Consensus       191 ~e~LGkGtFGQVvk~~d~~T~e~VAIKIiKN~k~f~~Q~~~Ei~iL~~l  239 (586)
T KOG0667|consen  191 LEVLGKGSFGQVVKAYDHKTGEIVAIKIIKNKKRFLRQAQIEIRILELL  239 (586)
T ss_pred             EEEecccccceeEEEEecCCCcEEEEEeeccChHHHHHHHHHHHHHHHH
Confidence            357999999999999987 799999999875544  3334444444443


No 22 
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=91.22  E-value=0.52  Score=39.54  Aligned_cols=44  Identities=14%  Similarity=0.299  Sum_probs=32.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH----HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR----DNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~----~~i~~Dl~~l~~  202 (227)
                      +.++.++.|+||+|+.+ +|+.||+|+......    ..+..++.+++.
T Consensus         1 ~~lg~g~~g~vy~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~e~~~l~~   49 (252)
T cd05084           1 ERIGRGNFGEVFSGRLRADNTPVAVKSCRETLPPDLKAKFLQEARILKQ   49 (252)
T ss_pred             CccCcccCccEEEEEEecCCceEEEEecCccCCHHHHHHHHHHHHHHHh
Confidence            35899999999999997 899999998765543    334444444443


No 23 
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=91.03  E-value=0.47  Score=41.86  Aligned_cols=47  Identities=19%  Similarity=0.248  Sum_probs=37.9

Q ss_pred             HHHHHhcCCChhhhccccCccccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         139 AVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       139 ~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      .+...-++.++++.|..  .++++.++.|+||+|+.. +|+.||+|+...
T Consensus        13 ~~~~~~~~~~~~~~f~~--~~~lg~G~~~~v~~~~~~~~~~~valK~~~~   60 (317)
T cd06635          13 EIAELFFKEDPEKLFTD--LREIGHGSFGAVYFARDVRTNEVVAIKKMSY   60 (317)
T ss_pred             HHHHHhcCCCchhhhhh--hheeccCCCeEEEEEEEcCCCcEEEEEEEec
Confidence            34556677888888874  456999999999999976 789999998764


No 24 
>PF03881 Fructosamin_kin:  Fructosamine kinase;  InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein []. Ketosamine-3-kinases (KT3K), of which fructosamine-3-kinase (FN3K) is the best-known example, catalyse the phosphorylation of the ketosamine moiety of glycated proteins. The instability of a phosphorylated ketosamine leads to its degradation, and KT3K is thus thought to be involved in protein repair []. The function of the prokaryotic members of this group has not been established. However, several lines of evidence indicate that they may function as fructosamine-3-kinases (FN3K). First, they are similar to characterised FN3K from mouse and human. Second, the Escherichia coli members are found in close proximity on the genome to fructose-6-phosphate kinase (PfkB). Last, FN3K activity has been found in a Anacystis montana (Gloeocapsa montana Kutzing 1843) [], indicating such activity-directly demonstrated in eukaryotes-is nonetheless not confined to eukaryotes. This family includes eukaryotic fructosamine-3-kinase enzymes [] which may initiate a process leading to the deglycation of fructoselysine and of glycated proteins and in the phosphorylation of 1-deoxy-1-morpholinofructose, fructoselysine, fructoseglycine, fructose and glycated lysozyme. The family also includes bacterial members that have not been characterised but probably have a similar or identical function. For additional information please see [].; PDB: 3JR1_B 3F7W_A.
Probab=90.95  E-value=0.25  Score=44.64  Aligned_cols=69  Identities=20%  Similarity=0.278  Sum_probs=53.3

Q ss_pred             HHHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEecCCCEEEEEecCCCcHHHHHHHHHHHHHHHHHH
Q psy4056         134 MKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVV  207 (227)
Q Consensus       134 ~~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~  207 (227)
                      |..|.+.|++.+|.+..    --+.+|++.++|.++++-+ .+|+.+-||+..+.-...++....-|+.+.+..
T Consensus         2 w~~i~~~~~~~~~~~~~----i~~~~~v~GG~i~~a~~~~-~~~~~~FvK~~~~~~~~~f~~Ea~gL~~L~~~~   70 (288)
T PF03881_consen    2 WQAIEQQISEQLGADFK----ITSIEPVSGGDINEAYRLD-TDGGSYFVKVNSESGRDMFEGEAEGLKALAEAN   70 (288)
T ss_dssp             HHHHHHHHHHHHTS---------EEEEE--SSSSEEEEEE-TTS-EEEEEEEEGGGCCHHHHHHHHHHHHCHTT
T ss_pred             hHHHHHHHHHHhCCCCc----eeeeEecCCCChhheEEEE-CCCccEEEEecChhhHHHHHHHHHHHHHHHhcC
Confidence            56789999999998722    1134799999999999988 589999999999888899999999999986543


No 25 
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=90.82  E-value=0.36  Score=40.81  Aligned_cols=29  Identities=21%  Similarity=0.294  Sum_probs=26.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +++++++.|+||+|+.+ +|++|++|+..+
T Consensus         7 ~~lg~g~~~~vy~~~~~~~~~~~~ik~~~~   36 (280)
T cd05581           7 KIIGEGSFSTVVLAKEKETNKEYAIKILDK   36 (280)
T ss_pred             eeecCCCceEEEEEEEcCCCCEEEEEEech
Confidence            57999999999999998 899999999876


No 26 
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=90.50  E-value=0.4  Score=40.74  Aligned_cols=35  Identities=20%  Similarity=0.228  Sum_probs=30.0

Q ss_pred             ccccCccccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         153 FASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       153 F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      |.++..+++|.++.|+||+|.-+ +|+.||||..+.
T Consensus         1 ~~~~~~~~lg~g~~~~vy~~~~~~~~~~~a~K~~~~   36 (272)
T cd06629           1 FKWVKGELIGKGTYGRVYLALNVTTGEMMAVKQVEL   36 (272)
T ss_pred             CceeecceecccCceEEEEEeecCCCceeeeeeeec
Confidence            45677889999999999999876 799999997654


No 27 
>KOG4236|consensus
Probab=90.37  E-value=0.31  Score=48.27  Aligned_cols=58  Identities=16%  Similarity=0.275  Sum_probs=48.8

Q ss_pred             CChhhhccccCccccceeeccceEEEEec-CCCEEEEEecC-----CCcHHHHHHHHHHHHHHH
Q psy4056         147 KDPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQH-----RNVRDNANIDIKCMEALV  204 (227)
Q Consensus       147 ~~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~-----P~i~~~i~~Dl~~l~~l~  204 (227)
                      .++..++.-|.++-+||+-.|-||-|.-+ +|++|||||.-     +.-+.+++.++++|+.+-
T Consensus       558 vd~stvYQif~devLGSGQFG~VYgg~hRktGrdVAvKvIdKlrFp~kqesqlR~EVaILq~l~  621 (888)
T KOG4236|consen  558 VDISTVYQIFADEVLGSGQFGTVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQNLH  621 (888)
T ss_pred             hhHHHHHHhhhHhhccCCcceeeecceecccCceeeeeeeecccCCCchHHHHHHHHHHHHhcC
Confidence            46777888888899999999999999987 99999999973     566788888888887653


No 28 
>PRK10593 hypothetical protein; Provisional
Probab=90.28  E-value=0.64  Score=41.75  Aligned_cols=64  Identities=14%  Similarity=0.058  Sum_probs=50.5

Q ss_pred             HHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEecCCCEEEEEecCCC-cHHHHHHHHHHHHHHHH
Q psy4056         135 KDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRN-VRDNANIDIKCMEALVH  205 (227)
Q Consensus       135 ~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~-i~~~i~~Dl~~l~~l~~  205 (227)
                      +.+++.+.+.+|..+.+      .+||+.+.++|||+-...+| ++.||+.+.. -...+......|+.+.+
T Consensus         2 ~~~~~~~~~~~~~~~~~------~~~i~~G~~~~vy~~~~~~~-~~~~k~~~~~~~~~~~~~Ea~~L~~L~~   66 (297)
T PRK10593          2 EQLRAELSHLLGEKLSR------VECISEQPYAALWALYDSQG-NPMPLMARSFSTPGVAQQEAWKLSMLAR   66 (297)
T ss_pred             hHHHHHHHHHhchhhhe------eeecCCccceeEEEEEcCCC-CEEEEEecccccchHHHHHHHHHHHHcc
Confidence            46777888888875443      47999999999999987666 5888997664 45688999999988865


No 29 
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=90.22  E-value=0.52  Score=39.91  Aligned_cols=44  Identities=14%  Similarity=0.216  Sum_probs=33.8

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCc--HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNV--RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i--~~~i~~Dl~~l~~  202 (227)
                      ..++.++.|+||+|+.+++..||+|+.+++-  .+.+..++.+++.
T Consensus        12 ~~ig~g~~~~v~~~~~~~~~~~~lK~~~~~~~~~~~~~~E~~~l~~   57 (260)
T cd05069          12 VKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKK   57 (260)
T ss_pred             eeecCcCCCeEEEEEEcCCceEEEEEcccCCccHHHHHHHHHHHHh
Confidence            4699999999999999888899999988753  2345555555543


No 30 
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=90.01  E-value=0.49  Score=42.55  Aligned_cols=44  Identities=25%  Similarity=0.252  Sum_probs=33.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH----HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR----DNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~----~~i~~Dl~~l~~  202 (227)
                      +.||.++.|.||+|+.+ +|+.||||+.+....    +.+..++.+++.
T Consensus        80 ~~lg~G~~g~V~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~E~~~l~~  128 (353)
T PLN00034         80 NRIGSGAGGTVYKVIHRPTGRLYALKVIYGNHEDTVRRQICREIEILRD  128 (353)
T ss_pred             hhccCCCCeEEEEEEECCCCCEEEEEEEecCCcHHHHHHHHHHHHHHHh
Confidence            56999999999999987 799999999876543    344445555443


No 31 
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=89.91  E-value=0.55  Score=39.16  Aligned_cols=31  Identities=23%  Similarity=0.233  Sum_probs=27.3

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+.++.++.|+||+|+.+ +|+.|++|+....
T Consensus         5 ~~~ig~g~~~~vy~~~~~~~~~~~~ik~~~~~   36 (258)
T cd06632           5 GELLGSGSFGSVYEGLNLDDGDFFAVKEVSLA   36 (258)
T ss_pred             cceeeecCCceEEEEEEcCCCcEEEEEEEEEc
Confidence            467999999999999998 8999999987653


No 32 
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=89.64  E-value=0.61  Score=39.87  Aligned_cols=45  Identities=27%  Similarity=0.335  Sum_probs=34.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC-----cHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN-----VRDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~-----i~~~i~~Dl~~l~~l  203 (227)
                      ++++.++.|+||+|+.+ +|+.|+||+.+..     ....+...+.+++.+
T Consensus         6 ~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~E~~~l~~l   56 (284)
T cd07860           6 EKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKEL   56 (284)
T ss_pred             eeecCCCceEEEEEEECCCCCEEEEEEccccccccccchHHHHHHHHHHhc
Confidence            57899999999999987 7999999987643     334556666665543


No 33 
>KOG0192|consensus
Probab=89.57  E-value=0.53  Score=43.95  Aligned_cols=41  Identities=20%  Similarity=0.315  Sum_probs=32.7

Q ss_pred             cceeeccceEEEEecCCCE-EEEEecCCCc-----HHHHHHHHHHHHH
Q psy4056         161 MGAASLAQVHKATLHDGST-IALKVQHRNV-----RDNANIDIKCMEA  202 (227)
Q Consensus       161 iasASIaQVHrA~L~~G~~-VAVKVq~P~i-----~~~i~~Dl~~l~~  202 (227)
                      +|+++-|+||+|.+ .|+. ||||+..+.-     .+.+..++.+|..
T Consensus        49 iG~G~~g~V~~~~~-~g~~~vavK~~~~~~~~~~~~~~f~~E~~il~~   95 (362)
T KOG0192|consen   49 LGSGSFGTVYKGKW-RGTDVVAVKIISDPDFDDESRKAFRREASLLSR   95 (362)
T ss_pred             cccCCceeEEEEEe-CCceeEEEEEecchhcChHHHHHHHHHHHHHHh
Confidence            99999999999999 5777 9999998865     3466666666554


No 34 
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=89.28  E-value=0.69  Score=37.96  Aligned_cols=44  Identities=20%  Similarity=0.349  Sum_probs=34.2

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCCcH---HHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRNVR---DNANIDIKCME  201 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~---~~i~~Dl~~l~  201 (227)
                      .+++++++.|+||++..+ +|+.|++|+.+++..   +.+..++..++
T Consensus         5 ~~~l~~g~~~~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~e~~~l~   52 (253)
T cd05122           5 LEKIGKGGFGEVYKARHKRTGKEVAIKVIKLESKEKKEKIINEIQILK   52 (253)
T ss_pred             eeeeccCCceEEEEEEECCCCcEEEEEEecccchhHHHHHHHHHHHHH
Confidence            367999999999999997 799999999988765   34444444443


No 35 
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=89.26  E-value=0.54  Score=42.17  Aligned_cols=48  Identities=19%  Similarity=0.251  Sum_probs=35.9

Q ss_pred             HHHhcCCChhhhccccC-ccccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         141 LKEDLGKDPSEIFASIE-PNPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       141 l~~elG~~~~~~F~~fd-~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +++|++..+.++-..++ -++++.+..|.||+|+.+ +|+.||||+.+..
T Consensus         2 ~~~~~~~~~~~~~~~y~~~~~lg~G~~g~V~~~~~~~~~~~vavK~~~~~   51 (343)
T cd07880           2 YRQEVNKTIWEVPDRYRDLKQVGSGAYGTVCSALDRRTGAKVAIKKLYRP   51 (343)
T ss_pred             hhhhhhhhhhccccceEEEEEeeecCCeEEEEEEECCCCcEEEEEEeccc
Confidence            45666666555544443 468999999999999876 8999999987643


No 36 
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=88.95  E-value=0.67  Score=39.14  Aligned_cols=43  Identities=14%  Similarity=0.234  Sum_probs=32.7

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcH--HHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVR--DNANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~--~~i~~Dl~~l~  201 (227)
                      +.+++++.|.||+|..++|++||||+.+++..  ..+...+.+++
T Consensus        12 ~~ig~G~~g~v~~~~~~~~~~~a~K~~~~~~~~~~~~~~E~~~l~   56 (260)
T cd05067          12 KKLGAGQFGEVWMGYYNGHTKVAIKSLKQGSMSPEAFLAEANLMK   56 (260)
T ss_pred             eeeccCccceEEeeecCCCceEEEEEecCCCCcHHHHHHHHHHHH
Confidence            45999999999999999999999998886553  23444444443


No 37 
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=88.77  E-value=0.75  Score=39.27  Aligned_cols=44  Identities=23%  Similarity=0.265  Sum_probs=32.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc-----HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV-----RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-----~~~i~~Dl~~l~~  202 (227)
                      +.++.++.|+||+|+.+ +|+.||||+.+.+.     ...+..++..++.
T Consensus         5 ~~l~~g~~~~vy~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~E~~~l~~   54 (283)
T cd07835           5 EKIGEGTYGVVYKARDKLTGEIVALKKIRLETEDEGVPSTAIREISLLKE   54 (283)
T ss_pred             eEecCCCCeEEEEEEEcCCCCEEEEEEeecccccccchhHHHHHHHHHHh
Confidence            45899999999999986 89999999887443     3344455555443


No 38 
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=88.67  E-value=0.87  Score=38.19  Aligned_cols=45  Identities=13%  Similarity=0.193  Sum_probs=34.9

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcH--HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVR--DNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~--~~i~~Dl~~l~~l  203 (227)
                      +.++.++.|+||+|...+|+.+|||+...+..  ..+..++.+++.+
T Consensus        10 ~~ig~g~~g~v~~~~~~~~~~~~~k~~~~~~~~~~~~~~e~~~l~~l   56 (256)
T cd05112          10 QEIGSGQFGLVWLGYWLEKRKVAIKTIREGAMSEEDFIEEAQVMMKL   56 (256)
T ss_pred             eeecCcccceEEEEEEeCCCeEEEEECCCCCCCHHHHHHHHHHHHhC
Confidence            56999999999999998899999999886643  3455566665543


No 39 
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=88.65  E-value=0.58  Score=41.99  Aligned_cols=32  Identities=25%  Similarity=0.320  Sum_probs=27.7

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      .+++++++.|+||+|... +|+.||||+...+.
T Consensus        22 ~~~lg~G~~g~v~~~~~~~~~~~vaiK~~~~~~   54 (345)
T cd07877          22 LSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPF   54 (345)
T ss_pred             EEEeeecCCeEEEEEEEcCCCeEEEEEEecCcc
Confidence            368999999999999865 89999999987654


No 40 
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=88.58  E-value=0.8  Score=38.66  Aligned_cols=44  Identities=14%  Similarity=0.239  Sum_probs=33.5

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcH--HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVR--DNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~--~~i~~Dl~~l~~  202 (227)
                      ..++.++-|+||+|...+|..||+|..+++-.  +.+...+.+++.
T Consensus        12 ~~ig~g~~~~v~~~~~~~~~~~~~k~~~~~~~~~~~~~~E~~~l~~   57 (260)
T cd05070          12 KKLGNGQFGEVWMGTWNGNTKVAVKTLKPGTMSPESFLEEAQIMKK   57 (260)
T ss_pred             heeccccCceEEEEEecCCceeEEEEecCCCCCHHHHHHHHHHHHh
Confidence            45999999999999998999999999988543  344455554443


No 41 
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=88.55  E-value=0.77  Score=39.10  Aligned_cols=45  Identities=22%  Similarity=0.302  Sum_probs=34.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecC-----CCcHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQH-----RNVRDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~-----P~i~~~i~~Dl~~l~~l  203 (227)
                      ..+++++.|+||+|+.+ +|+.||+|+..     +...+.+..++.+++.+
T Consensus         7 ~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~~e~~~l~~~   57 (286)
T cd07847           7 SKIGEGSYGVVFKCRNRETGQIVAIKKFVESEDDPVIKKIALREIRMLKQL   57 (286)
T ss_pred             eeecccCCeEEEEEEECCCCcEEEEEEEeecccCccccHHHHHHHHHHHhC
Confidence            45899999999999998 79999999864     33445566666666544


No 42 
>KOG0595|consensus
Probab=88.34  E-value=0.69  Score=43.98  Aligned_cols=43  Identities=26%  Similarity=0.391  Sum_probs=34.2

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCCC-----cHHHHHHHHHHHHHH
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHRN-----VRDNANIDIKCMEAL  203 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P~-----i~~~i~~Dl~~l~~l  203 (227)
                      ||+||.|=||+|+.+ +|.+||||=..-.     ..+....++.+|+.+
T Consensus        18 iG~GsfavVykg~h~~~~~~VAIK~i~~~~l~~k~~e~L~~Ei~iLkel   66 (429)
T KOG0595|consen   18 IGSGSFAVVYKGRHKKSGTEVAIKCIAKKKLNKKLVELLLSEIKILKEL   66 (429)
T ss_pred             ccCcceEEEEEeEeccCCceEEeeeehhhccCHHHHHHHHHHHHHHHhc
Confidence            999999999999998 8999999965444     555566667666654


No 43 
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=88.30  E-value=0.85  Score=37.94  Aligned_cols=44  Identities=18%  Similarity=0.314  Sum_probs=33.4

Q ss_pred             cccceeeccceEEEEecC-----CCEEEEEecCCCcHH----HHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHD-----GSTIALKVQHRNVRD----NANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~-----G~~VAVKVq~P~i~~----~i~~Dl~~l~~  202 (227)
                      +.+|.++.|+||+|+..+     +..||+|+.+++...    .+..++..++.
T Consensus         5 ~~lg~g~~g~v~~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~l~~   57 (258)
T smart00219        5 KKLGEGAFGEVYKGTLKGLSGEKEVEVAVKTLKEDADEQQIEEFLREARIMRK   57 (258)
T ss_pred             ceeccCCCcceEEEEecCCCCCCCceEEEEEccCCCChHHHHHHHHHHHHHHh
Confidence            568999999999999973     489999999988643    44445555443


No 44 
>PRK14879 serine/threonine protein kinase; Provisional
Probab=88.16  E-value=0.98  Score=37.25  Aligned_cols=30  Identities=10%  Similarity=0.050  Sum_probs=26.4

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i  189 (227)
                      .+++.++-|.||+|.. +|++|+||+..|..
T Consensus         2 ~~l~~G~~~~vy~~~~-~~~~~~vK~~~~~~   31 (211)
T PRK14879          2 KLIKRGAEAEIYLGDF-LGIKAVIKWRIPKR   31 (211)
T ss_pred             cccccCceEEEEEEee-CCCceEEEEeCCcC
Confidence            4689999999999987 89999999988754


No 45 
>PRK09188 serine/threonine protein kinase; Provisional
Probab=87.72  E-value=0.93  Score=42.38  Aligned_cols=46  Identities=13%  Similarity=0.263  Sum_probs=34.1

Q ss_pred             ccccceeeccceEEEEec--CCCEEEEEecCCC--------cHHHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH--DGSTIALKVQHRN--------VRDNANIDIKCMEAL  203 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~--~G~~VAVKVq~P~--------i~~~i~~Dl~~l~~l  203 (227)
                      .+.||.+..|+||+|..+  +|+.||||+..+.        ..+.+..++.+|+.+
T Consensus        23 ~~~IG~G~fg~Vy~a~~~~~~~~~vAiK~~~~~~~~~~~~~~~~~~~~E~~iL~~L   78 (365)
T PRK09188         23 TAVLKRDVFSTVERGYFAGDPGTARAVRRRVSEVPWWSKPLARHLAAREIRALKTV   78 (365)
T ss_pred             ccEEeecCcEEEEEEEEcCCCCeEEEEEEecccccccccHHHHHHHHHHHHHHHhc
Confidence            456999999999999876  6888999986644        234456666666554


No 46 
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=87.66  E-value=1.1  Score=36.93  Aligned_cols=32  Identities=22%  Similarity=0.176  Sum_probs=28.4

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      .++++.++.|+||+|+.. +|++|++|+.+..-
T Consensus         5 ~~~i~~g~~~~v~~~~~~~~~~~~~ik~~~~~~   37 (260)
T cd06606           5 GELLGRGSFGSVYLALDKDTGELMAVKSVELSG   37 (260)
T ss_pred             eeEeeecCceEEEEEEECCCCcEEEEEEeeccc
Confidence            367999999999999998 79999999987765


No 47 
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=87.64  E-value=1.4  Score=37.35  Aligned_cols=54  Identities=24%  Similarity=0.383  Sum_probs=37.7

Q ss_pred             ChhhhccccCccccceeeccceEEEEec-CCCEEEEEecCCC--cHHHHHHHHHHHHHH
Q psy4056         148 DPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHRN--VRDNANIDIKCMEAL  203 (227)
Q Consensus       148 ~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~--i~~~i~~Dl~~l~~l  203 (227)
                      +++..|...  +.++.++.|+||+|..+ +|+.||+|+....  -...+..++.+++.+
T Consensus         3 ~~~~~y~~~--~~lg~g~~g~vy~~~~~~~~~~~aik~~~~~~~~~~~~~~e~~~l~~~   59 (272)
T cd06637           3 DPAGIFELV--ELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKY   59 (272)
T ss_pred             ChhhhhhHH--HheeecCCeEEEEEEEcCCCcEEEEEEEEcCCccHHHHHHHHHHHHHh
Confidence            445566443  56999999999999987 7899999997432  234555566555544


No 48 
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=87.51  E-value=0.94  Score=38.04  Aligned_cols=45  Identities=24%  Similarity=0.346  Sum_probs=33.7

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCC------CcHHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHR------NVRDNANIDIKCMEA  202 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P------~i~~~i~~Dl~~l~~  202 (227)
                      .+.++.++.|+||+|+.. +|++||+|..++      ...+.+..++.+++.
T Consensus         7 ~~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~~ei~~l~~   58 (267)
T cd08224           7 EKKIGKGQFSVVYKAICLLDGRVVALKKVQIFEMMDAKARQDCLKEIDLLKQ   58 (267)
T ss_pred             eeeeccCCceEEEEEEEcCCCCEEEEEEeecccccchhhHHHHHHHHHHHHh
Confidence            356999999999999998 899999998764      224455555555553


No 49 
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=87.38  E-value=1.2  Score=37.83  Aligned_cols=45  Identities=18%  Similarity=0.337  Sum_probs=32.8

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcHH----HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRD----NANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~----~i~~Dl~~l~~l  203 (227)
                      +.++.++.|+||+|+.. +|+.|+||+.+.+...    .+..++.+++.+
T Consensus         7 ~~l~~g~~g~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~e~~~l~~l   56 (277)
T cd06917           7 ELIGRGAYGAVYRGKHVPTGRVVALKIINLDTPDDDVSDIQREVALLSQL   56 (277)
T ss_pred             hheeccCCceEEEEEEcCCCcEEEEEEecCCCCchhHHHHHHHHHHHHHh
Confidence            56999999999999975 8999999998765432    344444444433


No 50 
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves 
Probab=87.35  E-value=1.8  Score=32.32  Aligned_cols=47  Identities=9%  Similarity=0.109  Sum_probs=37.9

Q ss_pred             ccccceeeccceEEEEecCCCEEEEEecCCCcH-HHHHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLHDGSTIALKVQHRNVR-DNANIDIKCMEALVH  205 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~-~~i~~Dl~~l~~l~~  205 (227)
                      .++++.++.+.|++++. ++..++||+..+... ..+..+..+++.+..
T Consensus         3 ~~~i~~g~~~~v~~~~~-~~~~~~iK~~~~~~~~~~~~~e~~~~~~l~~   50 (155)
T cd05120           3 IKLLKGGLTNRVYLLGT-KDEDYVLKINPSREKGADREREVAILQLLAR   50 (155)
T ss_pred             ceecccccccceEEEEe-cCCeEEEEecCCCCchhHHHHHHHHHHHHHH
Confidence            35789999999999998 558999999988764 567777777777655


No 51 
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=87.34  E-value=1  Score=38.21  Aligned_cols=45  Identities=29%  Similarity=0.296  Sum_probs=33.8

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc-----HHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV-----RDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-----~~~i~~Dl~~l~~l  203 (227)
                      +.+++++.|+||+|+.. +|+.||||+.++..     ...+..++.+++.+
T Consensus         5 ~~l~~g~~~~vy~~~~~~~~~~~~~K~~~~~~~~~~~~~~~~~e~~~l~~l   55 (287)
T cd07840           5 AQIGEGTYGQVYKARNKKTGELVALKKIRMENEKEGFPITAIREIKLLQKL   55 (287)
T ss_pred             EEeccCCCeEEEEEEECCCCeEEEEEEEecccccccchHHHHHHHHHHHhc
Confidence            45889999999999987 68999999998763     33455555555433


No 52 
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=87.21  E-value=1.1  Score=38.12  Aligned_cols=44  Identities=18%  Similarity=0.242  Sum_probs=32.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc-----HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV-----RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-----~~~i~~Dl~~l~~  202 (227)
                      +.+++++.|+||+|+.+ +|+.||||+.+...     ...+...+.+++.
T Consensus         6 ~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~   55 (285)
T cd07861           6 EKIGEGTYGVVYKGRNKKTGQIVAMKKIRLESEEEGVPSTAIREISLLKE   55 (285)
T ss_pred             eEecccCceEEEEEEECCCCcEEEEEEeccccccCCchHHHHHHHHHHHh
Confidence            46899999999999987 79999999886542     2344555555443


No 53 
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=87.21  E-value=1.1  Score=37.76  Aligned_cols=44  Identities=16%  Similarity=0.241  Sum_probs=33.8

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcH--HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVR--DNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~--~~i~~Dl~~l~~  202 (227)
                      +.+++++.|.||+|...+++.|+||+.+++-.  +.+..++.+++.
T Consensus        12 ~~ig~g~~~~v~~~~~~~~~~~~vK~~~~~~~~~~~~~~e~~~l~~   57 (261)
T cd05034          12 RKLGAGQFGEVWMGTWNGTTKVAVKTLKPGTMSPEAFLQEAQIMKK   57 (261)
T ss_pred             eeeccCcceEEEEEEEcCCceEEEEEecCCccCHHHHHHHHHHHhh
Confidence            57999999999999998889999999887533  345555555544


No 54 
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=87.17  E-value=1.3  Score=37.36  Aligned_cols=44  Identities=16%  Similarity=0.209  Sum_probs=33.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc---------HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV---------RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i---------~~~i~~Dl~~l~~  202 (227)
                      +.++.++.|+||+|... +|+.||+|+.++..         .+.+..++..++.
T Consensus         6 ~~lg~g~~~~v~~~~~~~~~~~~alk~~~~~~~~~~~~~~~~~~~~~e~~~l~~   59 (268)
T cd06630           6 QQLGTGAFSSCYQARDVKTGTLMAVKQVTYVRNTSSEQEEVVEALRKEIRLMAR   59 (268)
T ss_pred             ceecCcCceEEEEEEEcCCCcEEEEEEeecccCCchhHHHHHHHHHHHHHHHHH
Confidence            56899999999999875 89999999987543         3455555555543


No 55 
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=87.02  E-value=1.3  Score=37.85  Aligned_cols=46  Identities=20%  Similarity=0.215  Sum_probs=34.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC-----cHHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN-----VRDNANIDIKCMEALV  204 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~-----i~~~i~~Dl~~l~~l~  204 (227)
                      +-+|.++.|+||+|+.+ +|+.||+|+....     ....+..++.+++.+.
T Consensus         6 ~~lg~g~~g~v~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~e~~~l~~l~   57 (288)
T cd07863           6 AEIGVGAYGTVYKARDPHSGHFVALKSVRVQTNEDGLPLSTVREVALLKRLE   57 (288)
T ss_pred             eEEeecCCeEEEEEEECCCCcEEEEEEeccCcCCCCCchHHHHHHHHHHHhh
Confidence            45899999999999987 7999999987643     3344556666665543


No 56 
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=86.85  E-value=1.2  Score=38.45  Aligned_cols=44  Identities=27%  Similarity=0.283  Sum_probs=32.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH-----HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR-----DNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~-----~~i~~Dl~~l~~  202 (227)
                      +.++.++.|+||+|+.+ +|+.||||+.+....     ..+..++.+++.
T Consensus        13 ~~lg~g~~g~v~~~~~~~~~~~v~iK~~~~~~~~~~~~~~~~~e~~~~~~   62 (302)
T cd07864          13 GQIGEGTYGQVYKARDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQ   62 (302)
T ss_pred             eeecccCCEEEEEEEECCCCcEEEEEEEeecccccCchHHHHHHHHHHHh
Confidence            57899999999999998 799999999875432     234444444443


No 57 
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins. This subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This subfamily is composed of bacterial and eukaryotic proteins with similarity to the N-terminal domains of vertebrate ACAD10 and ACAD11. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis, among them. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and is highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 contain
Probab=86.70  E-value=1.1  Score=36.69  Aligned_cols=49  Identities=12%  Similarity=0.147  Sum_probs=39.2

Q ss_pred             CccccceeeccceEEEEecCCCEEEEEecCCCc----HHHHHHHHHHHHHHHH
Q psy4056         157 EPNPMGAASLAQVHKATLHDGSTIALKVQHRNV----RDNANIDIKCMEALVH  205 (227)
Q Consensus       157 d~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i----~~~i~~Dl~~l~~l~~  205 (227)
                      +-+|++.+..++||+.+..+|++++||+-+++-    ...+.....+++.+..
T Consensus         2 ~~~~l~~G~~n~~~~v~~~~g~~~ilK~~~~~~~~~~~~~~~~E~~~~~~l~~   54 (223)
T cd05154           2 EVRQLSGGQSNLTYLLTAGGGRRLVLRRPPPGALLPSAHDVAREYRVLRALAG   54 (223)
T ss_pred             cceecCCCccceEEEEEecCCcceEEEeCCCcccCcccccHHHHHHHHHHhhC
Confidence            347899999999999999888999999987753    4566777777766654


No 58 
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=86.49  E-value=1  Score=38.32  Aligned_cols=45  Identities=22%  Similarity=0.338  Sum_probs=34.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC-----cHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN-----VRDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~-----i~~~i~~Dl~~l~~l  203 (227)
                      +.++.++.|+||+|+.+ +|+.|+||+.++.     ..+.+..++.+++.+
T Consensus         7 ~~i~~g~~~~v~~~~~~~~~~~v~vK~~~~~~~~~~~~~~~~~e~~~l~~l   57 (288)
T cd07833           7 GVVGEGAYGVVLKCRNKATGEIVAIKKFKESEDDEDVKKTALREVKVLRQL   57 (288)
T ss_pred             EEecccCCeeEEEEEeCCCCcEEEEehhhhhcccccchhHHHHHHHHHHhc
Confidence            46899999999999987 6899999987653     345566666666544


No 59 
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=86.29  E-value=0.87  Score=40.56  Aligned_cols=30  Identities=23%  Similarity=0.374  Sum_probs=26.7

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      .+.+|+++.|.||+|+.+ +|+.||||+.+.
T Consensus        23 ~~~lg~G~~g~V~~~~~~~~~~~~aiK~~~~   53 (329)
T PTZ00263         23 GETLGTGSFGRVRIAKHKGTGEYYAIKCLKK   53 (329)
T ss_pred             EEEEEecCCeEEEEEEECCCCCEEEEEEEEH
Confidence            367999999999999997 799999999765


No 60 
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=86.13  E-value=1.1  Score=37.46  Aligned_cols=44  Identities=20%  Similarity=0.271  Sum_probs=33.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH-----HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR-----DNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~-----~~i~~Dl~~l~~  202 (227)
                      ++++.++.|.||+|+.. +|+.|+||+.+....     +.+..++.+++.
T Consensus         6 ~~lg~G~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~~~~   55 (264)
T cd06626           6 NKIGGGTFGKVYTAVNLDTGELMAVKEIRIQDNDPKTIKEIADEMKVLEL   55 (264)
T ss_pred             eEeecCCCcEEEEEEECCCCcEEEEEEEECcccchHHHHHHHHHHHHHHh
Confidence            67999999999999986 899999999876644     344455554443


No 61 
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=86.10  E-value=1.5  Score=37.36  Aligned_cols=44  Identities=27%  Similarity=0.348  Sum_probs=32.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc----HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV----RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i----~~~i~~Dl~~l~~  202 (227)
                      +.++.++.|+||+|+.+ +|+.||||+.+.+.    ...+..++.+++.
T Consensus         6 ~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~E~~~l~~   54 (284)
T cd07836           6 EKLGEGTYATVYKGRNRTTGEIVALKEIHLDAEEGTPSTAIREISLMKE   54 (284)
T ss_pred             eeeccCCceEEEEEEECCCCeEEEEEEecccccccchHHHHHHHHHHHh
Confidence            56899999999999997 79999999887543    2333444454443


No 62 
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=85.98  E-value=1.4  Score=37.22  Aligned_cols=30  Identities=20%  Similarity=0.256  Sum_probs=26.4

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~  188 (227)
                      +.++.++.|+||+|...+|+.||||+....
T Consensus         6 ~~ig~g~~~~v~~~~~~~~~~~avk~~~~~   35 (265)
T cd06631           6 EVLGKGAYGTVYCGLTNQGQLIAVKQVELD   35 (265)
T ss_pred             ceEeccCCeEEEEEEEcCCCeEEEEEeecC
Confidence            568999999999999889999999987654


No 63 
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=85.94  E-value=1.7  Score=37.20  Aligned_cols=46  Identities=20%  Similarity=0.395  Sum_probs=35.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC--CcHHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR--NVRDNANIDIKCMEALV  204 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P--~i~~~i~~Dl~~l~~l~  204 (227)
                      +.++.++.|.||+|+.+ +|+.||+|+..+  .....+..++.+++.+.
T Consensus        24 ~~lg~g~~~~vy~~~~~~~~~~~~ik~~~~~~~~~~~~~~e~~~l~~l~   72 (286)
T cd06638          24 ETIGKGTYGKVFKVLNKKNGSKAAVKILDPIHDIDEEIEAEYNILKALS   72 (286)
T ss_pred             eeeccCCCcEEEEEEECCCCceeEEEeeccccchHHHHHHHHHHHHHHh
Confidence            57999999999999987 789999999766  33455666666665553


No 64 
>KOG1166|consensus
Probab=85.91  E-value=0.59  Score=48.93  Aligned_cols=31  Identities=32%  Similarity=0.400  Sum_probs=28.4

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i  189 (227)
                      .-+|-+|-|+||+|+-.||+.||+||+.|-.
T Consensus       704 ~e~G~g~y~~vy~a~~~~~~~~alK~e~P~~  734 (974)
T KOG1166|consen  704 KEIGEGSYGSVYVATHSNGKLVALKVEKPPN  734 (974)
T ss_pred             eeeccccceEEEEeecCCCcEEEEEeecCCC
Confidence            3499999999999999999999999999964


No 65 
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=85.63  E-value=1.5  Score=38.78  Aligned_cols=29  Identities=31%  Similarity=0.422  Sum_probs=25.6

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+|.|+.|+||+|+.+ +|+.||||+..+.
T Consensus         2 ~lg~G~~g~V~~~~~~~~~~~vaiK~~~~~   31 (323)
T cd05575           2 VIGKGSFGKVLLAKHKADGKFYAVKVLQKK   31 (323)
T ss_pred             eeeeCCCeEEEEEEECCCCCEEEEEEEEHH
Confidence            4789999999999987 8999999998654


No 66 
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=85.61  E-value=1.4  Score=37.67  Aligned_cols=39  Identities=23%  Similarity=0.435  Sum_probs=30.0

Q ss_pred             hhhhccccCccccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         149 PSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       149 ~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      +.+.|..+  +.++++..|+||+|... +|+.||||+.....
T Consensus         2 ~~~~y~~~--~~l~~g~~~~vy~~~~~~~~~~vaiK~~~~~~   41 (277)
T cd06642           2 PEELFTKL--ERIGKGSFGEVYKGIDNRTKEVVAIKIIDLEE   41 (277)
T ss_pred             hHHHHHHH--HHhcCCCCeeEEEEEEcCCCeEEEEEEecccc
Confidence            34455543  45999999999999976 78999999977544


No 67 
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=85.45  E-value=1.7  Score=35.17  Aligned_cols=38  Identities=21%  Similarity=0.253  Sum_probs=29.0

Q ss_pred             eccceEEEEec-CCCEEEEEecCCCcH----HHHHHHHHHHHH
Q psy4056         165 SLAQVHKATLH-DGSTIALKVQHRNVR----DNANIDIKCMEA  202 (227)
Q Consensus       165 SIaQVHrA~L~-~G~~VAVKVq~P~i~----~~i~~Dl~~l~~  202 (227)
                      +.|+||+|+.. +|+.|++|+.+.+..    +.+...+..++.
T Consensus         1 ~~g~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~e~~~~~~   43 (244)
T smart00220        1 SFGKVYLARDKKTGKLVAIKVIKKEKIKKKRERILREISILKK   43 (244)
T ss_pred             CceEEEEEEECCCCcEEEEEEecccccccHHHHHHHHHHHHHh
Confidence            46899999998 599999999988764    455555555543


No 68 
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=85.32  E-value=1.1  Score=40.78  Aligned_cols=29  Identities=17%  Similarity=0.242  Sum_probs=25.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      ..||.|+.|+||+|+.+ +|+.||||+.+.
T Consensus         7 ~~LG~G~~g~Vy~~~~~~~~~~~aiK~i~~   36 (381)
T cd05626           7 KTLGIGAFGEVCLACKVDTHALYAMKTLRK   36 (381)
T ss_pred             EEEeecCCEEEEEEEECCCCCEEEEEEEEH
Confidence            45999999999999886 789999999864


No 69 
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=85.31  E-value=1.3  Score=39.64  Aligned_cols=31  Identities=29%  Similarity=0.396  Sum_probs=27.2

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ..++++++.|+||+|+.. +|+.||||+..+.
T Consensus        20 ~~~ig~g~~g~vy~~~~~~~~~~~aiK~~~~~   51 (343)
T cd07851          20 LSPVGSGAYGQVCSAFDTKTGRKVAIKKLSRP   51 (343)
T ss_pred             EEEeccCCceEEEEEEECCCCcEEEEEecccc
Confidence            478999999999999997 7899999997654


No 70 
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=85.29  E-value=1.8  Score=37.27  Aligned_cols=45  Identities=24%  Similarity=0.391  Sum_probs=34.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC--cHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN--VRDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~--i~~~i~~Dl~~l~~l  203 (227)
                      +.+++++.|+||+|+.+ +|+.||+|+..+.  ....+..++.+++.+
T Consensus        28 ~~l~~g~~~~vy~~~~~~~~~~~aik~~~~~~~~~~~~~~e~~~l~~l   75 (291)
T cd06639          28 ETIGKGTYGKVYKVTNKKDGSLAAVKILDPISDVDEEIEAEYNILQSL   75 (291)
T ss_pred             EEeecCCCeEEEEEEECCCCCEEEEEEecccccHHHHHHHHHHHHHHh
Confidence            47999999999999986 7899999998764  345555666655544


No 71 
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=85.20  E-value=1.5  Score=38.23  Aligned_cols=30  Identities=33%  Similarity=0.403  Sum_probs=26.5

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      .+.+|.++.|+||+|+.+ +|+.||||+.+.
T Consensus        10 ~~~lg~G~~g~V~~~~~~~~~~~~aiK~~~~   40 (303)
T cd07869          10 LEKLGEGSYATVYKGKSKVNGKLVALKVIRL   40 (303)
T ss_pred             eeeEEecCCEEEEEEEECCCCCEEEEEEecc
Confidence            367999999999999987 899999999764


No 72 
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=85.13  E-value=1.7  Score=38.29  Aligned_cols=29  Identities=34%  Similarity=0.442  Sum_probs=25.3

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+|.++.|+||+|+.+ +|+.||||+....
T Consensus         2 ~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~   31 (321)
T cd05603           2 VIGKGSFGKVLLAKRKSDGSFYAVKVLQKK   31 (321)
T ss_pred             eeeeCCCEEEEEEEECCCCCEEEEEEEEHH
Confidence            4789999999999987 7899999997654


No 73 
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=85.08  E-value=1.7  Score=38.47  Aligned_cols=30  Identities=30%  Similarity=0.458  Sum_probs=25.9

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      .+|.++.|+||+|+-+ +|+.||||+.....
T Consensus         2 ~lG~G~~g~V~~~~~~~~~~~~aiK~~~~~~   32 (325)
T cd05604           2 VIGKGSFGKVLLAKRKLDGKCYAVKVLQKKI   32 (325)
T ss_pred             ceeeCCCeEEEEEEECCCCCEEEEEEEEHHH
Confidence            4789999999999976 89999999987643


No 74 
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=84.91  E-value=1.7  Score=38.57  Aligned_cols=31  Identities=26%  Similarity=0.394  Sum_probs=27.0

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      +.+|.|+.|+||+|+.+ +|+.||||+.....
T Consensus         7 ~~ig~G~~g~Vy~~~~~~~~~~vaiK~~~~~~   38 (333)
T cd05600           7 TQVGQGGYGQVFLAKKKDTGEIVALKRMKKSL   38 (333)
T ss_pred             EEEeecCCeEEEEEEECCCCCEEEEEEEEHHH
Confidence            46999999999999987 69999999987543


No 75 
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=84.73  E-value=1.4  Score=38.26  Aligned_cols=35  Identities=17%  Similarity=0.357  Sum_probs=27.6

Q ss_pred             ccccceeeccceEEEEecC-----------------CCEEEEEecCCCcHHH
Q psy4056         158 PNPMGAASLAQVHKATLHD-----------------GSTIALKVQHRNVRDN  192 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~~-----------------G~~VAVKVq~P~i~~~  192 (227)
                      .+.+|+++.|.||+|+..+                 +..||||+.+++....
T Consensus        10 ~~~lg~G~fg~V~~~~~~~~~~~~~~~~~~~~~~~~~~~vaiK~~~~~~~~~   61 (304)
T cd05096          10 KEKLGEGQFGEVHLCEVVNPQDLPTLQFPFNVRKGRPLLVAVKILRPDANKN   61 (304)
T ss_pred             eeEecccCCeEEEEEEeccCcccccccccccccCCcceEEEEEEecCCCCHH
Confidence            3569999999999998643                 3479999999976544


No 76 
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=84.57  E-value=1.7  Score=36.66  Aligned_cols=31  Identities=23%  Similarity=0.270  Sum_probs=27.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      ..+++++.|+||+|+.+ +|+.||+|+.+..-
T Consensus        15 ~~lg~g~~g~vy~~~~~~~~~~~aik~~~~~~   46 (267)
T cd06646          15 QRVGSGTYGDVYKARNLHTGELAAVKIIKLEP   46 (267)
T ss_pred             heeecCCCeEEEEEEECCCCeEEEEEEEecCc
Confidence            56899999999999975 89999999987654


No 77 
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=84.43  E-value=1.7  Score=37.21  Aligned_cols=52  Identities=25%  Similarity=0.394  Sum_probs=38.0

Q ss_pred             ChhhhccccCccccceeeccceEEEEec-CCCEEEEEecCCCc--HHHHHHHHHHHH
Q psy4056         148 DPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHRNV--RDNANIDIKCME  201 (227)
Q Consensus       148 ~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i--~~~i~~Dl~~l~  201 (227)
                      +..+.|...  ++++.+..|+||+|... +|+.|++|+..+..  .+.+..++..++
T Consensus        16 ~~~~~~~~~--~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~e~~~l~   70 (286)
T cd06614          16 DPRELYKNL--EKIGEGASGEVYKATDRATGKEVAIKKMRLRKQNKELIINEILIMK   70 (286)
T ss_pred             CccccchHh--HhccCCCCeEEEEEEEccCCcEEEEEEEecCchhHHHHHHHHHHHH
Confidence            344445432  67999999999999998 79999999998876  344555555443


No 78 
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=84.30  E-value=1.4  Score=38.40  Aligned_cols=29  Identities=24%  Similarity=0.291  Sum_probs=25.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.++.++.|.||+|+.+ +|+.||||+...
T Consensus         7 ~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~   36 (291)
T cd05612           7 KTVGTGTFGRVHLVRDRISEHYYALKVMAI   36 (291)
T ss_pred             eeeecCCCeEEEEEEEcCCCCEEEEEEEEH
Confidence            56999999999999987 799999998754


No 79 
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=84.19  E-value=1.7  Score=37.57  Aligned_cols=44  Identities=18%  Similarity=0.221  Sum_probs=32.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC----CcHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR----NVRDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P----~i~~~i~~Dl~~l~~  202 (227)
                      +.++.++.|.||+|+.+ +|+.||+|+.+.    +....+..++.+++.
T Consensus        11 ~~lg~G~~g~Vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~E~~~l~~   59 (288)
T cd07871          11 DKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKN   59 (288)
T ss_pred             eEEecCCCEEEEEEEECCCCCEEEEEEecccccCCcchhHHHHHHHHHh
Confidence            56999999999999987 789999998763    233344455555543


No 80 
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=84.06  E-value=1.7  Score=36.99  Aligned_cols=45  Identities=29%  Similarity=0.308  Sum_probs=33.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc-----HHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV-----RDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-----~~~i~~Dl~~l~~l  203 (227)
                      +.++.+..|.||+|+.+ +|+.|+||+.+...     .+.+..++.+++.+
T Consensus         6 ~~l~~g~~~~v~~~~~~~~~~~~~vK~~~~~~~~~~~~~~~~~e~~~l~~~   56 (286)
T cd07832           6 GRIGEGAHGIVFKAKDRETGETVALKKVALRRLEGGIPNQALREIKALQAC   56 (286)
T ss_pred             eecccCCCcEEEEEEECCCCceEEEEEEEcccccchhhHHHHHHHHHHHhC
Confidence            45899999999999986 89999999876433     34555555555433


No 81 
>KOG0574|consensus
Probab=84.04  E-value=0.18  Score=46.79  Aligned_cols=78  Identities=24%  Similarity=0.322  Sum_probs=54.6

Q ss_pred             HHHHHHHHhcCCChhhhccccCccccceeeccceEEEEec-CCCEEEEEecCCCc-HHHHHHHHHHHH-----HHHHHHH
Q psy4056         136 DILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHRNV-RDNANIDIKCME-----ALVHVVA  208 (227)
Q Consensus       136 ~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-~~~i~~Dl~~l~-----~l~~~~~  208 (227)
                      +..++=+..|.++++++|+-+++  +|.+|-|-||+|.-+ +|+-||+|-..-+- -+.|-.++.+|+     .+++...
T Consensus        18 ~~~KLd~~sL~K~PEEVFDi~~K--LGEGSYGSV~KAIH~EsG~v~AIK~VPV~sDLQEIIKEISIMQQC~S~yVVKYYG   95 (502)
T KOG0574|consen   18 DGFKLDSSALNKPPEEVFDIVGK--LGEGSYGSVHKAIHRESGHVLAIKKVPVDTDLQEIIKEISIMQQCKSKYVVKYYG   95 (502)
T ss_pred             cccccChhhhcCChHHHHHHHHH--hcCCcchHHHHHHHhccCcEEEEEecCccchHHHHHHHHHHHHHcCCchhhhhhh
Confidence            56677778889999999987765  999999999999988 89999999332211 123344455554     3445555


Q ss_pred             HhCCCCC
Q psy4056         209 WVFPEFK  215 (227)
Q Consensus       209 ~~~p~~~  215 (227)
                      ..|.+.+
T Consensus        96 SYFK~sD  102 (502)
T KOG0574|consen   96 SYFKHSD  102 (502)
T ss_pred             hhccCCc
Confidence            5565544


No 82 
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=84.00  E-value=2.8  Score=35.84  Aligned_cols=39  Identities=26%  Similarity=0.479  Sum_probs=30.7

Q ss_pred             hhhhccccCccccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         149 PSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       149 ~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      ++++|..+.  .+++++.|-||+|+.+ +|+.||||+.....
T Consensus         2 ~~~~~~~~~--~ig~G~~~~vy~~~~~~~~~~~aiK~~~~~~   41 (277)
T cd06641           2 PEELFTKLE--KIGKGSFGEVFKGIDNRTQKVVAIKIIDLEE   41 (277)
T ss_pred             HHHhhhhhe--eEeecCCeEEEEEEECCCCcEEEEEEecccc
Confidence            456666544  4999999999999875 88999999876543


No 83 
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=83.95  E-value=1  Score=37.87  Aligned_cols=30  Identities=23%  Similarity=0.400  Sum_probs=25.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ++++.++.|+||+|+.+ +|+.||||+.+..
T Consensus         2 ~~l~~g~~~~v~~a~~~~~~~~vavK~~~~~   32 (260)
T cd05611           2 KPISKGAFGSVYLAKKRSTGDYFAIKVLKKS   32 (260)
T ss_pred             ccCCcCCCeeEEEEEecCCCCeEEEEEecch
Confidence            47899999999999986 7999999987643


No 84 
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=83.93  E-value=2  Score=36.23  Aligned_cols=45  Identities=16%  Similarity=0.288  Sum_probs=34.4

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCc--HHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNV--RDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i--~~~i~~Dl~~l~~l  203 (227)
                      +.++.+.-|.||+|...+++.||||..+++-  .+.+..++.+++.+
T Consensus        12 ~~lg~g~~~~v~~~~~~~~~~v~iK~~~~~~~~~~~~~~e~~~l~~l   58 (261)
T cd05068          12 RKLGAGQFGEVWEGLWNNTTPVAVKTLKPGTMDPKDFLAEAQIMKKL   58 (261)
T ss_pred             EEecccCCccEEEEEecCCeEEEEEeeCCCcccHHHHHHHHHHHHHC
Confidence            6799999999999998888999999988753  23455555555443


No 85 
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=83.51  E-value=2.1  Score=37.64  Aligned_cols=40  Identities=30%  Similarity=0.409  Sum_probs=33.2

Q ss_pred             CCChhhhccccCccccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         146 GKDPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       146 G~~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.+++++|..+..  ++.++.|.||+|+.. +|+.|++|+...
T Consensus        16 ~~~~~~~~~~~~~--lg~g~~g~v~~~~~~~~~~~v~ik~~~~   56 (313)
T cd06633          16 KDDPEEIFVGLHE--IGHGSFGAVYFATNSHTNEVVAVKKMSY   56 (313)
T ss_pred             cCCHHHHhhccee--eccCCCeEEEEEEECCCCcEEEEEEEec
Confidence            4678888776554  999999999999986 789999998754


No 86 
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=83.43  E-value=2.3  Score=35.78  Aligned_cols=30  Identities=17%  Similarity=0.347  Sum_probs=26.9

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~  188 (227)
                      +.++.++.|.||+|...++++||+|...++
T Consensus        12 ~~lg~g~~g~v~~~~~~~~~~v~iK~~~~~   41 (261)
T cd05072          12 KKLGAGQFGEVWMGYYNNSTKVAVKTLKPG   41 (261)
T ss_pred             eecCCcCCceEEEEEecCCceEEEEEccCC
Confidence            569999999999999989999999988764


No 87 
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=83.42  E-value=2.1  Score=36.20  Aligned_cols=45  Identities=18%  Similarity=0.271  Sum_probs=33.3

Q ss_pred             ccccceeeccceEEEEecCCCEEEEEecCCCcH--HHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLHDGSTIALKVQHRNVR--DNANIDIKCMEA  202 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~--~~i~~Dl~~l~~  202 (227)
                      .+.++.++.|.||+|...++..|++|+.+++-.  +.+...+.+++.
T Consensus        11 ~~~lg~g~~~~vy~~~~~~~~~~~iK~~~~~~~~~~~~~~e~~~l~~   57 (260)
T cd05073          11 EKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKT   57 (260)
T ss_pred             EeEecCccceEEEEEEecCCccEEEEecCCChhHHHHHHHHHHHHHh
Confidence            357999999999999988888999999887643  234444444443


No 88 
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=83.12  E-value=2  Score=35.84  Aligned_cols=31  Identities=19%  Similarity=0.369  Sum_probs=26.4

Q ss_pred             ccceeeccceEEEEecCCCEEEEEecCCCcH
Q psy4056         160 PMGAASLAQVHKATLHDGSTIALKVQHRNVR  190 (227)
Q Consensus       160 PiasASIaQVHrA~L~~G~~VAVKVq~P~i~  190 (227)
                      .++.++.|.||+|...+|+.|++|+......
T Consensus         2 ~lg~g~~g~v~~~~~~~~~~v~~K~~~~~~~   32 (251)
T cd05041           2 KIGKGNFGDVYKGVLKGNTEVAVKTCRSTLP   32 (251)
T ss_pred             ccccCCCceEEEEEEeCCCcEEEEeccccCC
Confidence            5889999999999998899999998665433


No 89 
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=83.12  E-value=2.1  Score=38.34  Aligned_cols=46  Identities=20%  Similarity=0.305  Sum_probs=32.9

Q ss_pred             ccccceeeccceEEEEe------cCCCEEEEEecCCCcHH----HHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATL------HDGSTIALKVQHRNVRD----NANIDIKCMEAL  203 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L------~~G~~VAVKVq~P~i~~----~i~~Dl~~l~~l  203 (227)
                      .+.||.++.|.||+|+.      .+|+.||||+.+.+...    .+..++.++..+
T Consensus        12 ~~~lG~G~fg~V~~~~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~E~~~l~~l   67 (343)
T cd05103          12 GKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHI   67 (343)
T ss_pred             cccccCCccceEEEEeeccCCccccceeEEEEEeccCCChHHHHHHHHHHHHHHhc
Confidence            35799999999999973      36889999999875422    344455555444


No 90 
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=83.12  E-value=1.9  Score=36.95  Aligned_cols=43  Identities=16%  Similarity=0.261  Sum_probs=31.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC-----cHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN-----VRDNANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~-----i~~~i~~Dl~~l~  201 (227)
                      +.++.++.|.||+|+.+ +|+.||||+....     ..+.+..++.+++
T Consensus         7 ~~lg~g~~~~v~~~~~~~~~~~~avK~~~~~~~~~~~~~~~~~E~~~l~   55 (287)
T cd07848           7 GVVGEGAYGVVLKCRHKETKEIVAIKKFKDSEENEEVKETTLRELKMLR   55 (287)
T ss_pred             EEecccCCEEEEEEEECCCCcEEEEEEEecccccccchhhHHHHHHHHH
Confidence            46899999999999997 7899999987643     3334445555544


No 91 
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=83.04  E-value=2.1  Score=36.71  Aligned_cols=45  Identities=24%  Similarity=0.319  Sum_probs=33.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc-----HHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV-----RDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-----~~~i~~Dl~~l~~l  203 (227)
                      +-++.++-|.||+|+.. +|+.||||+.+...     ...+..++.+++.+
T Consensus         7 ~~lg~g~~g~vy~~~~~~~~~~v~lK~~~~~~~~~~~~~~~~~E~~~l~~l   57 (295)
T cd07837           7 EKIGEGTYGKVYKARDKNTGKLVALKKTRLEMDEEGIPPTALREISLLQML   57 (295)
T ss_pred             eEecccCCeEEEEEEECCCCcEEEEEeehhhccccCCchHHHHHHHHHHHc
Confidence            45899999999999987 79999999876543     23455566655544


No 92 
>PF07714 Pkinase_Tyr:  Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain;  InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].  ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=83.03  E-value=1.9  Score=36.74  Aligned_cols=32  Identities=19%  Similarity=0.387  Sum_probs=26.7

Q ss_pred             ccceeeccceEEEEec-----CCCEEEEEecCCCcHH
Q psy4056         160 PMGAASLAQVHKATLH-----DGSTIALKVQHRNVRD  191 (227)
Q Consensus       160 PiasASIaQVHrA~L~-----~G~~VAVKVq~P~i~~  191 (227)
                      -||.|+.|.||+|+++     .+.+|+||+..+....
T Consensus         6 ~ig~G~fg~v~~~~~~~~~~~~~~~V~vk~~~~~~~~   42 (259)
T PF07714_consen    6 QIGEGSFGKVYRAEWKQKDNDKNQPVAVKILKPSSSE   42 (259)
T ss_dssp             EEEEESSEEEEEEEEESTTTSSEEEEEEEEESTTSSH
T ss_pred             EEccCCCcEEEEEEEEcccCCCCEEEEEEEecccccc
Confidence            4899999999999998     3579999999875443


No 93 
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=83.03  E-value=2.1  Score=37.18  Aligned_cols=47  Identities=23%  Similarity=0.227  Sum_probs=33.5

Q ss_pred             cCccccceeeccceEEEEecC---CCEEEEEecCCC-cHHHHHHHHHHHHH
Q psy4056         156 IEPNPMGAASLAQVHKATLHD---GSTIALKVQHRN-VRDNANIDIKCMEA  202 (227)
Q Consensus       156 fd~~PiasASIaQVHrA~L~~---G~~VAVKVq~P~-i~~~i~~Dl~~l~~  202 (227)
                      .+...+|.++.|.||+|+.++   ++.||+|...+. ....+..++.+++.
T Consensus         4 ~~g~~lG~G~~g~Vy~~~~~~~~~~~~~a~k~~~~~~~~~~~~~E~~~l~~   54 (317)
T cd07867           4 YEGCKVGRGTYGHVYKAKRKDGKDEKEYALKQIEGTGISMSACREIALLRE   54 (317)
T ss_pred             eeceEeccCCCeeEEEEEecCCCccceEEEEEecCCCCcHHHHHHHHHHHh
Confidence            445679999999999999874   578999987653 33345555555554


No 94 
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=82.67  E-value=1.9  Score=36.37  Aligned_cols=32  Identities=25%  Similarity=0.274  Sum_probs=27.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~  190 (227)
                      +.++.++.|+||+|+.. +|+.||+|+.++...
T Consensus        15 ~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~~~   47 (267)
T cd06645          15 QRIGSGTYGDVYKARNVNTGELAAIKVIKLEPG   47 (267)
T ss_pred             HHhCCCCCeEEEEEEEcCCCcEEEEEEEecCch
Confidence            46899999999999986 799999999876643


No 95 
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=82.57  E-value=1.8  Score=38.81  Aligned_cols=29  Identities=17%  Similarity=0.315  Sum_probs=25.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.||.|+.|.||+|+-+ +|+.||||+...
T Consensus         7 ~~lG~G~~g~V~~~~~~~~~~~vaiK~~~~   36 (364)
T cd05599           7 KVIGRGAFGEVRLVQKKDTGHIYAMKKLRK   36 (364)
T ss_pred             EEEEecCCEEEEEEEECCCCCEEEEEEEEH
Confidence            56999999999999987 799999999864


No 96 
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=82.51  E-value=2.2  Score=35.86  Aligned_cols=43  Identities=16%  Similarity=0.281  Sum_probs=32.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcHH----HHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRD----NANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~----~i~~Dl~~l~  201 (227)
                      +.++.++.|.||+|..+ +|+.|++|+...+...    .+..++..++
T Consensus         7 ~~ig~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~e~~~l~   54 (265)
T cd06605           7 GELGAGNSGVVSKVLHRPTGKIMAVKTIRLEINEAIQKQILRELDILH   54 (265)
T ss_pred             HHhcCCCCeEEEEEEEcCCCcEEEEEEEecccChHHHHHHHHHHHHHH
Confidence            46899999999999998 7999999998776543    3444444443


No 97 
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=82.46  E-value=2.4  Score=36.82  Aligned_cols=44  Identities=18%  Similarity=0.195  Sum_probs=31.9

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCCcH----HHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRNVR----DNANIDIKCME  201 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~----~~i~~Dl~~l~  201 (227)
                      ...++.++.|+||+|+.+ +|+.||+|..+....    ..+..++.+++
T Consensus        11 ~~~lg~g~~g~vy~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~E~~~l~   59 (301)
T cd07873          11 LDKLGEGTYATVYKGRSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLK   59 (301)
T ss_pred             eeEeccCcCEEEEEEEEcCCCcEEEEEEEecccccCchhHHHHHHHHHH
Confidence            357999999999999987 789999998764432    23444444444


No 98 
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=82.42  E-value=1.9  Score=38.79  Aligned_cols=29  Identities=17%  Similarity=0.370  Sum_probs=26.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.+|.++.|+||+|+.+ +|+.||||+.++
T Consensus         7 ~~lG~G~~g~V~~~~~~~~~~~~aiK~~~~   36 (360)
T cd05627           7 KVIGRGAFGEVRLVQKKDTGHIYAMKILRK   36 (360)
T ss_pred             EEEeeCCCEEEEEEEECCCCCEEEEEEEEH
Confidence            57999999999999987 799999999874


No 99 
>PTZ00284 protein kinase; Provisional
Probab=82.37  E-value=2.2  Score=40.18  Aligned_cols=45  Identities=22%  Similarity=0.321  Sum_probs=31.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC--CcHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR--NVRDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P--~i~~~i~~Dl~~l~~l  203 (227)
                      +.||.|+.|.||+|+.. +|+.||||+.+.  ...+.....+.+++.+
T Consensus       135 ~~lG~G~fg~V~~a~~~~~~~~vAvK~i~~~~~~~~~~~~e~~~l~~l  182 (467)
T PTZ00284        135 SLLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKV  182 (467)
T ss_pred             EEEEeccCEEEEEEEEcCCCeEEEEEEEecchhhHHHHHHHHHHHHHH
Confidence            46999999999999986 788999999863  2233334444444443


No 100
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=82.36  E-value=2  Score=38.05  Aligned_cols=30  Identities=20%  Similarity=0.344  Sum_probs=26.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.+|.++.|+||+|+.+ +|+.||||+.+..
T Consensus         7 ~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~   37 (350)
T cd05573           7 KVIGRGAFGEVWLVRDKDTGQVYAMKVLRKS   37 (350)
T ss_pred             EEEEeCCcEEEEEEEECCCCCEEEEEEEEHH
Confidence            46899999999999987 7999999998653


No 101
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=82.34  E-value=2.7  Score=35.68  Aligned_cols=45  Identities=22%  Similarity=0.210  Sum_probs=32.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc-----HHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV-----RDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-----~~~i~~Dl~~l~~l  203 (227)
                      +.++.++.|.||+|+.+ +|++||||+.+...     ...+..++.+++.+
T Consensus         5 ~~l~~g~~~~v~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~e~~~l~~l   55 (287)
T cd07838           5 AEIGEGAYGTVYKARDLNTGRFVALKKVRVPLSEEGIPLSTLREIALLKQL   55 (287)
T ss_pred             EEecccCceEEEEEEECCCCCEEEEEEeccccccchhhhhHHHHHHHHHHh
Confidence            45889999999999998 59999999987433     33344455555444


No 102
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=82.31  E-value=2.4  Score=37.57  Aligned_cols=29  Identities=31%  Similarity=0.464  Sum_probs=25.6

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+|.++.|+||+|+.+ +|+.||||+..++
T Consensus         2 ~lg~G~~g~V~~~~~~~~~~~~aiK~~~~~   31 (320)
T cd05590           2 VLGKGSFGKVMLARLKESGRLYAVKVLKKD   31 (320)
T ss_pred             eeeeCCCeEEEEEEEcCCCCEEEEEEEEHH
Confidence            5789999999999987 7899999998764


No 103
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=82.18  E-value=3.3  Score=34.28  Aligned_cols=34  Identities=18%  Similarity=0.403  Sum_probs=29.2

Q ss_pred             cccceeeccceEEEEecC----CCEEEEEecCCCcHHH
Q psy4056         159 NPMGAASLAQVHKATLHD----GSTIALKVQHRNVRDN  192 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~----G~~VAVKVq~P~i~~~  192 (227)
                      +.+|.++.|+||+|+..+    +.+|+||+.++.....
T Consensus         1 ~~ig~g~~g~v~~~~~~~~~~~~~~~~ik~~~~~~~~~   38 (262)
T cd00192           1 KKLGEGAFGEVYKGKLKGKDGKTTEVAVKTLKEDASEE   38 (262)
T ss_pred             CccccCCceEEEEEEEecCCCCCceEEeEeeccccchh
Confidence            368999999999999974    8899999999887654


No 104
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=82.12  E-value=3  Score=34.91  Aligned_cols=45  Identities=16%  Similarity=0.261  Sum_probs=35.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH--HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR--DNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~--~~i~~Dl~~l~~l  203 (227)
                      ++++.+..|+||+|..+ +|+.|++|+..+...  +.+..++.+++.+
T Consensus        12 ~~l~~g~~~~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~e~~~l~~~   59 (275)
T cd06608          12 EVIGEGTYGKVYKARHKKTGQLVAIKIMDIIEDEEEEIKEEYNILRKY   59 (275)
T ss_pred             eeecCCCCeEEEEEEECCCCcEEEEEEEecCchhHHHHHHHHHHHHHh
Confidence            67999999999999987 789999999887653  4556666666654


No 105
>PHA02988 hypothetical protein; Provisional
Probab=82.05  E-value=2.5  Score=36.76  Aligned_cols=31  Identities=3%  Similarity=0.107  Sum_probs=26.7

Q ss_pred             CccccceeeccceEEEEecCCCEEEEEecCCC
Q psy4056         157 EPNPMGAASLAQVHKATLHDGSTIALKVQHRN  188 (227)
Q Consensus       157 d~~PiasASIaQVHrA~L~~G~~VAVKVq~P~  188 (227)
                      +...++.+.-+.||+|++ +|++||||+....
T Consensus        24 ~~~~i~~g~~~~v~~~~~-~~~~vavK~~~~~   54 (283)
T PHA02988         24 TSVLIKENDQNSIYKGIF-NNKEVIIRTFKKF   54 (283)
T ss_pred             CCeEEeeCCceEEEEEEE-CCEEEEEEecccc
Confidence            456789999999999998 8999999988754


No 106
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=81.98  E-value=2.9  Score=35.68  Aligned_cols=30  Identities=27%  Similarity=0.306  Sum_probs=26.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.++.|+||+|+.+ +|+.||+|+....
T Consensus        22 ~~lg~g~~~~v~~~~~~~~~~~~a~K~~~~~   52 (282)
T cd06636          22 EVVGNGTYGQVYKGRHVKTGQLAAIKVMDVT   52 (282)
T ss_pred             eeeccCCCeEEEEEEEcCCCcEEEEEEEecC
Confidence            57999999999999986 7899999997543


No 107
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=81.92  E-value=2  Score=36.23  Aligned_cols=28  Identities=32%  Similarity=0.485  Sum_probs=24.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      +.++.++.|+||+|+.+ +|+.|+||...
T Consensus         8 ~~ig~g~~g~v~~~~~~~~~~~~~vK~~~   36 (267)
T cd08229           8 KKIGRGQFSEVYRATCLLDGVPVALKKVQ   36 (267)
T ss_pred             hhhcccCCeEEEEEeecCCCceEEEEeee
Confidence            57999999999999976 89999999654


No 108
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=81.85  E-value=2.9  Score=35.67  Aligned_cols=34  Identities=21%  Similarity=0.295  Sum_probs=28.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDN  192 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~  192 (227)
                      ..++.++.|+||+|+.. +|+.||+|+....-...
T Consensus        11 ~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~   45 (280)
T cd06611          11 GELGDGAFGKVYKAQHKETGLFAAAKIIQIESEEE   45 (280)
T ss_pred             HHhcCCCCceEEEEEEcCCCcEEEEEEEeeCCHHH
Confidence            35899999999999986 79999999998765544


No 109
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=81.77  E-value=2  Score=37.44  Aligned_cols=44  Identities=20%  Similarity=0.202  Sum_probs=32.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc-----HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV-----RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-----~~~i~~Dl~~l~~  202 (227)
                      +.++.++.|.||+|+.+ +|+.||+|+.+...     ...+..++.+++.
T Consensus        13 ~~ig~g~~~~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~E~~~l~~   62 (309)
T cd07845          13 NRIGEGTYGIVYRARDTTSGEIVALKKVRMDNERDGIPISSLREITLLLN   62 (309)
T ss_pred             eeeeecCCEEEEEEEECCCCcEEEEEEEEeccCCCCCcchhhHHHHHHHh
Confidence            45899999999999987 79999999876432     2234445555544


No 110
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=81.69  E-value=3.1  Score=36.32  Aligned_cols=48  Identities=25%  Similarity=0.254  Sum_probs=34.6

Q ss_pred             cCccccceeeccceEEEEec---CCCEEEEEecCC-CcHHHHHHHHHHHHHH
Q psy4056         156 IEPNPMGAASLAQVHKATLH---DGSTIALKVQHR-NVRDNANIDIKCMEAL  203 (227)
Q Consensus       156 fd~~PiasASIaQVHrA~L~---~G~~VAVKVq~P-~i~~~i~~Dl~~l~~l  203 (227)
                      ++...+|.|+.|.||+|+.+   +++.||||+... +....+...+.+++.+
T Consensus         4 ~~~~~lG~G~~g~Vy~~~~~~~~~~~~~aiK~~~~~~~~~~~~~E~~~l~~l   55 (317)
T cd07868           4 YEGCKVGRGTYGHVYKAKRKDGKDDRDYALKQIEGTGISMSACREIALLREL   55 (317)
T ss_pred             ccccccccCCCeEEEEEEEccCCCCceEEEEEECCCCCcHHHHHHHHHHHhc
Confidence            44567999999999999976   567999997754 3444555555555543


No 111
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=81.51  E-value=2.8  Score=35.29  Aligned_cols=30  Identities=20%  Similarity=0.206  Sum_probs=25.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ..++.++.|+||+|... +|+.||||+....
T Consensus         6 ~~ig~g~~~~v~~a~~~~~~~~~~~k~~~~~   36 (267)
T cd06628           6 ALIGSGSFGSVYLGMNASSGELMAVKQVELP   36 (267)
T ss_pred             ceeecCCCeEEEEEEecCCCcEEEEEEecCC
Confidence            56899999999999876 7899999987654


No 112
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=81.38  E-value=2.1  Score=38.17  Aligned_cols=29  Identities=17%  Similarity=0.434  Sum_probs=25.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.+|+|+.|+||+|+.+ +|+.||||+.++
T Consensus         7 ~~lG~G~~g~V~~~~~~~~~~~~aiK~~~~   36 (331)
T cd05597           7 KVIGRGAFGEVAVVKMKNTGQVYAMKILNK   36 (331)
T ss_pred             EEEEecCCeEEEEEEECCCCCEEEEEEEEH
Confidence            56999999999999987 799999999764


No 113
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=81.29  E-value=2.4  Score=35.48  Aligned_cols=32  Identities=19%  Similarity=0.348  Sum_probs=26.5

Q ss_pred             ccceeeccceEEEEecC--CC--EEEEEecCCCcHH
Q psy4056         160 PMGAASLAQVHKATLHD--GS--TIALKVQHRNVRD  191 (227)
Q Consensus       160 PiasASIaQVHrA~L~~--G~--~VAVKVq~P~i~~  191 (227)
                      .+++++.|.||+|...+  |+  .||||+..++...
T Consensus         2 ~ig~g~~~~v~~~~~~~~~~~~~~vaiK~~~~~~~~   37 (257)
T cd05040           2 KLGDGSFGVVRRGEWSTSGGKVIPVAVKCLKSDKLS   37 (257)
T ss_pred             cCCccCcccEEeeeEecCCCCceEEEEeecCCcccH
Confidence            58999999999999863  33  7999999987764


No 114
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=81.26  E-value=2.5  Score=37.13  Aligned_cols=29  Identities=24%  Similarity=0.288  Sum_probs=25.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.++.++.|+||+|+-+ +|+.||||+.+.
T Consensus         6 ~~lg~G~~g~V~~~~~~~~~~~vaiK~~~~   35 (338)
T cd07859           6 EVIGKGSYGVVCSAIDTHTGEKVAIKKIND   35 (338)
T ss_pred             EEEeecCCeEEEEEEECCCCCEEEEEEech
Confidence            46899999999999976 899999998764


No 115
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=81.11  E-value=2.5  Score=37.52  Aligned_cols=43  Identities=19%  Similarity=0.298  Sum_probs=33.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcHH----HHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRD----NANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~----~i~~Dl~~l~  201 (227)
                      +.++.++.|+||+|+.+ +|..||+|+.+.....    .+..++.+++
T Consensus        11 ~~lg~G~~g~V~~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~E~~~l~   58 (331)
T cd06649          11 SELGAGNGGVVTKVQHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLH   58 (331)
T ss_pred             EeecCCCCEEEEEEEECCCCcEEEEEEeecccCHHHHHHHHHHHHHHH
Confidence            46999999999999988 7899999999876543    3444444444


No 116
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=81.01  E-value=2.4  Score=36.60  Aligned_cols=31  Identities=16%  Similarity=0.274  Sum_probs=26.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      +.+|.++.|.||+|..+ +|+.||||+..+..
T Consensus         6 ~~lg~G~~g~V~~~~~~~~~~~~avK~~~~~~   37 (285)
T cd05631           6 RVLGKGGFGEVCACQVRATGKMYACKKLEKKR   37 (285)
T ss_pred             EEEecCCCEEEEEEEEecCCceEEEEEeeHhh
Confidence            56999999999999986 89999999876543


No 117
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=80.89  E-value=3.1  Score=35.54  Aligned_cols=44  Identities=14%  Similarity=0.343  Sum_probs=32.4

Q ss_pred             cccceeeccceEEEEec-----CCCEEEEEecCCCcHH---HHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-----DGSTIALKVQHRNVRD---NANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-----~G~~VAVKVq~P~i~~---~i~~Dl~~l~~  202 (227)
                      +.+++++.|.||+|+.+     +|+.||||+.+..-..   .+..++.+++.
T Consensus        10 ~~lg~g~~g~v~~~~~~~~~~~~~~~v~iK~~~~~~~~~~~~~~~e~~~l~~   61 (284)
T cd05081          10 QQLGKGNFGSVELCRYDPLQDNTGEVVAVKKLQHSTAEHLRDFEREIEILKS   61 (284)
T ss_pred             eeccCCCCceEEEEEecCCcCCCCcEEEEEEeccCCHHHHHHHHHHHHHHHh
Confidence            56999999999999864     6889999998776543   34445554443


No 118
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=80.84  E-value=3.1  Score=35.68  Aligned_cols=44  Identities=18%  Similarity=0.204  Sum_probs=30.8

Q ss_pred             cccceeeccceEEEEec--CCCEEEEEecCCCc-----HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH--DGSTIALKVQHRNV-----RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~--~G~~VAVKVq~P~i-----~~~i~~Dl~~l~~  202 (227)
                      +.++.++.|.||+|+..  +|+.||||+.+...     ......++.+++.
T Consensus         7 ~~lg~G~~g~Vy~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~~e~~~l~~   57 (290)
T cd07862           7 AEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRH   57 (290)
T ss_pred             eEeccCCCeEEEEEEEcCCCCeEEEEEEEecccCCCCchHHHHHHHHHHHh
Confidence            46899999999999864  57899999876432     2334445555443


No 119
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=80.84  E-value=2.8  Score=37.94  Aligned_cols=29  Identities=31%  Similarity=0.438  Sum_probs=25.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.+|.|+.|+||+|+-. +|+.||||+...
T Consensus         6 ~~lg~G~~g~V~~~~~~~~~~~vaiK~~~~   35 (372)
T cd07853           6 RPIGYGAFGVVWSVTDPRDGKRVALKKMPN   35 (372)
T ss_pred             ceeeeCCCEEEEEEEECCCCCEEEEEeccc
Confidence            57999999999999975 899999998754


No 120
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=80.82  E-value=3  Score=36.89  Aligned_cols=30  Identities=30%  Similarity=0.461  Sum_probs=26.4

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      .+|.|+.|+||+|+.+ +|+.||||+.+++.
T Consensus         2 ~lg~G~~g~V~~~~~~~~~~~~avK~~~~~~   32 (316)
T cd05620           2 VLGKGSFGKVLLAELKGKGEYFAVKALKKDV   32 (316)
T ss_pred             eeeeCCCeEEEEEEECCCCCEEEEEEEEHHH
Confidence            4789999999999998 79999999988754


No 121
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=80.81  E-value=2.9  Score=36.45  Aligned_cols=38  Identities=24%  Similarity=0.370  Sum_probs=29.5

Q ss_pred             ChhhhccccCccccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         148 DPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       148 ~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      .+++.|...  +-++.++.|+||+|+.+ +|+.||+|+...
T Consensus        12 ~~~~~y~~~--~~lg~g~~g~vy~~~~~~~~~~v~iK~~~~   50 (307)
T cd06607          12 DPEKLFTDL--REIGHGSFGAVYFARDVRTNEVVAIKKMSY   50 (307)
T ss_pred             Ccchhhhhh--eeecCCCCeEEEEEEEcCCCcEEEEEEEec
Confidence            444555433  45999999999999987 799999998753


No 122
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=80.78  E-value=2.8  Score=36.30  Aligned_cols=44  Identities=20%  Similarity=0.268  Sum_probs=32.8

Q ss_pred             cccceeeccceEEEEecC---CCEEEEEecCCCc------HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHD---GSTIALKVQHRNV------RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~---G~~VAVKVq~P~i------~~~i~~Dl~~l~~  202 (227)
                      ..+++++.|.||+|+.++   |+.||||+..+..      .+.+..++.+++.
T Consensus         6 ~~ig~g~~g~v~~~~~~~~~~~~~~alK~~~~~~~~~~~~~~~~~~e~~~l~~   58 (316)
T cd07842           6 GCIGRGTYGRVYKAKRKNGKDGKEYAIKKFKGDKEQYTGISQSACREIALLRE   58 (316)
T ss_pred             EEeccCCcEEEEEEEecCCCCCCeEEEEEeccccccccCccHHHHHHHHHHHh
Confidence            348999999999999874   7999999998843      3444455555443


No 123
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=80.75  E-value=2.2  Score=36.34  Aligned_cols=32  Identities=22%  Similarity=0.311  Sum_probs=27.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~  190 (227)
                      +.++.++.|+||+|+.+ +|+.||+|+..+...
T Consensus         7 ~~ig~g~~g~v~~~~~~~~~~~vaiK~~~~~~~   39 (283)
T cd06617           7 EELGRGAYGVVDKMRHVPTGTIMAVKRIRATVN   39 (283)
T ss_pred             EEecccCCeEEEEEEEcCCCcEEEEEEEecCCC
Confidence            46899999999999987 799999998877654


No 124
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=80.71  E-value=3.5  Score=34.42  Aligned_cols=32  Identities=28%  Similarity=0.260  Sum_probs=28.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~  190 (227)
                      +.++.++.|.||+|+.+ +|+.|+||+..++..
T Consensus         7 ~~i~~g~~~~v~~~~~~~~~~~~~vk~~~~~~~   39 (264)
T cd06623           7 KVLGQGSSGVVYKVRHKPTGKIYALKKIHVDGD   39 (264)
T ss_pred             eeeeecCCeEEEEEEEcCCCcEEEEEEeccCcc
Confidence            67999999999999998 699999999888754


No 125
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=80.55  E-value=2.5  Score=37.46  Aligned_cols=29  Identities=17%  Similarity=0.320  Sum_probs=25.5

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+|.|+.|+||+|+.+ +|+.||||+..+.
T Consensus         2 ~lG~G~~g~Vy~~~~~~~~~~~aiK~~~~~   31 (323)
T cd05571           2 LLGKGTFGKVILVREKATGKYYAMKILKKE   31 (323)
T ss_pred             eeeeCCCeEEEEEEECCCCCEEEEEEEEHH
Confidence            4789999999999986 8999999998764


No 126
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=80.51  E-value=2.7  Score=36.17  Aligned_cols=43  Identities=28%  Similarity=0.288  Sum_probs=32.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH--------HHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR--------DNANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~--------~~i~~Dl~~l~  201 (227)
                      +.++.++.|+||+|..+ +|++|+||.......        ..+..++.+++
T Consensus         6 ~~lg~g~~~~vy~~~~~~~~~~v~iK~~~~~~~~~~~~~~~~~~~~e~~~l~   57 (298)
T cd07841           6 KKLGEGTYAVVYKARDKETGRIVAIKKIKLGERKEAKDGINFTALREIKLLQ   57 (298)
T ss_pred             eeeeeccccEEEEEEECCCCcEEEEEEEeccccccccchhhHHHHHHHHHHh
Confidence            35899999999999986 799999999876543        34445555554


No 127
>KOG1163|consensus
Probab=80.49  E-value=1.4  Score=39.98  Aligned_cols=32  Identities=16%  Similarity=0.374  Sum_probs=26.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~  190 (227)
                      .+|||+|.|-.|.|.-- +|++|||||-.-.++
T Consensus        21 rkiGsGSFGdIy~~~~i~~ge~VAiK~Es~~a~   53 (341)
T KOG1163|consen   21 RKIGSGSFGDIYLGISITSGEEVAIKLESSKAK   53 (341)
T ss_pred             EeecCCchhheeeeeeccCCceEEEEeecccCC
Confidence            57999999999999764 999999998654443


No 128
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=80.48  E-value=3.4  Score=34.36  Aligned_cols=36  Identities=19%  Similarity=0.405  Sum_probs=30.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDNAN  194 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~i~  194 (227)
                      +.+|+|+-|.||+++.+ +|+.||+|+....-...-.
T Consensus         5 ~~lg~G~~g~v~~~~~~~~~~~~~~K~~~~~~~~~~~   41 (260)
T PF00069_consen    5 KKLGSGGFGTVYKAKNKKNGQKVAVKIIDKSEIEEEE   41 (260)
T ss_dssp             EEEEEESSEEEEEEEETTTTEEEEEEEEESTTHHHHH
T ss_pred             EEEEeCCCEEEEEEEECCCCeEEEEEEeccccccccc
Confidence            46999999999999998 6779999999888654443


No 129
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs),  (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast 
Probab=80.46  E-value=4.2  Score=33.62  Aligned_cols=33  Identities=18%  Similarity=0.159  Sum_probs=28.3

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCCcH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRNVR  190 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~  190 (227)
                      .+++++++.|+||+|+.+ +|++|+||...+.-.
T Consensus         5 ~~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~   38 (254)
T cd06627           5 GDLIGRGAFGVVYKGLNLETGDFVAIKQISLEKI   38 (254)
T ss_pred             eeEEcccCCeEEEEEEEcCCCcEEEEEEeccccc
Confidence            368999999999999887 789999999887643


No 130
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=80.46  E-value=4  Score=34.10  Aligned_cols=31  Identities=19%  Similarity=0.171  Sum_probs=26.2

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .++++.++.|+||+|... +|+.|++|+....
T Consensus         6 ~~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~   37 (267)
T cd06610           6 IEVIGVGATAVVYAAICLPNNEKVAIKRIDLE   37 (267)
T ss_pred             eeeecCCCCeEEEEEEEcCCCcEEEEEEeccC
Confidence            356899999999999976 7899999987643


No 131
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=80.28  E-value=2.9  Score=37.81  Aligned_cols=29  Identities=14%  Similarity=0.236  Sum_probs=25.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      ++||.++.|.||+|+.+ +|+.||||+.+.
T Consensus         7 ~~lG~G~~g~V~~a~~~~~~~~~avK~~~~   36 (376)
T cd05598           7 KTIGIGAFGEVCLVRKVDTNALYAMKTLRK   36 (376)
T ss_pred             EEEEeCCCeEEEEEEECCCCCEEEEEEEcH
Confidence            57999999999999986 799999998764


No 132
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=80.21  E-value=3  Score=35.18  Aligned_cols=34  Identities=21%  Similarity=0.427  Sum_probs=28.1

Q ss_pred             ccccceeeccceEEEEec-CCC---EEEEEecCCCcHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGS---TIALKVQHRNVRD  191 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~---~VAVKVq~P~i~~  191 (227)
                      .+.++.++.|+||+|+++ +|+   .|+||..+++...
T Consensus        10 ~~~lg~g~~g~vy~~~~~~~~~~~~~~~ik~~~~~~~~   47 (268)
T cd05063          10 QKVIGAGEFGEVFRGILKMPGRKEVAVAIKTLKPGYTE   47 (268)
T ss_pred             eeEecCCCCccEEEEEEecCCCCceEEEEEeccccCCH
Confidence            467999999999999997 444   7999999887643


No 133
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=80.18  E-value=2.9  Score=36.15  Aligned_cols=30  Identities=17%  Similarity=0.302  Sum_probs=26.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.++.|.||+|+.. +|+.||||+..+.
T Consensus         6 ~~lg~G~~g~vy~~~~~~~~~~~aiK~~~~~   36 (285)
T cd05632           6 RVLGKGGFGEVCACQVRATGKMYACKRLEKK   36 (285)
T ss_pred             EEEecCCCeEEEEEEECCCCcEEEEEEeehh
Confidence            56999999999999987 8999999987664


No 134
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=79.97  E-value=2.5  Score=38.16  Aligned_cols=29  Identities=17%  Similarity=0.377  Sum_probs=25.8

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.+|.|+.|.||+|+.+ +|+.||||+.+.
T Consensus         7 ~~LG~G~~g~V~~~~~~~~~~~~aiK~~~~   36 (363)
T cd05628           7 KVIGRGAFGEVRLVQKKDTGHVYAMKILRK   36 (363)
T ss_pred             EEEEeCCCEEEEEEEECCCCCEEEEEEEEH
Confidence            56999999999999887 799999999864


No 135
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=79.93  E-value=2.7  Score=37.14  Aligned_cols=31  Identities=23%  Similarity=0.319  Sum_probs=26.8

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      +.+|.|+.|.||+|+.+ +|+.||||+.+++.
T Consensus         6 ~~lg~G~~g~Vy~~~~~~~~~~~avK~~~~~~   37 (324)
T cd05587           6 MVLGKGSFGKVMLAERKGTDELYAIKILKKDV   37 (324)
T ss_pred             EEEeeccCeEEEEEEECCCCCEEEEEEEEHHH
Confidence            56999999999999987 67899999987653


No 136
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=79.91  E-value=2.9  Score=36.50  Aligned_cols=31  Identities=23%  Similarity=0.261  Sum_probs=26.5

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+.+|.++.|.||+|+.+ +|+.||||+....
T Consensus        11 ~~~lg~G~~g~Vy~~~~~~~~~~vaiK~~~~~   42 (309)
T cd07872          11 LEKLGEGTYATVFKGRSKLTENLVALKEIRLE   42 (309)
T ss_pred             EEEecccCCEEEEEEEecCCCCeEEEEEeecc
Confidence            356999999999999987 7889999987644


No 137
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=79.79  E-value=3.6  Score=36.39  Aligned_cols=29  Identities=24%  Similarity=0.311  Sum_probs=25.1

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+|.|+.|.||+|+.+ +|+.||+|+....
T Consensus         2 ~lg~G~fg~V~~~~~~~~~~~~aiK~~~~~   31 (325)
T cd05602           2 VIGKGSFGKVLLARHKAEEKFYAVKVLQKK   31 (325)
T ss_pred             eeeeCCCeEEEEEEECCCCCEEEEEEEEHH
Confidence            5889999999999987 7889999998653


No 138
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=79.36  E-value=2.4  Score=37.52  Aligned_cols=45  Identities=16%  Similarity=0.274  Sum_probs=31.8

Q ss_pred             cccceeeccceEEEEec------CCCEEEEEecCCCcH----HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH------DGSTIALKVQHRNVR----DNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~------~G~~VAVKVq~P~i~----~~i~~Dl~~l~~l  203 (227)
                      +.||.++.|.||+|+..      +|+.||||+..++..    +.+...+.++..+
T Consensus        13 ~~lG~G~fg~Vy~~~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~E~~~l~~l   67 (338)
T cd05102          13 KVLGHGAFGKVVEASAFGIDKKSSCNTVAVKMLKEGATASEHKALMSELKILIHI   67 (338)
T ss_pred             eEeccCCcceEEEEEEeccCCcccchhhheeccccccchHHHHHHHHHHHHHHHh
Confidence            57999999999999852      467899999876543    2344455555443


No 139
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=79.36  E-value=2.8  Score=36.13  Aligned_cols=28  Identities=18%  Similarity=0.370  Sum_probs=24.0

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +|.++.|.||++..+ +|+.||||+....
T Consensus         1 lg~G~~g~Vy~~~~~~~~~~~avK~~~~~   29 (280)
T cd05608           1 LGKGGFGEVSACQMRATGKLYACKKLNKK   29 (280)
T ss_pred             CCCCCceeEEEEEEccCCcEEEEEeeeHH
Confidence            578999999999987 8999999987653


No 140
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=79.29  E-value=2.8  Score=35.73  Aligned_cols=44  Identities=23%  Similarity=0.258  Sum_probs=32.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC-----cHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN-----VRDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~-----i~~~i~~Dl~~l~~  202 (227)
                      +.++.++.|.||+|+.+ +|+.||+|+.+..     ....+..++.+++.
T Consensus         6 ~~l~~g~~~~vy~~~~~~~g~~~~~k~~~~~~~~~~~~~~~~~ei~~l~~   55 (284)
T cd07839           6 EKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKE   55 (284)
T ss_pred             EEecccCCeEEEEEEECCCCcEEEEEEeecccccccCccchhHHHHHHHh
Confidence            45899999999999987 8999999987542     23345556666553


No 141
>PTZ00036 glycogen synthase kinase; Provisional
Probab=79.20  E-value=3.7  Score=38.57  Aligned_cols=62  Identities=18%  Similarity=0.291  Sum_probs=39.1

Q ss_pred             HHHHHHhcCCChhhhccccCccccceeeccceEEEEec-CCCEEEEEecCCCcHHHHHHHHHHHHH
Q psy4056         138 LAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDNANIDIKCMEA  202 (227)
Q Consensus       138 ~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~i~~Dl~~l~~  202 (227)
                      ...+..+.+.....-|.-  .+.+|.|+.|.||+|+.. +|+.||||....+- ......+.+++.
T Consensus        53 ~~~~~~~~~~~~~~~y~~--~~~LG~G~fg~Vy~~~~~~~~~~vAiK~i~~~~-~~~~~Ei~il~~  115 (440)
T PTZ00036         53 EKMIDNDINRSPNKSYKL--GNIIGNGSFGVVYEAICIDTSEKVAIKKVLQDP-QYKNRELLIMKN  115 (440)
T ss_pred             hhhhhhhhccCcCCeEEE--eEEEEeCCCEEEEEEEECCCCCEEEEEEEecCc-chHHHHHHHHHh
Confidence            344445544433333332  356999999999999986 78999999765432 223345555544


No 142
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=79.16  E-value=3.2  Score=35.70  Aligned_cols=45  Identities=27%  Similarity=0.289  Sum_probs=33.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC-----cHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN-----VRDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~-----i~~~i~~Dl~~l~~l  203 (227)
                      +.++.++.|.||+|+.+ +|+.||||..+..     ..+.+..++.+++.+
T Consensus         8 ~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~~e~~~l~~l   58 (294)
T PLN00009          8 EKIGEGTYGVVYKARDRVTNETIALKKIRLEQEDEGVPSTAIREISLLKEM   58 (294)
T ss_pred             EEecCCCCEEEEEEEecCCCcEEEEEehhhccccccchHHHHHHHHHHHhc
Confidence            46889999999999987 8999999987542     234455566655543


No 143
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=79.12  E-value=5  Score=33.55  Aligned_cols=31  Identities=16%  Similarity=0.161  Sum_probs=27.1

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+.++.++.|+||+|+.. +|++|+||+.++.
T Consensus         7 ~~~lg~g~~~~vy~~~~~~~~~~~~lk~~~~~   38 (263)
T cd06625           7 GKLLGQGAFGRVYLCYDVDTGRELAVKQVPFD   38 (263)
T ss_pred             cceecCCCceEEEEEEEcCCCcEEEEEEEeec
Confidence            468999999999999976 7999999988765


No 144
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=79.09  E-value=4.2  Score=34.72  Aligned_cols=36  Identities=22%  Similarity=0.431  Sum_probs=28.4

Q ss_pred             hhhccccCccccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         150 SEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       150 ~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      ++.|..+  .++++++.|+||+|+.+ +|+.||||+...
T Consensus         3 ~~~y~~~--~~lg~g~~~~vy~~~~~~~~~~vaiK~~~~   39 (277)
T cd06640           3 EELFTKL--ERIGKGSFGEVFKGIDNRTQQVVAIKIIDL   39 (277)
T ss_pred             HHhhhhh--hhcccCCCeEEEEEEEccCCEEEEEEEEec
Confidence            4445433  46999999999999986 689999998753


No 145
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=78.90  E-value=5.7  Score=32.93  Aligned_cols=28  Identities=21%  Similarity=0.323  Sum_probs=24.2

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +++++.|+||+++.. +|+.|++|+..+.
T Consensus         1 lg~g~~~~vy~~~~~~~~~~~~~k~~~~~   29 (265)
T cd05579           1 ISKGAYGRVFLAKKKSTGDIYAIKVIKKA   29 (265)
T ss_pred             CCCCCceEEEEEEECCCCCEEEEEEecch
Confidence            467899999999998 5999999988664


No 146
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=78.81  E-value=3.2  Score=34.58  Aligned_cols=44  Identities=11%  Similarity=0.206  Sum_probs=32.0

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC-----cHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN-----VRDNANIDIKCME  201 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~-----i~~~i~~Dl~~l~  201 (227)
                      .++++.++.|.||++..+ +|..||+|.....     -.+.+...+.+++
T Consensus         5 ~~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~E~~~l~   54 (257)
T cd08225           5 IKKIGEGSFGKIYLAKAKSDSEHCVIKEIDLTKMPVKEKEASKKEVILLA   54 (257)
T ss_pred             EEEecCCCcceEEEEEEcCCCceEEEEEeeHhhccchhhHHHHHHHHHHH
Confidence            357999999999999998 7899999987542     2234444554444


No 147
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=78.73  E-value=3.1  Score=37.33  Aligned_cols=30  Identities=27%  Similarity=0.300  Sum_probs=26.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.+|+++.|.||+|+-+ +|+.||||+....
T Consensus        27 ~~lg~G~~g~V~~~~~~~~~~~vavK~~~~~   57 (359)
T cd07876          27 KPIGSGAQGIVCAAFDTVLGINVAVKKLSRP   57 (359)
T ss_pred             EEeecCCCEEEEEEEEcCCCceeEEEEeccc
Confidence            67999999999999876 7999999997643


No 148
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=78.67  E-value=3.8  Score=35.17  Aligned_cols=45  Identities=27%  Similarity=0.274  Sum_probs=32.6

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC----cHHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN----VRDNANIDIKCMEA  202 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~----i~~~i~~Dl~~l~~  202 (227)
                      .+.++.++-|.||+|+.+ +|+.|++|+....    ....+..++.+++.
T Consensus        10 ~~~ig~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~e~~~l~~   59 (291)
T cd07870          10 LEKLGEGSYATVYKGISRINGQLVALKVISMKTEEGVPFTAIREASLLKG   59 (291)
T ss_pred             EEEEEecCCEEEEEEEEcCCCcEEEEEEecccCcCCCcHHHHHHHHHHHh
Confidence            356999999999999986 7999999987543    22344455555543


No 149
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=78.65  E-value=1.8  Score=38.23  Aligned_cols=30  Identities=27%  Similarity=0.401  Sum_probs=26.1

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      .+|.|+.|.||+|+.+ +|+.||||+.++..
T Consensus         2 ~lG~G~~g~Vy~~~~~~~~~~vaiK~~~~~~   32 (316)
T cd05592           2 VLGKGSFGKVMLAELKGTNEFFAIKALKKDV   32 (316)
T ss_pred             eeeeCCCeEEEEEEECCCCCEEEEEEEEHHH
Confidence            4889999999999987 68899999987654


No 150
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=78.47  E-value=1.7  Score=38.43  Aligned_cols=29  Identities=28%  Similarity=0.416  Sum_probs=25.3

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+|.|+.|+||+|+.+ +|+.||||+..++
T Consensus         2 ~lG~G~~g~Vy~~~~~~~~~~~aiK~~~~~   31 (321)
T cd05591           2 VLGKGSFGKVMLAELKGTDEVYAIKVLKKD   31 (321)
T ss_pred             ccccCCCeEEEEEEECCCCCEEEEEEEeHH
Confidence            4789999999999987 6899999997764


No 151
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=78.32  E-value=3.6  Score=36.34  Aligned_cols=29  Identities=28%  Similarity=0.383  Sum_probs=25.1

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      -+|.++.|.||+|+.+ +|+.||||+.+..
T Consensus         2 ~lG~G~~g~V~~~~~~~~~~~~aiK~~~~~   31 (318)
T cd05570           2 VLGKGSFGKVLLAELKGTDELYAVKVLKKD   31 (318)
T ss_pred             eeeeCCCeEEEEEEECCCCCEEEEEEEEHH
Confidence            3789999999999987 6899999988754


No 152
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=78.32  E-value=2  Score=38.09  Aligned_cols=30  Identities=20%  Similarity=0.292  Sum_probs=26.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ..+|.++.|+||+|..+ +|+.||||+....
T Consensus         6 ~~lg~G~~g~Vy~~~~~~~~~~vaiK~~~~~   36 (323)
T cd05615           6 MVLGKGSFGKVMLAERKGTDELYAIKILKKD   36 (323)
T ss_pred             EEEEecCCeEEEEEEECCCCCEEEEEEEEHH
Confidence            57999999999999976 7999999997754


No 153
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=78.14  E-value=3.8  Score=34.45  Aligned_cols=44  Identities=18%  Similarity=0.280  Sum_probs=33.3

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCc--HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNV--RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i--~~~i~~Dl~~l~~  202 (227)
                      +.++.++.|.||+|..+++..+|||+..++.  ...+..++.+++.
T Consensus        10 ~~lg~G~~~~v~~~~~~~~~~~~iK~~~~~~~~~~~~~~e~~~l~~   55 (256)
T cd05059          10 KELGSGQFGVVHLGKWRGKIDVAIKMIREGAMSEDDFIEEAKVMMK   55 (256)
T ss_pred             hhhccCCCceEEEeEecCCccEEEEEeccCCCCHHHHHHHHHHHHh
Confidence            4689999999999998888899999987653  2345556665554


No 154
>KOG0600|consensus
Probab=78.14  E-value=2.8  Score=41.12  Aligned_cols=53  Identities=30%  Similarity=0.339  Sum_probs=43.7

Q ss_pred             hhhccccCccccceeeccceEEEEec-CCCEEEEEec-----CCCcHHHHHHHHHHHHHHH
Q psy4056         150 SEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQ-----HRNVRDNANIDIKCMEALV  204 (227)
Q Consensus       150 ~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq-----~P~i~~~i~~Dl~~l~~l~  204 (227)
                      .+.|+.++.  ||-|-.||||+|+-. +|+-||+|=.     .||....+...+.+|+.+-
T Consensus       116 ~~~feki~k--IGeGTyg~VYkAr~~~tgkivALKKvr~d~~~~~~~~t~~REI~ILr~l~  174 (560)
T KOG0600|consen  116 ADSFEKIEK--IGEGTYGQVYKARDLETGKIVALKKVRFDNEKEGFPITAIREIKILRRLD  174 (560)
T ss_pred             hHHHHHHHH--hcCcchhheeEeeecccCcEEEEEEeecccCCCcchHHHHHHHHHHHhcC
Confidence            466777765  999999999999976 8999999854     4888888999999988653


No 155
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=78.14  E-value=3.9  Score=34.80  Aligned_cols=44  Identities=23%  Similarity=0.303  Sum_probs=32.0

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC-----cHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN-----VRDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~-----i~~~i~~Dl~~l~~  202 (227)
                      +.++.+..|+||+|+.+ +|+.||+|+....     ..+.+..++.+++.
T Consensus         7 ~~lg~g~~~~vy~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~~e~~~l~~   56 (286)
T cd07846           7 GLVGEGSYGMVMKCKHKETGQIVAIKKFLESEDDKMVKKIAMREIRMLKQ   56 (286)
T ss_pred             eeeccCCCeEEEEEEECCCCCEEEEEeHhhccCcchhhHHHHHHHHHHHh
Confidence            56899999999999997 6899999975443     23345555555543


No 156
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=78.12  E-value=3.2  Score=38.71  Aligned_cols=32  Identities=25%  Similarity=0.450  Sum_probs=26.2

Q ss_pred             cccceeeccceEEEEec------CCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLH------DGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~------~G~~VAVKVq~P~i~  190 (227)
                      +.+|.|+.|+||+|+.+      ++++||||+.+....
T Consensus        43 ~~lG~G~fG~Vy~~~~~~~~~~~~~~~vavK~l~~~~~   80 (401)
T cd05107          43 RTLGSGAFGRVVEATAHGLSHSQSTMKVAVKMLKSTAR   80 (401)
T ss_pred             hhccCCCceeEEEEEEcCCCCCCCceEEEEEecCCCCC
Confidence            57999999999999975      346899999986543


No 157
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=78.07  E-value=3.8  Score=36.39  Aligned_cols=30  Identities=27%  Similarity=0.387  Sum_probs=26.3

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      .+|.++.|+||+|+.+ +|+.||||+.+...
T Consensus         2 ~lG~G~~g~V~~~~~~~~~~~~aiK~~~~~~   32 (327)
T cd05617           2 VIGRGSYAKVLLVRLKKNDQIYAMKVVKKEL   32 (327)
T ss_pred             eeeeCCCeEEEEEEECCCCCEEEEEEEEHHH
Confidence            5899999999999987 78999999988653


No 158
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=77.95  E-value=4.6  Score=36.12  Aligned_cols=37  Identities=19%  Similarity=0.236  Sum_probs=28.7

Q ss_pred             hccccC-ccccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         152 IFASIE-PNPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       152 ~F~~fd-~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ++..+. .+.+|.++.|.||+|.-. +|+.||||+....
T Consensus        15 ~~~~y~~~~~lg~G~~g~V~~~~~~~~~~~vaiK~~~~~   53 (355)
T cd07874          15 VLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP   53 (355)
T ss_pred             hhhceeEEEEeeecCCEEEEEEEecCCCceEEEEEeCCc
Confidence            333443 367999999999999876 7899999987653


No 159
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=77.91  E-value=3.2  Score=36.71  Aligned_cols=30  Identities=23%  Similarity=0.279  Sum_probs=26.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.+|.+..|.||+|+.+ +|++||||+....
T Consensus        15 ~~ig~G~~g~vy~~~~~~~~~~vaiK~~~~~   45 (335)
T PTZ00024         15 AHLGEGTYGKVEKAYDTLTGKIVAIKKVKII   45 (335)
T ss_pred             hcccCCCceeEEEEEECCCCCeEEEEEeecc
Confidence            46999999999999976 7999999987654


No 160
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=77.76  E-value=4.5  Score=33.00  Aligned_cols=27  Identities=11%  Similarity=0.084  Sum_probs=23.1

Q ss_pred             cceeeccceEEEEecCCCEEEEEecCCC
Q psy4056         161 MGAASLAQVHKATLHDGSTIALKVQHRN  188 (227)
Q Consensus       161 iasASIaQVHrA~L~~G~~VAVKVq~P~  188 (227)
                      |+.++-|.||+|.. +|++|+||+..+.
T Consensus         2 ig~G~~~~vy~~~~-~~~~~viK~~~~~   28 (199)
T TIGR03724         2 IAKGAEAIIYLGDF-LGLKAVIKERVPK   28 (199)
T ss_pred             CCCCceEEEEEeec-CCccEEEEEecCC
Confidence            67889999999995 8999999996654


No 161
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=77.69  E-value=3.8  Score=34.66  Aligned_cols=44  Identities=14%  Similarity=0.326  Sum_probs=33.2

Q ss_pred             cccceeeccceEEEEec-----CCCEEEEEecCCCcHH----HHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-----DGSTIALKVQHRNVRD----NANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-----~G~~VAVKVq~P~i~~----~i~~Dl~~l~~  202 (227)
                      +.++.+..|.||+|++.     +|+.||||+..+.-..    .+..++..++.
T Consensus        10 ~~ig~g~~~~v~~~~~~~~~~~~~~~~avK~~~~~~~~~~~~~~~~ei~~l~~   62 (284)
T cd05038          10 KQLGEGHFGKVELCRYDPLGDNTGEQVAVKSLNHSGEEQHRSDFEREIEILRT   62 (284)
T ss_pred             eeeccCCCeeEEEeeecCCCCCCceEEEEEEeccccchHHHHHHHHHHHHHHh
Confidence            56899999999999975     3789999999877553    45555555543


No 162
>KOG0199|consensus
Probab=77.60  E-value=2.1  Score=43.91  Aligned_cols=38  Identities=21%  Similarity=0.319  Sum_probs=32.4

Q ss_pred             ccceeeccceEEEEec--CCC--EEEEEecCCCcHHHHHHHH
Q psy4056         160 PMGAASLAQVHKATLH--DGS--TIALKVQHRNVRDNANIDI  197 (227)
Q Consensus       160 PiasASIaQVHrA~L~--~G~--~VAVKVq~P~i~~~i~~Dl  197 (227)
                      -+|.+|.|-||||.++  +|+  .||||..+++....+-.|+
T Consensus       117 ~LG~GsFgvV~rg~Wt~psgk~V~VAVKclr~d~l~~~mddf  158 (1039)
T KOG0199|consen  117 LLGEGSFGVVKRGTWTQPSGKHVNVAVKCLRDDSLNAIMDDF  158 (1039)
T ss_pred             HhcCcceeeEeeccccCCCCcEEeEEEEeccCCccchhHHHH
Confidence            4899999999999998  565  8999999999988765554


No 163
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=77.36  E-value=3.5  Score=35.06  Aligned_cols=32  Identities=9%  Similarity=0.256  Sum_probs=26.6

Q ss_pred             cccceeeccceEEEEec----CCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLH----DGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~----~G~~VAVKVq~P~i~  190 (227)
                      +.++.++.|+||+|+++    .+..||+|+.+.+..
T Consensus        11 ~~ig~G~fg~V~~~~~~~~~~~~~~vaik~~~~~~~   46 (266)
T cd05064          11 RILGTGRFGELCRGCLKLPSKRELPVAIHTLRAGCS   46 (266)
T ss_pred             eeecccCCCeEEEEEEecCCCceeeEEEEecCCCCC
Confidence            46999999999999985    467999999887654


No 164
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=77.31  E-value=3.3  Score=36.61  Aligned_cols=30  Identities=20%  Similarity=0.320  Sum_probs=26.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.+|.++.|.||+|..+ +|+.||||+.++.
T Consensus         5 ~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~   35 (324)
T cd05589           5 AVLGRGHFGKVLLAEYKKTGELYAIKALKKG   35 (324)
T ss_pred             EEEeecCCEEEEEEEECCCCCEEEEEEEEHH
Confidence            45899999999999987 7999999998764


No 165
>KOG0193|consensus
Probab=77.30  E-value=1.9  Score=43.07  Aligned_cols=52  Identities=13%  Similarity=0.194  Sum_probs=36.0

Q ss_pred             hhhhccccC-ccccceeeccceEEEEecCCCEEEEEecC-----CCcHHHHHHHHHHHHH
Q psy4056         149 PSEIFASIE-PNPMGAASLAQVHKATLHDGSTIALKVQH-----RNVRDNANIDIKCMEA  202 (227)
Q Consensus       149 ~~~~F~~fd-~~PiasASIaQVHrA~L~~G~~VAVKVq~-----P~i~~~i~~Dl~~l~~  202 (227)
                      |+..+.++. -.+||+||.|-||||.++ | +||||+..     |.-.+.|+.++.+++.
T Consensus       387 WeIp~~ev~l~~rIGsGsFGtV~Rg~wh-G-dVAVK~Lnv~~pt~~qlqaFKnEVa~lkk  444 (678)
T KOG0193|consen  387 WEIPPEEVLLGERIGSGSFGTVYRGRWH-G-DVAVKLLNVDDPTPEQLQAFKNEVAVLKK  444 (678)
T ss_pred             cccCHHHhhccceeccccccceeecccc-c-ceEEEEEecCCCCHHHHHHHHHHHHHHhh
Confidence            333343333 378999999999999995 3 59999763     3445567777777663


No 166
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=77.13  E-value=3.7  Score=37.44  Aligned_cols=46  Identities=22%  Similarity=0.325  Sum_probs=32.4

Q ss_pred             ccccceeeccceEEEEec------CCCEEEEEecCCCcH----HHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH------DGSTIALKVQHRNVR----DNANIDIKCMEAL  203 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~------~G~~VAVKVq~P~i~----~~i~~Dl~~l~~l  203 (227)
                      .+.||.|+.|.||+|+..      ++..||||+.++...    +.+...+.++..+
T Consensus        40 ~~~LG~G~fG~V~~~~~~~~~~~~~~~~vavK~l~~~~~~~~~~~~~~Ei~il~~l   95 (375)
T cd05104          40 GKTLGAGAFGKVVEATAYGLFKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYL   95 (375)
T ss_pred             hheecCCccceEEEEEEeccccCccceeEEEEeccCCcCcHHHHHHHHHHHHHHHh
Confidence            367999999999999742      466899999887543    2344455555443


No 167
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=77.12  E-value=3.9  Score=35.33  Aligned_cols=30  Identities=17%  Similarity=0.305  Sum_probs=25.8

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.++.|+||+|... +|+.||||+....
T Consensus         6 ~~lg~G~~g~V~~~~~~~~~~~vavK~~~~~   36 (285)
T cd05605           6 RVLGKGGFGEVCACQVRATGKMYACKKLEKK   36 (285)
T ss_pred             EEEecCCCeEEEEEEEcCCCceEEEEEEehh
Confidence            45899999999999976 7999999987654


No 168
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=77.03  E-value=4.2  Score=34.96  Aligned_cols=43  Identities=26%  Similarity=0.271  Sum_probs=31.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc-----HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV-----RDNANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-----~~~i~~Dl~~l~  201 (227)
                      +.+++++.|+||+|+.+ +|+.||||+.....     ...+...+.+++
T Consensus        14 ~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~   62 (311)
T cd07866          14 GKLGEGTFGEVYKARQIKTGRVVALKKILMHNEKDGFPITALREIKILK   62 (311)
T ss_pred             EEeccCCCEEEEEEEECCCCcEEEEEEEEeccCCCCcchhHHHHHHHHH
Confidence            56999999999999987 79999999865432     223444555554


No 169
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=76.94  E-value=4  Score=34.53  Aligned_cols=30  Identities=17%  Similarity=0.153  Sum_probs=25.7

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      .+.++.++.|.||+|+.+ +|+.|++|+.+.
T Consensus         7 ~~~lg~g~~g~v~~~~~~~~~~~~~ik~~~~   37 (264)
T cd06653           7 GKLLGRGAFGEVYLCYDADTGRELAVKQVPF   37 (264)
T ss_pred             eeeEccCCCeEEEEEEEcCCCCEEEEEEEec
Confidence            357899999999999986 799999998654


No 170
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=76.90  E-value=4.8  Score=34.10  Aligned_cols=43  Identities=14%  Similarity=0.244  Sum_probs=31.6

Q ss_pred             ccceeeccceEEEEecCCCEEEEEecCCCc--HHHHHHHHHHHHH
Q psy4056         160 PMGAASLAQVHKATLHDGSTIALKVQHRNV--RDNANIDIKCMEA  202 (227)
Q Consensus       160 PiasASIaQVHrA~L~~G~~VAVKVq~P~i--~~~i~~Dl~~l~~  202 (227)
                      .++.++-|.||+|+..++..||||+.++.-  .+.+..++.+++.
T Consensus        13 ~lg~g~~~~v~~~~~~~~~~valK~~~~~~~~~~~~~~E~~~l~~   57 (262)
T cd05071          13 KLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKK   57 (262)
T ss_pred             ecCCCCCCcEEEEEecCCceEEEEecccCccCHHHHHHHHHHHHh
Confidence            489999999999998877789999988632  2344455555543


No 171
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=76.89  E-value=4  Score=34.96  Aligned_cols=44  Identities=23%  Similarity=0.220  Sum_probs=33.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH----HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR----DNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~----~~i~~Dl~~l~~  202 (227)
                      +++++++-|.||+|+.+ +|+.||||...+...    ..+..++.+++.
T Consensus        11 ~~lg~g~~~~vy~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~E~~~l~~   59 (291)
T cd07844          11 DKLGEGSYATVYKGRSKLTGQLVALKEIRLEHEEGAPFTAIREASLLKD   59 (291)
T ss_pred             EEEeecCCeEEEEEEEcCCCcEEEEEEEecccccCCchhHHHHHHHHhh
Confidence            67999999999999987 899999998765432    334445665554


No 172
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=76.87  E-value=3.9  Score=35.06  Aligned_cols=43  Identities=26%  Similarity=0.332  Sum_probs=32.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc----HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV----RDNANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i----~~~i~~Dl~~l~  201 (227)
                      +.++.++.|+||+|... +|+.||+|+...+.    .+.+..++.+++
T Consensus        11 ~~ig~g~~g~v~~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~E~~~l~   58 (284)
T cd06620          11 SDLGAGNGGSVSKVKHIPTGTVMAKKVVHIGAKSSVRKQILRELQIMH   58 (284)
T ss_pred             HHcCCCCCeEEEEEEEcCCCcEEEEEEEEecCcchHHHHHHHHHHHHH
Confidence            45899999999999987 79999999977554    344555555554


No 173
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the 
Probab=76.87  E-value=4.3  Score=33.62  Aligned_cols=29  Identities=24%  Similarity=0.355  Sum_probs=24.9

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      +|.++.|+||+++.. +|+.|++|+.+.+.
T Consensus         1 lg~G~~~~v~~~~~~~~~~~~~~k~~~~~~   30 (250)
T cd05123           1 LGKGSFGKVLLVRKKDTGKLYAMKVLKKKK   30 (250)
T ss_pred             CCCCCceEEEEEEECCCCcEEEEEEeehhh
Confidence            577899999999987 69999999987664


No 174
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=76.71  E-value=4.1  Score=33.89  Aligned_cols=44  Identities=23%  Similarity=0.286  Sum_probs=32.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc-HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV-RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-~~~i~~Dl~~l~~  202 (227)
                      +.++++..|+||+|+.+ +|+.|++|...... .+.+...+.+++.
T Consensus         9 ~~i~~g~~~~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~e~~~~~~   54 (256)
T cd06612           9 EKLGEGSYGSVYKAIHKETGQVVAIKVVPVEEDLQEIIKEISILKQ   54 (256)
T ss_pred             hhhcCCCCeEEEEEEEcCCCcEEEEEEeecHHHHHHHHHHHHHHHh
Confidence            45899999999999998 48999999887653 3344444444443


No 175
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=76.61  E-value=4  Score=34.63  Aligned_cols=43  Identities=9%  Similarity=0.204  Sum_probs=31.0

Q ss_pred             cccceeeccceEEEEecC------CCEEEEEecCCCcHH----HHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHD------GSTIALKVQHRNVRD----NANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~------G~~VAVKVq~P~i~~----~i~~Dl~~l~  201 (227)
                      +.++.++.|+||+|+.++      ++.||||+.......    .+...+.+++
T Consensus        11 ~~lg~g~~~~v~~~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~e~~~l~   63 (280)
T cd05049          11 RELGEGAFGKVFLGECYHLEPENDKELVAVKTLKETASNDARKDFEREAELLT   63 (280)
T ss_pred             hhccccCCceEeeeeeccccCcCCcceEEEEeecccCCHHHHHHHHHHHHHHH
Confidence            568999999999999864      478999998765443    4444444444


No 176
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=76.52  E-value=4.4  Score=36.01  Aligned_cols=29  Identities=28%  Similarity=0.334  Sum_probs=25.7

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+|.++.|.||+|+.+ +|+.||||+.++.
T Consensus         2 ~lG~G~~g~V~~~~~~~~~~~~aiK~i~~~   31 (329)
T cd05588           2 VIGRGSYAKVLLVELKKTRRIYAMKVIKKE   31 (329)
T ss_pred             eEeeCCCeEEEEEEECCCCCEEEEEEEEHH
Confidence            4789999999999987 7899999998764


No 177
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=76.48  E-value=4.9  Score=35.78  Aligned_cols=30  Identities=27%  Similarity=0.348  Sum_probs=26.2

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      .+|.|+.|+||+|+.+ +|+.||+|+.....
T Consensus         2 ~lG~G~~g~V~~~~~~~~~~~~aiK~~~~~~   32 (329)
T cd05618           2 VIGRGSYAKVLLVRLKKTERIYAMKVVKKEL   32 (329)
T ss_pred             eeeeCCCeEEEEEEECCCCCEEEEEEEEhhH
Confidence            5899999999999987 78999999987653


No 178
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=76.39  E-value=3.4  Score=34.87  Aligned_cols=32  Identities=19%  Similarity=0.321  Sum_probs=26.8

Q ss_pred             cccceeeccceEEEEec----CCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLH----DGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~----~G~~VAVKVq~P~i~  190 (227)
                      +.++.++-|.||+|.++    +|+.||||+...++.
T Consensus         5 ~~ig~g~~g~v~~~~~~~~~~~~~~~aiK~~~~~~~   40 (273)
T cd05074           5 RMLGKGEFGSVREAQLKSEDGSFQKVAVKMLKADIF   40 (273)
T ss_pred             hcccCCCCCCEEeeEeeccCCCceEEEEEEeccccC
Confidence            46899999999999976    468999999887653


No 179
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=76.36  E-value=3.9  Score=34.44  Aligned_cols=29  Identities=28%  Similarity=0.367  Sum_probs=25.0

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.++.++.|.||+|+.+ +|+.||||+..+
T Consensus         8 ~~l~~g~~~~v~~~~~~~~~~~~~iK~~~~   37 (267)
T cd08228           8 KKIGRGQFSEVYRATCLLDRKPVALKKVQI   37 (267)
T ss_pred             eeeccCCCeeEEEEEEeCCCCEEEEEEeec
Confidence            46899999999999987 899999997653


No 180
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=76.34  E-value=4.9  Score=35.58  Aligned_cols=29  Identities=21%  Similarity=0.370  Sum_probs=24.6

Q ss_pred             cccceeeccceEEEEec----CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH----DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~----~G~~VAVKVq~P  187 (227)
                      +.+|.|+.|.||+++..    +|+.||||+...
T Consensus         2 ~~lg~G~~g~V~~~~~~~~~~~~~~~avK~~~~   34 (323)
T cd05584           2 KVLGKGGYGKVFQVRKVTGADTGKIFAMKVLKK   34 (323)
T ss_pred             ceeeecCCeEEEEEEEcccCCCCCEEEEEEEEH
Confidence            46899999999999863    688999998764


No 181
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=76.32  E-value=5.3  Score=33.51  Aligned_cols=45  Identities=18%  Similarity=0.280  Sum_probs=33.0

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCc--HHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNV--RDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i--~~~i~~Dl~~l~~l  203 (227)
                      +.++.+..|.||+|+.+++..||+|...++-  .+.+...+.+++.+
T Consensus        10 ~~lg~G~~~~vy~~~~~~~~~~a~K~~~~~~~~~~~~~~e~~~l~~l   56 (256)
T cd05114          10 KELGSGQFGVVHLGKWRAQIKVAIKAINEGAMSEEDFIEEAKVMMKL   56 (256)
T ss_pred             eEecCCcCceEEEEEeccCceEEEEecccCCccHHHHHHHHHHHHHC
Confidence            4599999999999999999999999866542  23444455555443


No 182
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=76.18  E-value=4.7  Score=34.65  Aligned_cols=29  Identities=24%  Similarity=0.293  Sum_probs=25.3

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      ...++.++.|+||+|+.+ +|+.||||+..
T Consensus        17 ~~~lg~g~~~~v~~~~~~~~~~~~aik~~~   46 (310)
T cd07865          17 LAKIGQGTFGEVFKARHKKTKQIVALKKVL   46 (310)
T ss_pred             EEEeecCCCEEEEEEEECCCCcEEEEEEEe
Confidence            356999999999999987 79999999764


No 183
>KOG0583|consensus
Probab=76.10  E-value=4.4  Score=37.78  Aligned_cols=47  Identities=21%  Similarity=0.382  Sum_probs=36.7

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCC--------CcHHHHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHR--------NVRDNANIDIKCMEALV  204 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P--------~i~~~i~~Dl~~l~~l~  204 (227)
                      ...+|++|.|-|+.|+-. +|+.|||||...        ++.+.+..++.+++.+-
T Consensus        22 ~~~lG~GsfgkV~~a~~~~t~~~vAiKii~~~~~~~~~~~~~~~i~rEi~~~~~~~   77 (370)
T KOG0583|consen   22 GRTLGSGSFGKVKLAKHRLTGEKVAIKIIDRKKVSSKSQKLDELIKREISILRRLR   77 (370)
T ss_pred             eeeecCCCCeeEEEeeeccCCCeEEEEEechhcccccccccchhhHHHHHHHHHhc
Confidence            357999999999999776 899999998655        45667777776665543


No 184
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=75.94  E-value=5.3  Score=35.04  Aligned_cols=33  Identities=18%  Similarity=0.303  Sum_probs=26.2

Q ss_pred             ccccceeeccceEEEEec-CCC----EEEEEecCCCcH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGS----TIALKVQHRNVR  190 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~----~VAVKVq~P~i~  190 (227)
                      .+.+|+++.|+||+|+.+ +|+    +||||+..+...
T Consensus        12 ~~~lg~G~~g~Vy~~~~~~~~~~~~~~vaiK~~~~~~~   49 (316)
T cd05108          12 IKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATS   49 (316)
T ss_pred             eeeeecCCCceEEEEEEecCCCccceeEEEEeccccCC
Confidence            367999999999999976 454    499999876543


No 185
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=75.83  E-value=3.8  Score=37.20  Aligned_cols=29  Identities=17%  Similarity=0.249  Sum_probs=25.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.+|.|+.|+||+|+.+ +|+.||||+...
T Consensus         7 ~~LG~G~~g~Vy~a~~~~~~~~~aiK~i~~   36 (382)
T cd05625           7 KTLGIGAFGEVCLARKVDTKALYAMKTLRK   36 (382)
T ss_pred             EEEEeCCCEEEEEEEECCCCCEEEEEEEeH
Confidence            46999999999999986 789999998764


No 186
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=75.72  E-value=4.8  Score=35.90  Aligned_cols=44  Identities=23%  Similarity=0.177  Sum_probs=32.0

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC---cHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN---VRDNANIDIKCME  201 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~---i~~~i~~Dl~~l~  201 (227)
                      .++++.++.|.||+|+.+ +|+.||+|+....   ..+.+...+.+++
T Consensus        10 ~~~Lg~g~~g~vy~~~~~~~~~~v~iK~i~~~~~~~~~~~~~Ei~~l~   57 (342)
T cd07854          10 LRPLGCGSNGLVFSAVDSDCDKRVAVKKIVLTDPQSVKHALREIKIIR   57 (342)
T ss_pred             EEEecCCCCEEEEEEEECCCCcEEEEEEEecCCCchHHHHHHHHHHHH
Confidence            468999999999999986 7999999976432   2334444555554


No 187
>PF04655 APH_6_hur:  Aminoglycoside/hydroxyurea antibiotic resistance kinase;  InterPro: IPR006748 The aminoglycosides are a large group of biologically active bacterial secondary metabolites, best known for their antibiotic properties []. Aminoglycoside phosphotransferases achieve inactivation of these enzymes by phosphorylation, utilising ATP. Likewise, hydroxyurea is inactivated by phosphorylation of the hydroxy group in the hydroxylamine moiety.; GO: 0016773 phosphotransferase activity, alcohol group as acceptor, 0006468 protein phosphorylation, 0019748 secondary metabolic process
Probab=75.69  E-value=3  Score=37.08  Aligned_cols=32  Identities=22%  Similarity=0.250  Sum_probs=29.0

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~  190 (227)
                      .|+..++-+.|++++..||+++++|+..|+-+
T Consensus         8 ~~~~~g~~s~V~pv~~~dG~~avLKl~~p~~~   39 (253)
T PF04655_consen    8 GPPAHGSSSLVVPVRRADGTPAVLKLAPPHAE   39 (253)
T ss_pred             CCCCCCcceEEEEEEcCCCCeEEEEecCCccc
Confidence            46788999999999999999999999998765


No 188
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=75.33  E-value=7  Score=33.00  Aligned_cols=34  Identities=18%  Similarity=0.046  Sum_probs=28.2

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCCcHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRNVRD  191 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~  191 (227)
                      ...++.++-|.||+|+.+ +|+.|+||.......+
T Consensus        13 ~~~lg~g~~g~v~~~~~~~~~~~v~~k~~~~~~~~   47 (268)
T cd06624          13 RVVLGKGTYGIVYAARDLSTQVRIAIKEIPERDSR   47 (268)
T ss_pred             eEEEecCCceEEEEeEecCCCcEEEEEEecCCCHH
Confidence            357999999999999976 7889999988776544


No 189
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=75.32  E-value=5.7  Score=34.04  Aligned_cols=43  Identities=14%  Similarity=0.221  Sum_probs=31.4

Q ss_pred             cccceeeccceEEEEec------CCCEEEEEecCCCcHH----HHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH------DGSTIALKVQHRNVRD----NANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~------~G~~VAVKVq~P~i~~----~i~~Dl~~l~  201 (227)
                      ..++.++.|+||+|+.+      ++..||+|+.+.+...    .+..++.+++
T Consensus        11 ~~lg~g~~g~v~~~~~~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~ei~~l~   63 (288)
T cd05050          11 RDIGQGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMA   63 (288)
T ss_pred             ccccccccccEEEEEEcccCCCCcceeEEEEecCCCcCHHHHHHHHHHHHHHH
Confidence            56899999999999974      4689999998876533    3444444444


No 190
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=75.22  E-value=4.8  Score=36.05  Aligned_cols=29  Identities=24%  Similarity=0.324  Sum_probs=25.5

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      .++++.++.|.||+|+-+ +|+.||||+..
T Consensus        21 ~~~lg~g~~g~V~~~~~~~~~~~vaiK~~~   50 (353)
T cd07850          21 LKPIGSGAQGIVCAAYDTVTGQNVAIKKLS   50 (353)
T ss_pred             EEEeccCCCEEEEEEEECCCCCEEEEEecC
Confidence            367999999999999986 89999999864


No 191
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=75.06  E-value=5  Score=33.90  Aligned_cols=43  Identities=16%  Similarity=0.225  Sum_probs=30.9

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCc--HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNV--RDNANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i--~~~i~~Dl~~l~  201 (227)
                      +.+++++.|.||.|..+++.+||||...++-  .+.+..++.+++
T Consensus        10 ~~lg~G~~~~vy~~~~~~~~~~aik~~~~~~~~~~~~~~e~~~l~   54 (256)
T cd05113          10 KELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMM   54 (256)
T ss_pred             eEecCcccceEEEEEecCCCcEEEEEcCCCcccHHHHHHHHHHHh
Confidence            4589999999999998888889999776543  223444444443


No 192
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=74.80  E-value=5.1  Score=35.73  Aligned_cols=44  Identities=18%  Similarity=0.304  Sum_probs=33.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcHH----HHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRD----NANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~----~i~~Dl~~l~~  202 (227)
                      +.++.++.|+||+|+.+ +|+.||+|+.+.....    .+..++.+++.
T Consensus        11 ~~lg~g~~g~V~~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~E~~~l~~   59 (333)
T cd06650          11 SELGAGNGGVVFKVSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHE   59 (333)
T ss_pred             ccccCCCCEEEEEEEECCCCcEEEEEEeecccCHHHHHHHHHHHHHHHH
Confidence            46899999999999988 7899999998876543    34445555443


No 193
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=74.70  E-value=4.8  Score=33.73  Aligned_cols=29  Identities=14%  Similarity=0.243  Sum_probs=25.8

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      ++++.++.+.||+|+.. +|++|++|+...
T Consensus         6 ~~i~~g~~~~v~~~~~~~~~~~~~ik~~~~   35 (258)
T cd05578           6 RVIGKGAFGKVCIVQKRDTKKMFAMKYMNK   35 (258)
T ss_pred             EEeccCCCceEEEEEEccCCcEEEEEEEeh
Confidence            57899999999999987 699999998864


No 194
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=74.33  E-value=4.3  Score=36.74  Aligned_cols=29  Identities=17%  Similarity=0.312  Sum_probs=25.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.+|.++.|.||+|+-+ +|+.||||+...
T Consensus         7 ~~lG~G~~g~Vy~~~~~~~~~~~aiK~~~~   36 (377)
T cd05629           7 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLK   36 (377)
T ss_pred             EEEeecCCEEEEEEEECCCCCEEEEEEEEH
Confidence            56899999999999886 899999998754


No 195
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=74.16  E-value=6.8  Score=34.83  Aligned_cols=30  Identities=20%  Similarity=0.352  Sum_probs=26.1

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      .+|.++.|+||+|.-+ +|+.||||+..+..
T Consensus         2 ~lG~G~~g~Vy~~~~~~~~~~~avK~~~~~~   32 (328)
T cd05593           2 LLGKGTFGKVILVREKASGKYYAMKILKKEV   32 (328)
T ss_pred             eeeeCCCEEEEEEEECCCCCEEEEEEEEHHH
Confidence            4789999999999976 79999999987653


No 196
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=73.97  E-value=5.8  Score=33.49  Aligned_cols=44  Identities=23%  Similarity=0.259  Sum_probs=33.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc-----HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV-----RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-----~~~i~~Dl~~l~~  202 (227)
                      +.++++..|.||+|+.. +|++|++|+.++..     .+.+..++.+++.
T Consensus         5 ~~ig~g~~~~vy~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~~e~~~l~~   54 (282)
T cd07829           5 EKLGEGTYGVVYKARDKKTGEIVALKKIRLDNEEEGIPSTALREISLLKE   54 (282)
T ss_pred             hcccccCcceEEEeeecCCCcEEEEEEeccccccccccHHHHHHHHHHHh
Confidence            45888999999999998 69999999998753     3344555555553


No 197
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=73.90  E-value=5.6  Score=33.42  Aligned_cols=28  Identities=21%  Similarity=0.413  Sum_probs=23.6

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ++.++.|.||+|+.. +|+.|+||+..+.
T Consensus         1 lg~g~~~~v~~~~~~~~~~~~~iK~~~~~   29 (262)
T cd05572           1 LGVGGFGRVELVKVKSKNRTFALKCVKKR   29 (262)
T ss_pred             CCCCCceEEEEEEECCCCcEEEEEEEehh
Confidence            467888999999997 5999999998653


No 198
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=73.84  E-value=6.1  Score=33.49  Aligned_cols=30  Identities=27%  Similarity=0.323  Sum_probs=25.8

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ..++++..|+||+|+.. +|+.|++|+..-.
T Consensus         7 ~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~   37 (274)
T cd06609           7 ECIGKGSFGEVYKAIDKRTNQVVAIKVIDLE   37 (274)
T ss_pred             hhhcCCCCeEEEEEEECCCCeEEEEEEeecc
Confidence            46899999999999987 7999999987543


No 199
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=73.70  E-value=6.1  Score=33.77  Aligned_cols=31  Identities=19%  Similarity=0.349  Sum_probs=25.2

Q ss_pred             cccceeeccceEEEEec-----CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-----DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-----~G~~VAVKVq~P~i  189 (227)
                      +.++.++.|+|+.++.+     +|+.||+|+.+.+.
T Consensus        10 ~~lg~g~~g~v~~~~~~~~~~~~~~~vaiK~~~~~~   45 (283)
T cd05080          10 RVLGEGHFGKVSLYCYDPANDGTGEMVAVKTLKREC   45 (283)
T ss_pred             eecccCCCcEEEEeeEccccCCCCceEEEEEecccc
Confidence            45899999999887642     78899999988764


No 200
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=73.59  E-value=8.7  Score=32.70  Aligned_cols=34  Identities=26%  Similarity=0.438  Sum_probs=26.6

Q ss_pred             cccceeeccceEEEEec-CCC----EEEEEecCCCcHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGS----TIALKVQHRNVRDN  192 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~----~VAVKVq~P~i~~~  192 (227)
                      +.++.++-|.||+|+.. +|+    +||||+........
T Consensus        13 ~~lg~G~~g~vy~~~~~~~~~~~~~~va~K~~~~~~~~~   51 (279)
T cd05109          13 KVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPK   51 (279)
T ss_pred             eecCCCCCceEEEEEEecCCCccceEEEEEEecCCCCHH
Confidence            57999999999999865 666    58999976554443


No 201
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=73.58  E-value=3.2  Score=36.70  Aligned_cols=27  Identities=22%  Similarity=0.337  Sum_probs=23.5

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +|.++.|.||+|+.+ +|+.||||+...
T Consensus         1 lG~G~~g~Vy~~~~~~~~~~~avK~~~~   28 (330)
T cd05586           1 IGKGTFGQVYQVRKKDTRRIYAMKVLSK   28 (330)
T ss_pred             CCCCCceEEEEEEECCCCCEEEEEEEeH
Confidence            578999999999987 799999998753


No 202
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=73.52  E-value=5.6  Score=37.06  Aligned_cols=33  Identities=18%  Similarity=0.271  Sum_probs=26.8

Q ss_pred             cccceeeccceEEEEec------CCCEEEEEecCCCcHH
Q psy4056         159 NPMGAASLAQVHKATLH------DGSTIALKVQHRNVRD  191 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~------~G~~VAVKVq~P~i~~  191 (227)
                      +.||+++.|.||+|+..      .+..||||+.++....
T Consensus        43 ~~LG~G~fG~Vy~~~~~~~~~~~~~~~vavK~l~~~~~~   81 (400)
T cd05105          43 RILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARS   81 (400)
T ss_pred             heecCCCCceEEEEEEcccCCCCCceEEEEEecCCCCCh
Confidence            57999999999999863      2457999999887653


No 203
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=73.42  E-value=6  Score=33.98  Aligned_cols=27  Identities=19%  Similarity=0.342  Sum_probs=23.5

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      ++.++.|+||+++.+ +|+.||+|+...
T Consensus         1 lg~G~~g~Vy~~~~~~~~~~~a~K~~~~   28 (277)
T cd05607           1 LGKGGFGEVCAVQVKNTGKMYACKKLDK   28 (277)
T ss_pred             CCCCCceEEEEEEEccCCcEEEEEEEcH
Confidence            578899999999987 799999998754


No 204
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=73.30  E-value=8  Score=32.71  Aligned_cols=33  Identities=18%  Similarity=0.333  Sum_probs=26.6

Q ss_pred             cceeeccceEEEEec---CCCEEEEEecCCCcHHHH
Q psy4056         161 MGAASLAQVHKATLH---DGSTIALKVQHRNVRDNA  193 (227)
Q Consensus       161 iasASIaQVHrA~L~---~G~~VAVKVq~P~i~~~i  193 (227)
                      +|.++.|.||+|+++   +|..||||+..+......
T Consensus         3 ig~G~~g~v~~~~~~~~~~~~~vavk~~~~~~~~~~   38 (257)
T cd05115           3 LGSGNFGCVKKGVYKMRKKQIDVAIKVLKNENEKSV   38 (257)
T ss_pred             cCCCCcccEEEEEEecCCCceeEEEEEcccccChHH
Confidence            789999999999875   456899999988765433


No 205
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=73.25  E-value=6.1  Score=34.87  Aligned_cols=30  Identities=20%  Similarity=0.314  Sum_probs=25.1

Q ss_pred             cccceeeccceEEEEec----CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH----DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~----~G~~VAVKVq~P~  188 (227)
                      +.+|.|+.|.||+++..    +|+.||+|+....
T Consensus         6 ~~lg~G~~g~Vy~~~~~~~~~~~~~~aiK~~~~~   39 (332)
T cd05614           6 KVLGTGAYGKVFLVRKVTGHDTGKLYAMKVLQKA   39 (332)
T ss_pred             EEEeecCCEEEEEEEEcccCCCCCEEEEEEEEHH
Confidence            46899999999999864    6899999998653


No 206
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=73.18  E-value=4.1  Score=40.69  Aligned_cols=30  Identities=17%  Similarity=0.304  Sum_probs=26.8

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.|+.++.|.||+|+.. +|+.||||+.+..
T Consensus        10 ~~LG~G~fg~Vy~a~~~~~~~~vAiKvi~~~   40 (669)
T cd05610          10 KPISRGAFGKVYLGRKKNNSKLYAVKVVKKA   40 (669)
T ss_pred             EEEecCCCeEEEEEEECCCCcEEEEEEEehh
Confidence            57999999999999998 7999999998753


No 207
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=72.89  E-value=6.1  Score=35.01  Aligned_cols=30  Identities=23%  Similarity=0.259  Sum_probs=26.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.++-|.||+|+-+ +|++||||+..|.
T Consensus        11 ~~lg~G~~g~vy~~~~~~~~~~vaiK~~~~~   41 (336)
T cd07849          11 SYIGEGAYGMVCSATHKPTGVKVAIKKISPF   41 (336)
T ss_pred             EEEEecCCeEEEEEEEcCCCCeEEEEEeccc
Confidence            56899999999999876 8999999988753


No 208
>PF01636 APH:  Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily.;  InterPro: IPR002575 This entry consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include:- aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation []. The proteins are found in a range of taxonomic groups.; PDB: 2PPQ_A 2Q83_B 3TDV_B 3TDW_A 3I0O_A 3I0Q_A 3I1A_B 3Q2M_A 3HAV_C 2PUI_B ....
Probab=72.84  E-value=8.8  Score=31.23  Aligned_cols=46  Identities=15%  Similarity=0.226  Sum_probs=36.2

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCC-cHHHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRN-VRDNANIDIKCMEALVH  205 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~-i~~~i~~Dl~~l~~l~~  205 (227)
                      +|+++|.-++||+.+..+ +++++|+-+|. ....+.....+++.+..
T Consensus         3 ~~l~~G~~n~~~~v~~~~-~~~vlK~~~~~~~~~~~~~e~~~~~~l~~   49 (239)
T PF01636_consen    3 RPLSGGFSNRVYRVTTDD-GRYVLKFYRPPDAAERLRREAAVLRQLAE   49 (239)
T ss_dssp             EEEEESSSSEEEEEEETT-SEEEEEEESSHHHHHHHHHHHHHHHHHHH
T ss_pred             ccCCCCCeeeEEEEEECC-cEEEEEEeCCCCCHHHHHHHHHHHHHHHh
Confidence            589999999999999866 69999998887 55566666666655543


No 209
>PHA03209 serine/threonine kinase US3; Provisional
Probab=72.83  E-value=4.8  Score=36.37  Aligned_cols=30  Identities=20%  Similarity=0.277  Sum_probs=25.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ..++.++.|+||+|+.+ +++.||+|+...+
T Consensus        72 ~~lg~G~~g~Vy~~~~~~~~~~valK~~~~~  102 (357)
T PHA03209         72 KTLTPGSEGRVFVATKPGQPDPVVLKIGQKG  102 (357)
T ss_pred             EEecCCCCeEEEEEEECCCCceEEEEeCCcc
Confidence            57999999999999987 6789999986554


No 210
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=72.81  E-value=6  Score=33.23  Aligned_cols=31  Identities=19%  Similarity=0.361  Sum_probs=25.4

Q ss_pred             cccceeeccceEEEEec-C---CCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-D---GSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~---G~~VAVKVq~P~i  189 (227)
                      +.+|.++.|+||+|++. +   +..||||+.+.+.
T Consensus         5 ~~lg~G~~g~v~~~~~~~~~~~~~~vaiK~~~~~~   39 (273)
T cd05035           5 KILGEGEFGSVMEGQLSQDDGSQLKVAVKTMKLDI   39 (273)
T ss_pred             cccCcCCCceEEEEEEecCCCCcceEEEEEeccCc
Confidence            46899999999999987 3   3689999887643


No 211
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=72.73  E-value=6.4  Score=34.86  Aligned_cols=30  Identities=20%  Similarity=0.278  Sum_probs=26.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.++.|+||+|+.+ +|++||+|+.+..
T Consensus        11 ~~lg~g~~g~v~~~~~~~~~~~valK~~~~~   41 (334)
T cd07855          11 ENIGSGAYGVVCSAIDTRSGKKVAIKKIPHA   41 (334)
T ss_pred             eeeecCCCeEEEEEEEcCCCCEEEEEEeccc
Confidence            56999999999999987 7999999987764


No 212
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=72.54  E-value=5.7  Score=34.30  Aligned_cols=31  Identities=16%  Similarity=0.274  Sum_probs=26.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      +.++.++.|+||+|..+ +|+.||||...+..
T Consensus         6 ~~ig~G~~g~v~~~~~~~~~~~~avK~~~~~~   37 (285)
T cd05630           6 RVLGKGGFGEVCACQVRATGKMYACKKLEKKR   37 (285)
T ss_pred             EEeecCCCeEEEEEEEcCCCceEEEEEEehhh
Confidence            45899999999999987 79999999876653


No 213
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=72.37  E-value=7  Score=34.74  Aligned_cols=31  Identities=19%  Similarity=0.258  Sum_probs=27.0

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ..+++.++.|.||+|+-. +|+.||||..++.
T Consensus        10 ~~~lg~G~~~~vy~~~~~~~~~~vaiK~~~~~   41 (337)
T cd07858          10 IKPIGRGAYGIVCSAKNSETNEKVAIKKIANA   41 (337)
T ss_pred             EEEeccCCCeEEEEEEecCCCCeEEEEEeccc
Confidence            358999999999999976 7999999988764


No 214
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=72.30  E-value=7.1  Score=32.97  Aligned_cols=44  Identities=23%  Similarity=0.280  Sum_probs=32.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcHH-----HHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRD-----NANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~-----~i~~Dl~~l~~  202 (227)
                      ..++.++.|.||+|... +|+.|++|...+....     .+...+.+++.
T Consensus         5 ~~i~~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~   54 (283)
T cd05118           5 GKIGEGTYGVVYKARDKLTGEIVAIKKIKLRFESEGIPKTALREIKLLKE   54 (283)
T ss_pred             eeeecCCCceEEEEEcCCCCcEEEEEEeccccccchhHHHHHHHHHHHHH
Confidence            46899999999999986 8999999987665433     44444444443


No 215
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=72.25  E-value=5.6  Score=34.94  Aligned_cols=27  Identities=22%  Similarity=0.321  Sum_probs=23.4

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +|.++.|.||+|+.+ +|+.||||+..+
T Consensus         1 lg~G~~g~Vy~~~~~~~~~~~aiK~i~~   28 (312)
T cd05585           1 IGKGSFGKVMQVRKRDTQRIYALKTIRK   28 (312)
T ss_pred             CCcCCCeEEEEEEECCCCCEEEEEEEEH
Confidence            578899999999987 689999998764


No 216
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=72.22  E-value=6  Score=34.16  Aligned_cols=31  Identities=26%  Similarity=0.401  Sum_probs=27.0

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+.+++++.|+||+|+.+ +|+.||||+....
T Consensus        20 ~~~lg~g~~~~v~~~~~~~~~~~~avK~~~~~   51 (296)
T cd06618          20 LGEIGSGTCGQVYKMRFKKTGHVMAVKQMRRT   51 (296)
T ss_pred             eeEeeccCCeEEEEEEECCCCeEEEEEEEecc
Confidence            467999999999999997 4999999998753


No 217
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=72.14  E-value=5.3  Score=33.48  Aligned_cols=41  Identities=17%  Similarity=0.242  Sum_probs=29.9

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcH-HHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVR-DNANIDIKCM  200 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~-~~i~~Dl~~l  200 (227)
                      +.++.++.|+||++.. +|+.||+|+.+.... +.+..++.++
T Consensus        12 ~~lg~g~~g~v~~~~~-~~~~~~iK~~~~~~~~~~~~~e~~~l   53 (254)
T cd05083          12 EIIGEGEFGAVLQGEY-TGQKVAVKNIKCDVTAQAFLEETAVM   53 (254)
T ss_pred             eeeccCCCCceEeccc-CCCceEEEeecCcchHHHHHHHHHHH
Confidence            5789999999999985 899999998876533 2334444443


No 218
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=71.88  E-value=6.4  Score=33.21  Aligned_cols=38  Identities=16%  Similarity=0.296  Sum_probs=29.7

Q ss_pred             ccccceeeccceEEEEecC----CCEEEEEecCCCcHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLHD----GSTIALKVQHRNVRDNANI  195 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~~----G~~VAVKVq~P~i~~~i~~  195 (227)
                      .+.++.++.|.||+|+.+.    ...||||+.+++.......
T Consensus         9 ~~~lg~g~~g~vy~~~~~~~~~~~~~vaik~~~~~~~~~~~~   50 (266)
T cd05033           9 EKVIGGGEFGEVCRGRLKLPGKKEIDVAIKTLKAGSSDKQRL   50 (266)
T ss_pred             eeEecCCccceEEEEEEccCCCCcceEEEEEcCCCCChHHHH
Confidence            4679999999999999862    3589999998876554433


No 219
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=71.77  E-value=5.8  Score=34.18  Aligned_cols=30  Identities=23%  Similarity=0.380  Sum_probs=26.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.+..|.||+|... +|+.||||+.++.
T Consensus         7 ~~ig~g~~~~vy~~~~~~~~~~~aiK~~~~~   37 (290)
T cd05580           7 KTLGTGSFGRVMLVRHKGSGKYYALKILSKA   37 (290)
T ss_pred             EEeecCCCeEEEEEEEcCCCCEEEEEEEEHH
Confidence            56899999999999987 7899999988653


No 220
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=71.72  E-value=4.9  Score=35.50  Aligned_cols=30  Identities=20%  Similarity=0.358  Sum_probs=26.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.++.|.||+|+.+ +|+.||||+.+..
T Consensus         7 ~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~   37 (330)
T cd05601           7 SLVGRGHFGEVQVVREKATGDIYAMKVMKKS   37 (330)
T ss_pred             EEEEeccCEEEEEEEECCCCCEEEEEEEEHH
Confidence            56999999999999987 8999999998754


No 221
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=71.70  E-value=6.5  Score=33.79  Aligned_cols=43  Identities=19%  Similarity=0.247  Sum_probs=32.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH----HHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR----DNANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~----~~i~~Dl~~l~  201 (227)
                      +.++.++-|.||++..+ +++.||+|+..+...    ..+..++.+++
T Consensus         7 ~~lg~g~~~~v~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~e~~~l~   54 (287)
T cd06621           7 SRLGEGAGGSVTKCRLKNTGMIFALKTITTDPNPDLQKQILRELEINK   54 (287)
T ss_pred             EEeccCCceEEEEEEECCCCeEEEEEEEecCCchHHHHHHHHHHHHHH
Confidence            67899999999999997 789999998876533    34445555444


No 222
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=71.55  E-value=3.9  Score=35.26  Aligned_cols=30  Identities=17%  Similarity=0.253  Sum_probs=25.7

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      .+++++.|.||+|+.. +|+.||||+.++..
T Consensus         1 ~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~~   31 (279)
T cd05633           1 IIGRGGFGEVYGCRKADTGKMYAMKCLDKKR   31 (279)
T ss_pred             CcccCCCeEEEEEEECCCCcEEEEEEEEccc
Confidence            3788999999999986 79999999987653


No 223
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=71.43  E-value=3.2  Score=36.70  Aligned_cols=31  Identities=23%  Similarity=0.319  Sum_probs=26.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      ..+|.++.|.||+|+.+ +|+.||||+..+..
T Consensus         6 ~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~~~   37 (323)
T cd05616           6 MVLGKGSFGKVMLAERKGTDELYAIKILKKDV   37 (323)
T ss_pred             EEEeeCCCeEEEEEEECCCCCEEEEEEEEHHH
Confidence            46899999999999987 68899999987654


No 224
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=71.36  E-value=7  Score=33.41  Aligned_cols=31  Identities=23%  Similarity=0.381  Sum_probs=26.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      ..++.++.|.||+++.. +|+.||||......
T Consensus        10 ~~lg~G~~g~vy~~~~~~~~~~~aiK~~~~~~   41 (288)
T cd06616          10 GEIGRGAFGTVNKMLHKPSGTIMAVKRIRSTV   41 (288)
T ss_pred             HHhCCCCceEEEEEEECCCCCEEEEEEehhcc
Confidence            46899999999999986 78999999877543


No 225
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=71.35  E-value=7.4  Score=34.01  Aligned_cols=39  Identities=23%  Similarity=0.344  Sum_probs=30.5

Q ss_pred             CChhhhccccCccccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         147 KDPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       147 ~~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      ...++.|..  ...++.++.|+||+|+.+ +|+.|+||....
T Consensus        11 ~~~~~~~~~--~~~lg~g~~g~v~~~~~~~~~~~~~ik~~~~   50 (308)
T cd06634          11 DDPEKLFSD--LREIGHGSFGAVYFARDVRNSEVVAIKKMSY   50 (308)
T ss_pred             CCcHHHHHH--HHheeeCCCEEEEEEEEcCCCcEEEEEEEec
Confidence            445555654  356999999999999987 789999998754


No 226
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=70.93  E-value=8.5  Score=37.87  Aligned_cols=31  Identities=23%  Similarity=0.265  Sum_probs=26.7

Q ss_pred             ccccceeeccceEEEEec-C----CCEEEEEecCCC
Q psy4056         158 PNPMGAASLAQVHKATLH-D----GSTIALKVQHRN  188 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~----G~~VAVKVq~P~  188 (227)
                      .+.||.|+.|+||+|++. +    |+.||||.....
T Consensus       137 ~~~LG~G~FG~VYka~~~~~~~~~~~~vAvK~~~~~  172 (566)
T PLN03225        137 GKKLGEGAFGVVYKASLVNKQSKKEGKYVLKKATEY  172 (566)
T ss_pred             eEEEeeCCCeEEEEEEEcCCccccCcEEEEEEeccc
Confidence            468999999999999997 5    799999986653


No 227
>PRK10345 hypothetical protein; Provisional
Probab=70.78  E-value=7  Score=33.50  Aligned_cols=46  Identities=15%  Similarity=0.244  Sum_probs=35.8

Q ss_pred             CccccceeeccceEEEEecCCCEEEEEecCCC---cHHHHHHHHHHHHHHH
Q psy4056         157 EPNPMGAASLAQVHKATLHDGSTIALKVQHRN---VRDNANIDIKCMEALV  204 (227)
Q Consensus       157 d~~PiasASIaQVHrA~L~~G~~VAVKVq~P~---i~~~i~~Dl~~l~~l~  204 (227)
                      +.++||+||-+.||. --.++.. +|||.+++   -.+.+..++..++.+.
T Consensus         6 ~~~~LG~G~~~~Vy~-hp~~~~k-~IKv~~~~~~~~~~~~~rEi~~l~~L~   54 (210)
T PRK10345          6 EQSPLGTGRHRKCYA-HPEDAQR-CIKIVYHRGDGGDKEIRRELKYYAHLS   54 (210)
T ss_pred             CcceecCCCceEEEE-CCCCcCe-EEEEEeccccchHHHHHHHHHHHHHhh
Confidence            457899999999996 3336666 69999886   6677888888887764


No 228
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=70.63  E-value=8.4  Score=32.54  Aligned_cols=31  Identities=16%  Similarity=0.154  Sum_probs=26.4

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+.++.++.|+||+|... +|+.|++|+....
T Consensus         7 ~~~lg~g~~g~vy~~~~~~~~~~~~~k~~~~~   38 (266)
T cd06651           7 GKLLGQGAFGRVYLCYDVDTGRELAAKQVQFD   38 (266)
T ss_pred             cceecCCCCEEEEEEEEcCCCcEEEEEEeecC
Confidence            467999999999999886 6999999987643


No 229
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=70.11  E-value=9.1  Score=31.98  Aligned_cols=44  Identities=14%  Similarity=0.226  Sum_probs=32.8

Q ss_pred             ccccceeeccceEEEEecCCCEEEEEecCCCcH--HHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLHDGSTIALKVQHRNVR--DNANIDIKCMEA  202 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~--~~i~~Dl~~l~~  202 (227)
                      .+.+++++-|.||+|+. .|+.||||.......  +.+..++.+++.
T Consensus        11 ~~~ig~g~~g~v~~~~~-~~~~v~iK~~~~~~~~~~~~~~e~~~l~~   56 (256)
T cd05039          11 GATIGKGEFGDVMLGDY-RGQKVAVKCLKDDSTAAQAFLAEASVMTT   56 (256)
T ss_pred             eeeeecCCCceEEEEEe-cCcEEEEEEeccchhHHHHHHHHHHHHHh
Confidence            35699999999999997 599999999887754  344445554444


No 230
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=70.08  E-value=7.5  Score=34.93  Aligned_cols=30  Identities=23%  Similarity=0.245  Sum_probs=26.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.+|+++.|+||+|+-+ +|+.||||+....
T Consensus        30 ~~lg~G~~g~V~~~~~~~~~~~vaiK~~~~~   60 (364)
T cd07875          30 KPIGSGAQGIVCAAYDAILERNVAIKKLSRP   60 (364)
T ss_pred             EEeecCCCeEEEEEEECCCCcEEEEEEeCcc
Confidence            57999999999999976 7899999987653


No 231
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=70.01  E-value=7.6  Score=33.26  Aligned_cols=29  Identities=21%  Similarity=0.312  Sum_probs=24.5

Q ss_pred             cccceeeccceEEEEec----CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH----DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~----~G~~VAVKVq~P  187 (227)
                      +.++.++.|+||+|+..    +|+.||||+.+.
T Consensus         6 ~~ig~G~~~~vy~~~~~~~~~~~~~~avk~~~~   38 (288)
T cd05583           6 RVLGTGAYGKVFLVRKVGGHDAGKLYAMKVLKK   38 (288)
T ss_pred             EEeccCCCceEEEEEEeccccCCcEEEEEEEeh
Confidence            56899999999999864    678999998764


No 232
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=70.00  E-value=8  Score=33.15  Aligned_cols=45  Identities=16%  Similarity=0.314  Sum_probs=32.9

Q ss_pred             cccceeeccceEEEEec----CCCEEEEEecCCC-------cHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH----DGSTIALKVQHRN-------VRDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~----~G~~VAVKVq~P~-------i~~~i~~Dl~~l~~l  203 (227)
                      +.++.++.|.||.|+..    +|+.||+|+....       ..+.+..++.+++.+
T Consensus         6 ~~lg~G~~g~v~~~~~~~~~~~g~~~aiK~~~~~~~~~~~~~~~~~~~e~~~l~~l   61 (290)
T cd05613           6 KVLGTGAYGKVFLVRKVSGHDSGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHI   61 (290)
T ss_pred             eeeccCCcceEEEEEeccCCCCCceEEEEEeehhhhhhcchHHHHHHHHHHHHHhc
Confidence            45899999999999874    7899999987643       234455566665544


No 233
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=69.75  E-value=4  Score=36.16  Aligned_cols=30  Identities=27%  Similarity=0.408  Sum_probs=26.1

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      .+|.++.|.||+|+.+ +|+.||||+.++..
T Consensus         2 ~lG~G~~g~Vy~~~~~~~~~~vaiK~~~~~~   32 (316)
T cd05619           2 MLGKGSFGKVFLAELKGTNQFFAIKALKKDV   32 (316)
T ss_pred             eeeeCCCEEEEEEEECCCCCEEEEEEEEHHH
Confidence            4789999999999987 68999999988764


No 234
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=69.45  E-value=11  Score=32.42  Aligned_cols=42  Identities=26%  Similarity=0.442  Sum_probs=31.8

Q ss_pred             hhhhccccCccccceeeccceEEEEec-CCCEEEEEecCCCcHHH
Q psy4056         149 PSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDN  192 (227)
Q Consensus       149 ~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~  192 (227)
                      +.+.|.-.  ..++.++.|.||+|+.. +|+.|++|+....-.+.
T Consensus        10 ~~~~y~i~--~~lg~g~~g~vy~~~~~~~~~~~~~k~~~~~~~~~   52 (292)
T cd06644          10 PNEVWEII--GELGDGAFGKVYKAKNKETGALAAAKVIETKSEEE   52 (292)
T ss_pred             cchhhhhh--heecCCCCeEEEEEEECCCCceEEEEEeccCCHHH
Confidence            34555433  34899999999999987 68999999987665443


No 235
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=69.37  E-value=9.9  Score=33.64  Aligned_cols=30  Identities=20%  Similarity=0.344  Sum_probs=25.9

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      .+|.++.|+||+++-+ +|+.||+|+.++..
T Consensus         2 ~lG~G~~g~Vy~~~~~~~~~~vaiK~~~~~~   32 (323)
T cd05595           2 LLGKGTFGKVILVREKATGRYYAMKILRKEV   32 (323)
T ss_pred             eeeeCCCEEEEEEEECCCCCEEEEEEEEHHH
Confidence            4789999999999976 89999999987653


No 236
>KOG0594|consensus
Probab=69.30  E-value=3  Score=38.55  Aligned_cols=55  Identities=25%  Similarity=0.299  Sum_probs=41.1

Q ss_pred             hhhccccCccccceeeccceEEEEec-CCCEEEEEecCCC-----cHHHHHHHHHHHHHHHHH
Q psy4056         150 SEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHRN-----VRDNANIDIKCMEALVHV  206 (227)
Q Consensus       150 ~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~-----i~~~i~~Dl~~l~~l~~~  206 (227)
                      -+.|..++.  +|.++.|-||+|+-+ +|+.||+|.++=.     +...-...+.+++.+.+-
T Consensus        10 ~~~~~~~ek--lGeGtyg~Vykar~~~~g~~VALKkirl~~~~EG~P~taiREisllk~L~~~   70 (323)
T KOG0594|consen   10 MFDYEKVEK--LGEGTYGVVYKARSKRTGKFVALKKIRLEFEEEGVPSTAIREISLLKRLSHA   70 (323)
T ss_pred             HHHHHHHHH--hCCCCceEEEEEEEecCCCEEEEEEEeccccccCCCchhhHHHHHHHHhCCC
Confidence            344556665  999999999999998 8999999998754     444556666776665543


No 237
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=69.00  E-value=4.3  Score=39.01  Aligned_cols=31  Identities=26%  Similarity=0.310  Sum_probs=26.5

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+.||.++.|.||+|+.. +|+.||||+....
T Consensus        37 ~~~LG~G~fG~Vy~a~~~~~g~~vAvK~i~~~   68 (496)
T PTZ00283         37 SRVLGSGATGTVLCAKRVSDGEPFAVKVVDME   68 (496)
T ss_pred             EEEEecCCCEEEEEEEEcCCCCEEEEEEEecc
Confidence            356999999999999876 8999999997543


No 238
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=68.89  E-value=8.7  Score=34.15  Aligned_cols=46  Identities=20%  Similarity=0.329  Sum_probs=33.6

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCC-----CcHHHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHR-----NVRDNANIDIKCMEAL  203 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P-----~i~~~i~~Dl~~l~~l  203 (227)
                      .++++.+..|.||+|+-+ +|+.||||....     ...+.+..++.+++.+
T Consensus        15 ~~~ig~g~~g~v~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~~E~~~l~~l   66 (328)
T cd07856          15 LQPVGMGAFGLVCSARDQLTGQNVAIKKIMKPFSTPVLAKRTYRELKLLKHL   66 (328)
T ss_pred             EEeecccCCeEEEEEEECCCCCEEEEEEecccccccchhHHHHHHHHHHHhc
Confidence            368999999999999876 899999997653     2334555555555543


No 239
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=68.85  E-value=8.5  Score=33.04  Aligned_cols=30  Identities=23%  Similarity=0.265  Sum_probs=25.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.++.|.||+|+.+ +|+.|++|.....
T Consensus        11 ~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~   41 (293)
T cd07843          11 NRIEEGTYGVVYRARDKKTGEIVALKKLKME   41 (293)
T ss_pred             hhhcCCCCeEEEEEEECCCCcEEEEEEEeec
Confidence            67899999999999997 7899999977643


No 240
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=68.84  E-value=5.1  Score=34.45  Aligned_cols=29  Identities=17%  Similarity=0.284  Sum_probs=24.6

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .++.++.|+||+|... +|+.||+|+..+.
T Consensus         1 ~ig~g~~g~Vy~~~~~~~~~~vaiK~~~~~   30 (278)
T cd05606           1 IIGRGGFGEVYGCRKADTGKMYAMKCLDKK   30 (278)
T ss_pred             CcccCCCeEEEEEEEecCCCEEEEEEeecc
Confidence            3688999999999876 6899999987664


No 241
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=68.55  E-value=6.6  Score=34.67  Aligned_cols=28  Identities=18%  Similarity=0.325  Sum_probs=23.3

Q ss_pred             ccee--eccceEEEEec-CCCEEEEEecCCC
Q psy4056         161 MGAA--SLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       161 iasA--SIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ||.|  +.+.||+++.+ +|+.||||.....
T Consensus         6 ig~G~~~~~~v~~~~~~~~~~~vaiK~~~~~   36 (327)
T cd08227           6 IGRGFEDLMTVNLARYKPTGEYVTVRRINLE   36 (327)
T ss_pred             ccccccceEEEEEEeecccCcEEEEEEechh
Confidence            5555  78899999987 8999999988754


No 242
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=68.53  E-value=8.7  Score=32.00  Aligned_cols=31  Identities=26%  Similarity=0.322  Sum_probs=26.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      ++++.++.|.||+|... +++.+++|+....-
T Consensus         9 ~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~~   40 (262)
T cd06613           9 QRIGSGTYGDVYKARDIATGELVAIKVIKLEP   40 (262)
T ss_pred             EEecCCCceEEEEeEecCCCCEEEEEEEEcCc
Confidence            67999999999999986 68899999987553


No 243
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=67.82  E-value=10  Score=31.95  Aligned_cols=31  Identities=16%  Similarity=0.284  Sum_probs=26.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      +.++.++.|.||+|..+ +|+.|++|+...+-
T Consensus        12 ~~ig~g~~~~v~~~~~~~~~~~~~~K~~~~~~   43 (263)
T cd05052          12 HKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDT   43 (263)
T ss_pred             eecCCcccceEEEEEEecCCceEEEEEecCCc
Confidence            56999999999999987 68999999977653


No 244
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=67.67  E-value=11  Score=31.27  Aligned_cols=29  Identities=24%  Similarity=0.362  Sum_probs=25.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.++++..|.||+|... +|+.|++|+...
T Consensus         6 ~~lg~g~~~~v~~~~~~~~~~~~~~k~~~~   35 (265)
T cd08217           6 ETIGKGSFGTVRKVRRKSDGKILVWKEIDY   35 (265)
T ss_pred             eeeccCCCeEEEEeeecCCCCEEEEEEEec
Confidence            56899999999999876 889999998754


No 245
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=67.40  E-value=8.6  Score=33.46  Aligned_cols=30  Identities=27%  Similarity=0.442  Sum_probs=26.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.++.|.||+|+.. +|+.||+|..++.
T Consensus         7 ~~ig~g~~g~vy~~~~~~~~~~~aiK~~~~~   37 (316)
T cd05574           7 KLLGKGDVGRVFLVRLKGTGKLFALKVLDKK   37 (316)
T ss_pred             eeecCCccEEEEEEEEcCCCcEEEEEEEecc
Confidence            46899999999999987 5999999998875


No 246
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=67.33  E-value=10  Score=32.18  Aligned_cols=32  Identities=25%  Similarity=0.316  Sum_probs=24.7

Q ss_pred             ccceeeccceEEEEecC-------------CCEEEEEecCCCcHH
Q psy4056         160 PMGAASLAQVHKATLHD-------------GSTIALKVQHRNVRD  191 (227)
Q Consensus       160 PiasASIaQVHrA~L~~-------------G~~VAVKVq~P~i~~  191 (227)
                      .++.+.-|+||+|++.+             +.+|+||+..+.-.+
T Consensus         2 ~lg~G~~~~vy~~~~~~~~~~~~~~~~~~~~~~v~~k~~~~~~~~   46 (262)
T cd05077           2 HLGRGTRTQIYAGILNYKDDDEDDGYSYEKEIKVILKVLDPSHRD   46 (262)
T ss_pred             ccccCCcceEeeeecccCCCccccccchhhceeEEEeecChhhhh
Confidence            47888999999999752             236999998876544


No 247
>KOG4721|consensus
Probab=67.33  E-value=2.9  Score=42.06  Aligned_cols=67  Identities=25%  Similarity=0.336  Sum_probs=48.6

Q ss_pred             CcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEecCCCEEEEEecCCCcHHHH
Q psy4056         114 LPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNA  193 (227)
Q Consensus       114 lP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i  193 (227)
                      +...|..+.+.=|+..-..||++|-+                  -+=+||++=|-|++|+| .+++||||    -|++.=
T Consensus       103 iGk~~s~e~k~qq~e~WeiPFe~IsE------------------LeWlGSGaQGAVF~Grl-~netVAVK----KV~elk  159 (904)
T KOG4721|consen  103 IGKAYSTEHKQQQEELWEIPFEEISE------------------LEWLGSGAQGAVFLGRL-HNETVAVK----KVRELK  159 (904)
T ss_pred             hccceeeehhhhhhhhccCCHHHhhh------------------hhhhccCcccceeeeec-cCceehhH----HHhhhh
Confidence            44555555666666666666654422                  13489999999999999 58999999    577888


Q ss_pred             HHHHHHHHHH
Q psy4056         194 NIDIKCMEAL  203 (227)
Q Consensus       194 ~~Dl~~l~~l  203 (227)
                      +.|++-|+.+
T Consensus       160 ETdIKHLRkL  169 (904)
T KOG4721|consen  160 ETDIKHLRKL  169 (904)
T ss_pred             hhhHHHHHhc
Confidence            8899988764


No 248
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=66.47  E-value=11  Score=32.72  Aligned_cols=46  Identities=20%  Similarity=0.375  Sum_probs=32.7

Q ss_pred             ccccceeeccceEEEEec--------CCCEEEEEecCCCcHH----HHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH--------DGSTIALKVQHRNVRD----NANIDIKCMEAL  203 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~--------~G~~VAVKVq~P~i~~----~i~~Dl~~l~~l  203 (227)
                      ..+++.++.|+||+|+..        ++..||+|+..+....    .+..++.+++.+
T Consensus        20 ~~~lg~G~~g~Vy~~~~~~~~~~~~~~~~~v~iK~~~~~~~~~~~~~~~~E~~~l~~l   77 (304)
T cd05101          20 GKPLGEGCFGQVVMAEALGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMI   77 (304)
T ss_pred             cceeeccCCceEEEEEEeccCCCCCCcceeEEeeecccccchHHHHHHHHHHHHHHhh
Confidence            478999999999999752        4568999999875432    344555555444


No 249
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=66.25  E-value=8.2  Score=35.12  Aligned_cols=29  Identities=14%  Similarity=0.282  Sum_probs=25.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.+|.|+.|.||+|+.+ +|+.||||+...
T Consensus        49 ~~lg~G~~g~Vy~~~~~~~~~~~aiK~~~~   78 (370)
T cd05596          49 KVIGRGAFGEVQLVRHKSSKQVYAMKLLSK   78 (370)
T ss_pred             EEEeeCCCEEEEEEEECCCCCEEEEEEEEH
Confidence            56999999999999987 789999998753


No 250
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=66.03  E-value=9.5  Score=34.32  Aligned_cols=28  Identities=25%  Similarity=0.317  Sum_probs=23.6

Q ss_pred             cccceeeccceEEEEecC--CCEEEEEecC
Q psy4056         159 NPMGAASLAQVHKATLHD--GSTIALKVQH  186 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~--G~~VAVKVq~  186 (227)
                      +.+|.|+.|.||+|+.++  +..||||+..
T Consensus        36 ~~ig~G~~g~Vy~a~~~~~~~~~vavK~~~   65 (340)
T PTZ00426         36 RTLGTGSFGRVILATYKNEDFPPVAIKRFE   65 (340)
T ss_pred             EEEeecCCeEEEEEEEECCCCeEEEEEEEE
Confidence            679999999999998763  4689999764


No 251
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=66.00  E-value=11  Score=33.14  Aligned_cols=25  Identities=16%  Similarity=0.301  Sum_probs=21.7

Q ss_pred             eeccceEEEEec-CCCEEEEEecCCC
Q psy4056         164 ASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       164 ASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ++.++||+|+.+ +|+.||||+....
T Consensus        11 ~~~~~v~~a~~~~~~~~vaiK~~~~~   36 (328)
T cd08226          11 CNLTSVYLARHTPTGTLVTVRITDLE   36 (328)
T ss_pred             cCceeEEEEEEcCCCcEEEEEEeccc
Confidence            488899999976 8999999998764


No 252
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=65.96  E-value=14  Score=32.89  Aligned_cols=29  Identities=14%  Similarity=0.338  Sum_probs=25.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.+|.++.|.||+++.+ +|+.||||+...
T Consensus         7 ~~lG~G~fg~V~~~~~~~~~~~~aiK~~~~   36 (331)
T cd05624           7 KVIGRGAFGEVAVVKMKHTERIYAMKILNK   36 (331)
T ss_pred             EEEeeCCCeEEEEEEECCCCCEEEEEEEeH
Confidence            46899999999999987 789999998764


No 253
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=65.77  E-value=11  Score=31.55  Aligned_cols=31  Identities=16%  Similarity=0.235  Sum_probs=24.9

Q ss_pred             cceeeccceEEEEec--C--CCEEEEEecCCCcHH
Q psy4056         161 MGAASLAQVHKATLH--D--GSTIALKVQHRNVRD  191 (227)
Q Consensus       161 iasASIaQVHrA~L~--~--G~~VAVKVq~P~i~~  191 (227)
                      ||.|+.|+||+|+..  +  +..||+|+.++....
T Consensus         3 ig~G~~g~v~~~~~~~~~~~~~~~~iK~~~~~~~~   37 (257)
T cd05060           3 LGHGNFGSVVKGVYLMKSGKEVEVAVKTLKQEHIA   37 (257)
T ss_pred             cCccCceeEEEeEeeccCCCcceEEEEecccccch
Confidence            788999999999875  3  268999998876653


No 254
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=65.76  E-value=12  Score=31.71  Aligned_cols=44  Identities=23%  Similarity=0.323  Sum_probs=30.3

Q ss_pred             ccceeeccceEEEEec-CCC--EEEEEecCCCcH----HHHHHHHHHHHHH
Q psy4056         160 PMGAASLAQVHKATLH-DGS--TIALKVQHRNVR----DNANIDIKCMEAL  203 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~--~VAVKVq~P~i~----~~i~~Dl~~l~~l  203 (227)
                      .++.++.|.||+|+++ +|.  .|++|.......    +.+...+.++..+
T Consensus         2 ~lg~g~~g~v~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~E~~~l~~l   52 (270)
T cd05047           2 VIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKL   52 (270)
T ss_pred             cCCCCCCceEEEEEEcCCCCeeEEEEEEccccCCHHHHHHHHHHHHHHHhh
Confidence            5889999999999997 554  578888775443    3444455555443


No 255
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=65.63  E-value=12  Score=32.39  Aligned_cols=36  Identities=28%  Similarity=0.267  Sum_probs=27.8

Q ss_pred             hhhccccCccccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         150 SEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       150 ~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      .+.+..+  ..++.++-|.||++... +|+.||||...-
T Consensus        21 ~~~~~~~--~~lg~g~~g~v~~~~~~~~~~~vaiK~~~~   57 (292)
T cd06658          21 REYLDSF--IKIGEGSTGIVCIATEKHTGKQVAVKKMDL   57 (292)
T ss_pred             HHHHhhh--hcccCCCCeEEEEEEECCCCCEEEEEEEec
Confidence            3444444  45999999999999986 789999998643


No 256
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=65.46  E-value=9.3  Score=32.68  Aligned_cols=32  Identities=16%  Similarity=0.302  Sum_probs=26.4

Q ss_pred             ccceeeccceEEEEec-----CCCEEEEEecCCCcHH
Q psy4056         160 PMGAASLAQVHKATLH-----DGSTIALKVQHRNVRD  191 (227)
Q Consensus       160 PiasASIaQVHrA~L~-----~G~~VAVKVq~P~i~~  191 (227)
                      .++.+..|+||.|+..     +|+.||+|..++....
T Consensus        11 ~lg~g~~g~v~~~~~~~~~~~~~~~va~K~~~~~~~~   47 (284)
T cd05079          11 DLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGG   47 (284)
T ss_pred             ecCCCCceeEEEEEEccCCCCccceEEEEEcCccccH
Confidence            4899999999999853     6889999999877543


No 257
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=65.42  E-value=13  Score=32.81  Aligned_cols=29  Identities=17%  Similarity=0.320  Sum_probs=25.4

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .+|.++.|+||+|+-+ +|+.||||+..+.
T Consensus         2 ~lG~G~~g~V~~~~~~~~~~~~a~K~~~~~   31 (325)
T cd05594           2 LLGKGTFGKVILVKEKATGRYYAMKILKKE   31 (325)
T ss_pred             eeeeCCCEEEEEEEECCCCCEEEEEEEEHH
Confidence            4789999999999876 8999999998764


No 258
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=65.40  E-value=9.8  Score=31.57  Aligned_cols=29  Identities=28%  Similarity=0.306  Sum_probs=25.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.++.++.|+||+|+.+ +|+.|++|....
T Consensus         6 ~~l~~g~~~~v~~~~~~~~~~~~~~k~~~~   35 (256)
T cd08529           6 NKIGKGSFGVVFKVVRKADKRVYAMKQIDL   35 (256)
T ss_pred             EEecCCCCeEEEEEEEcCCCcEEEEEEeeh
Confidence            56899999999999987 799999998653


No 259
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=65.21  E-value=9.7  Score=31.84  Aligned_cols=43  Identities=9%  Similarity=0.293  Sum_probs=32.0

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcH---HHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVR---DNANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~---~~i~~Dl~~l~  201 (227)
                      +.++.++.|-||+|+.++++.|++|+....-.   ..+...+.+++
T Consensus        12 ~~ig~g~~~~vy~~~~~~~~~~~~k~~~~~~~~~~~~~~~e~~~l~   57 (261)
T cd05148          12 RKLGSGYFGEVWEGLWKNRVRVAIKILKSDDLLKQQDFQKEVQALK   57 (261)
T ss_pred             hhhccCCCccEEEeEecCCCcEEEEeccccchhhHHHHHHHHHHHh
Confidence            45889999999999999999999999775543   33444444443


No 260
>PHA03212 serine/threonine kinase US3; Provisional
Probab=65.11  E-value=8.3  Score=35.65  Aligned_cols=42  Identities=7%  Similarity=0.139  Sum_probs=30.8

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~i~~Dl~~l~~l  203 (227)
                      +.++.|+.|.||+|.-+ +|+.||+|+..   .+.+...+.+++.+
T Consensus        98 ~~lg~G~~g~V~~~~d~~~~~~vaiK~~~---~~~~~~E~~il~~l  140 (391)
T PHA03212         98 ETFTPGAEGFAFACIDNKTCEHVVIKAGQ---RGGTATEAHILRAI  140 (391)
T ss_pred             EEEcCCCCeEEEEEEECCCCCEEEEechh---hhhhHHHHHHHHhC
Confidence            45999999999999986 79999999753   23444555555443


No 261
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=65.10  E-value=15  Score=31.37  Aligned_cols=31  Identities=23%  Similarity=0.189  Sum_probs=26.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      ++++.++-|.||+|+.. +|+.||||+...+.
T Consensus         7 ~~lg~g~~~~v~~~~~~~~~~~~aiK~~~~~~   38 (279)
T cd06619           7 EILGHGNGGTVYKAYHLLTRRILAVKVIPLDI   38 (279)
T ss_pred             eeeccCCCeEEEEEEEcCCCcEEEEEEEecCC
Confidence            46899999999999875 89999999986654


No 262
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=64.96  E-value=12  Score=31.93  Aligned_cols=43  Identities=16%  Similarity=0.316  Sum_probs=31.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH----HHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR----DNANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~----~~i~~Dl~~l~  201 (227)
                      +.++.++.|.||+|..+ +|+.||+|+..-...    ..+...+.+++
T Consensus         7 ~~ig~g~~g~v~~~~~~~~~~~~a~k~~~~~~~~~~~~~~~~e~~~l~   54 (286)
T cd06622           7 DELGKGNYGSVYKVLHRPTGVTMAMKEIRLELDESKFNQIIMELDILH   54 (286)
T ss_pred             hhhcccCCeEEEEEEEcCCCcEEEEEEeecccCHHHHHHHHHHHHHHH
Confidence            45899999999999987 899999997764432    23444445544


No 263
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=64.68  E-value=9.8  Score=31.96  Aligned_cols=28  Identities=21%  Similarity=0.471  Sum_probs=23.3

Q ss_pred             cceeeccceEEEEec---CCCEEEEEecCCC
Q psy4056         161 MGAASLAQVHKATLH---DGSTIALKVQHRN  188 (227)
Q Consensus       161 iasASIaQVHrA~L~---~G~~VAVKVq~P~  188 (227)
                      ++.++.|-||+|..+   +++.||||+....
T Consensus         3 lg~G~~g~v~~~~~~~~~~~~~~aiK~~~~~   33 (257)
T cd05116           3 LGSGNFGTVKKGMYKMKKSEKTVAVKILKND   33 (257)
T ss_pred             CCCcCCcceEEeEEecCCCceEEEEEEccCC
Confidence            788899999999764   6889999997644


No 264
>KOG0575|consensus
Probab=64.62  E-value=11  Score=37.69  Aligned_cols=46  Identities=22%  Similarity=0.291  Sum_probs=40.2

Q ss_pred             cccceeeccceEEEEe-cCCCEEEEEec------CCCcHHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATL-HDGSTIALKVQ------HRNVRDNANIDIKCMEALV  204 (227)
Q Consensus       159 ~PiasASIaQVHrA~L-~~G~~VAVKVq------~P~i~~~i~~Dl~~l~~l~  204 (227)
                      .-+|-|..|+||+|+- ..|+.||+||.      .|+.++.+...+.+-+.+.
T Consensus        24 ~~LGkGgFA~cYe~~~~~tge~~A~KvVpk~~l~k~~~reKv~~EIeIHr~L~   76 (592)
T KOG0575|consen   24 RFLGKGGFARCYEARDLDTGEVVAVKVVPKKLLKKPKQREKVLNEIEIHRSLK   76 (592)
T ss_pred             eeeccCcceEEEEEEEcCCCcEEEEEEeehHHhcCcchHHHHHHHHHHHHhcC
Confidence            5689999999999998 68999999985      7899999999999877654


No 265
>PHA03207 serine/threonine kinase US3; Provisional
Probab=64.58  E-value=9.2  Score=35.04  Aligned_cols=43  Identities=14%  Similarity=0.231  Sum_probs=31.7

Q ss_pred             cccceeeccceEEEEec---CCCEEEEEecCCCcHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH---DGSTIALKVQHRNVRDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~---~G~~VAVKVq~P~i~~~i~~Dl~~l~~l  203 (227)
                      ..++.++-|+||+|+.+   ++++|+||+...+-  .....+.+++.+
T Consensus        98 ~~Lg~G~~g~Vy~~~~~~~~~~~~v~vK~~~~~~--~~~~E~~il~~l  143 (392)
T PHA03207         98 SSLTPGSEGEVFVCTKHGDEQRKKVIVKAVTGGK--TPGREIDILKTI  143 (392)
T ss_pred             EeecCCCCeEEEEEEEcCCccceeEEEEeccccc--cHHHHHHHHHhc
Confidence            56999999999999875   46799999887653  334556665543


No 266
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=64.54  E-value=13  Score=32.55  Aligned_cols=45  Identities=22%  Similarity=0.310  Sum_probs=34.8

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc-----HHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV-----RDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-----~~~i~~Dl~~l~~l  203 (227)
                      ..++.++.|-||+|+.. +|+.|+||+.++..     .+.+..++.+++.+
T Consensus         6 ~~ig~g~~~~v~~~~~~~~~~~~~iK~~~~~~~~~~~~~~~~~e~~~l~~l   56 (330)
T cd07834           6 KPIGSGAYGVVCSAVDKRTGRKVAIKKISNVFDDLIDAKRILREIKLLRHL   56 (330)
T ss_pred             eeecCCCCeEEEEEEeCCCCcEEEEEeeccccccchhhhhHHHHHHHHHhc
Confidence            56999999999999987 59999999887654     34555566666544


No 267
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=64.00  E-value=13  Score=32.04  Aligned_cols=29  Identities=28%  Similarity=0.216  Sum_probs=25.3

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      .+.++.++.|.||+|+.+ +|+.|++|+.+
T Consensus        24 ~~~lg~g~~g~v~~~~~~~~~~~~~iK~~~   53 (285)
T cd06648          24 FVKIGEGSTGIVCIATDKSTGRQVAVKKMD   53 (285)
T ss_pred             ceEeccCCCeEEEEEEECCCCCEEEEEEEe
Confidence            368999999999999975 89999999764


No 268
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=63.67  E-value=9.6  Score=33.08  Aligned_cols=30  Identities=17%  Similarity=0.237  Sum_probs=25.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.++-|.||+|+-+ +|+.|++|.....
T Consensus        26 ~~lg~g~~~~v~~~~~~~~~~~v~ik~~~~~   56 (296)
T cd06654          26 EKIGQGASGTVYTAMDVATGQEVAIRQMNLQ   56 (296)
T ss_pred             EEecCCCCeEEEEEEECCCCcEEEEEEEecC
Confidence            45999999999999865 8999999977643


No 269
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=63.56  E-value=11  Score=31.97  Aligned_cols=34  Identities=21%  Similarity=0.420  Sum_probs=26.9

Q ss_pred             cccceeeccceEEEEecC-C-----CEEEEEecCCCcHHH
Q psy4056         159 NPMGAASLAQVHKATLHD-G-----STIALKVQHRNVRDN  192 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~-G-----~~VAVKVq~P~i~~~  192 (227)
                      +.++.++.|.||+|...+ +     +.|++|+.+......
T Consensus        11 ~~lg~G~~g~Vy~~~~~~~~~~~~~~~v~~K~~~~~~~~~   50 (283)
T cd05048          11 EELGEGAFGKVYKGELTGPNERLSATSVAIKTLKENAEPK   50 (283)
T ss_pred             hcccCccCCcEEEEEEecCCCCcceeeEEEEecccCCCHH
Confidence            569999999999999862 2     589999998765433


No 270
>KOG0032|consensus
Probab=63.37  E-value=11  Score=35.33  Aligned_cols=46  Identities=15%  Similarity=0.257  Sum_probs=35.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcH------HHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR------DNANIDIKCMEALV  204 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~------~~i~~Dl~~l~~l~  204 (227)
                      +-+|.+..|+||+++-+ +|+++|+|+......      +.+...+.+|+.+.
T Consensus        41 ~~lG~G~Fg~v~~~~~~~tg~~~A~K~i~k~~~~~~~~~~~v~~Ev~il~~l~   93 (382)
T KOG0032|consen   41 RELGRGQFGVVYLCREKSTGKEVACKVIPKRKLRGKEDREDVRREVAILQQLS   93 (382)
T ss_pred             hhhCCCCceEEEEEEecCCCceeEEEEeehhhccccccHHHHHHHHHHHHhcc
Confidence            56999999999999998 599999999865544      35555555555543


No 271
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=63.25  E-value=11  Score=32.02  Aligned_cols=28  Identities=18%  Similarity=0.344  Sum_probs=23.6

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ++.++.|.||+|..+ +|+.|++|+.+..
T Consensus         1 lg~g~~g~vy~~~~~~~~~~~~ik~~~~~   29 (277)
T cd05577           1 LGKGGFGEVCACQVKATGKMYACKKLDKK   29 (277)
T ss_pred             CCCCCceeEEEEEEcCCCcEEEEEEEehh
Confidence            467889999999876 7999999988754


No 272
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=63.16  E-value=13  Score=32.25  Aligned_cols=28  Identities=21%  Similarity=0.292  Sum_probs=24.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      +.++.++.|.||+|+-. +|+.|+||...
T Consensus        25 ~~lg~g~~g~vy~~~~~~~~~~v~iK~~~   53 (296)
T cd06655          25 EKIGQGASGTVFTAIDVATGQEVAIKQIN   53 (296)
T ss_pred             EEEecCCCeEEEEEEEcCCCcEEEEEEEe
Confidence            46999999999999865 89999999654


No 273
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=63.13  E-value=11  Score=31.29  Aligned_cols=41  Identities=22%  Similarity=0.226  Sum_probs=28.6

Q ss_pred             ccceeeccceEEEEecCCC-----------EEEEEecCCCcH--HHHHHHHHHH
Q psy4056         160 PMGAASLAQVHKATLHDGS-----------TIALKVQHRNVR--DNANIDIKCM  200 (227)
Q Consensus       160 PiasASIaQVHrA~L~~G~-----------~VAVKVq~P~i~--~~i~~Dl~~l  200 (227)
                      .++.++-|+||+|+.++..           .|++|+..++-.  ..+...+.++
T Consensus         2 ~lg~G~~~~v~~~~~~~~~~~~~~~~~~~~~v~~k~~~~~~~~~~~~~~e~~~l   55 (259)
T cd05037           2 HLGQGTFTNIYKGVLRVQSDLDIVGPGQEVSVVLKVLGSDHRDSLAFFETASLM   55 (259)
T ss_pred             cccccccceEEEEEEeccCCccccCCccceeeeeeccccchhhHHHHHHHHHHH
Confidence            4788999999999998433           688998776653  3444444444


No 274
>PRK09550 mtnK methylthioribose kinase; Reviewed
Probab=62.84  E-value=21  Score=33.85  Aligned_cols=58  Identities=19%  Similarity=0.216  Sum_probs=40.5

Q ss_pred             CCCHHHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEecCC-CEEEEEecCCCcH
Q psy4056         131 MSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDG-STIALKVQHRNVR  190 (227)
Q Consensus       131 ~~~~~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G-~~VAVKVq~P~i~  190 (227)
                      ++.-+.+...+.+..|.-  +--+..+-++++.|-+.+||+.+..+| +.|+||...|.++
T Consensus         6 ~l~~~~v~~yl~~~~~~~--~~~~~~~~~elggGn~N~VyrV~~~~g~~svIVKqa~p~~r   64 (401)
T PRK09550          6 TLTEEDAVEYAALKLGLF--DPKALLTAREIGDGNLNLVFRVSDTEGGKSVIVKQALPYVR   64 (401)
T ss_pred             eCCHhHHHHHHHHhcCCC--CCcccceeeEcCCCceEEEEEEEeCCCCeEEEEEecCcccc
Confidence            455566666665554421  111344567999999999999999888 5999998776654


No 275
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=62.69  E-value=11  Score=31.64  Aligned_cols=29  Identities=17%  Similarity=0.205  Sum_probs=24.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +-++.++.|.||+|..+ +|+.|+||+.+.
T Consensus         8 ~~l~~g~~g~v~~~~~~~~~~~v~ik~~~~   37 (265)
T cd06652           8 KLLGQGAFGRVYLCYDADTGRELAVKQVQF   37 (265)
T ss_pred             eEEecCCceEEEEEEEcCCCcEEEEEEeec
Confidence            45888999999999987 699999998653


No 276
>KOG3653|consensus
Probab=62.52  E-value=6.4  Score=38.43  Aligned_cols=42  Identities=19%  Similarity=0.262  Sum_probs=35.2

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCME  201 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~~Dl~~l~  201 (227)
                      +-+|.|=.|-|++|.| +++.|||||-.+.-.+++...=.+++
T Consensus       216 eli~~Grfg~V~KaqL-~~~~VAVKifp~~~kqs~~~Ek~Iy~  257 (534)
T KOG3653|consen  216 ELIGRGRFGCVWKAQL-DNRLVAVKIFPEQEKQSFQNEKNIYS  257 (534)
T ss_pred             HHhhcCccceeehhhc-cCceeEEEecCHHHHHHHHhHHHHHh
Confidence            3489999999999999 67999999988888888777766654


No 277
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=62.37  E-value=20  Score=31.16  Aligned_cols=33  Identities=18%  Similarity=0.387  Sum_probs=26.9

Q ss_pred             cccceeeccceEEEEec-CCC----EEEEEecCCCcHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGS----TIALKVQHRNVRD  191 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~----~VAVKVq~P~i~~  191 (227)
                      +.+|+++.|+||+|+.. +|+    .||+|+..+....
T Consensus        13 ~~lg~G~~g~vy~~~~~~~~~~~~~~vaiK~~~~~~~~   50 (303)
T cd05110          13 KVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGP   50 (303)
T ss_pred             cccccCCCccEEEEEEecCCCcceeeEEEEeccccCCH
Confidence            57999999999999876 565    5799988876544


No 278
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=62.27  E-value=9.5  Score=40.11  Aligned_cols=31  Identities=19%  Similarity=0.195  Sum_probs=27.0

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      +.+|.++.|.||+|+-. +|+.||||+.+.+.
T Consensus         8 ~~LGkGgfG~VYlA~d~~tg~~VAIK~I~~~l   39 (932)
T PRK13184          8 RLIGKGGMGEVYLAYDPVCSRRVALKKIREDL   39 (932)
T ss_pred             EEEecCCCEEEEEEEECCCCcEEEEEEECccc
Confidence            56899999999999976 79999999987654


No 279
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=62.21  E-value=14  Score=31.34  Aligned_cols=31  Identities=19%  Similarity=0.343  Sum_probs=25.8

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      +.|+.++.|.||+|+.. +|+.|+||......
T Consensus         5 ~~ig~g~~g~v~~~~~~~~~~~~~ik~~~~~~   36 (283)
T cd07830           5 KQLGDGTFGSVYLARNKETGELVAIKKMKKKF   36 (283)
T ss_pred             eeeccCCceEEEEEEECCCCcEEEEEEehhhc
Confidence            45899999999999997 68899999765543


No 280
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=62.07  E-value=15  Score=31.99  Aligned_cols=46  Identities=17%  Similarity=0.321  Sum_probs=32.8

Q ss_pred             ccccceeeccceEEEEec--------CCCEEEEEecCCCcHH----HHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH--------DGSTIALKVQHRNVRD----NANIDIKCMEAL  203 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~--------~G~~VAVKVq~P~i~~----~i~~Dl~~l~~l  203 (227)
                      .+++|.++.|.||+|+..        +++.||+|+.++....    .+..++.+++.+
T Consensus        23 ~~~lg~G~~g~V~~~~~~~~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~e~~~l~~l   80 (307)
T cd05098          23 GKPLGEGCFGQVVMAEAIGLDKEKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMI   80 (307)
T ss_pred             eeeeccCCCeeEEEeEEeccCCcccCccceEEEEeccCCCChHHHHHHHHHHHHHHHh
Confidence            357999999999999863        3467999999987532    344455555544


No 281
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=62.03  E-value=13  Score=31.44  Aligned_cols=30  Identities=10%  Similarity=0.183  Sum_probs=24.3

Q ss_pred             ccceeeccceEEEEecC---CCEEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLHD---GSTIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~~---G~~VAVKVq~P~i  189 (227)
                      .++.++.|.||+|+..+   +..|++|..+...
T Consensus         2 ~lg~G~~g~Vy~~~~~~~~~~~~~~~k~~~~~~   34 (269)
T cd05087           2 EIGNGWFGKVILGEVNSGYTPAQVVVKELRVSA   34 (269)
T ss_pred             cccccCCceEEEEEEcCCCCceEEEEEecCCCC
Confidence            47899999999999864   3579999877654


No 282
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=61.92  E-value=16  Score=30.27  Aligned_cols=28  Identities=21%  Similarity=0.306  Sum_probs=24.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      ++++.++.|+|++++.+ +|++||||...
T Consensus         6 ~~lg~g~~~~v~~~~~~~~~~~~~~k~~~   34 (257)
T cd08223           6 RVVGKGSYGEVSLVRHRTDGKQYVIKKLN   34 (257)
T ss_pred             EEecCCCCeEEEEEEEcCCCcEEEEEEEe
Confidence            46889999999999987 78999999864


No 283
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=61.76  E-value=16  Score=31.07  Aligned_cols=32  Identities=22%  Similarity=0.420  Sum_probs=26.1

Q ss_pred             cccceeeccceEEEEec-CCC----EEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLH-DGS----TIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~----~VAVKVq~P~i~  190 (227)
                      +.++.++-|+||+|+.+ +|+    .||+|+..++..
T Consensus        13 ~~ig~g~~g~v~~~~~~~~~~~~~~~~aik~~~~~~~   49 (279)
T cd05057          13 KVLGSGAFGTVYKGVWIPEGEKVKIPVAIKVLREETS   49 (279)
T ss_pred             ceecCCCCccEEEEEEecCCCCcceEEEEEeccCCCC
Confidence            57999999999999987 454    699998876643


No 284
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=61.46  E-value=17  Score=31.06  Aligned_cols=33  Identities=21%  Similarity=0.370  Sum_probs=26.2

Q ss_pred             cccceeeccceEEEEecC-----------------CCEEEEEecCCCcHH
Q psy4056         159 NPMGAASLAQVHKATLHD-----------------GSTIALKVQHRNVRD  191 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~-----------------G~~VAVKVq~P~i~~  191 (227)
                      +.+|.++.|.||+|+..+                 +..||+|+..++...
T Consensus        11 ~~lg~G~~g~v~~~~~~~~~~~~~~~~~~~~~~~~~~~va~K~~~~~~~~   60 (296)
T cd05051          11 EKLGEGQFGEVHLCEADGLQDFSEKAFAENDNADAPVLVAVKVLRPDASD   60 (296)
T ss_pred             ccccCCCCccEEEEEeccCCcccccccccccccCCceeEEEEEecCccCH
Confidence            568999999999998762                 256999999887643


No 285
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=61.30  E-value=28  Score=30.20  Aligned_cols=29  Identities=24%  Similarity=0.289  Sum_probs=25.4

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .++.++.|+|++|+.+ +|+.||||+....
T Consensus        28 ~ig~g~~g~v~~~~~~~~~~~v~iK~~~~~   57 (297)
T cd06659          28 KIGEGSTGIVCIAREKHSGRQVAVKMMDLR   57 (297)
T ss_pred             hcCCCCceeEEEEEEcCCCCEEEEEEEEec
Confidence            5999999999999986 8999999997543


No 286
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=60.84  E-value=13  Score=31.06  Aligned_cols=28  Identities=18%  Similarity=0.296  Sum_probs=24.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      +.++.++.|.||.++.+ +|+.|++|...
T Consensus         6 ~~lg~g~~g~~~~~~~~~~~~~~~ik~~~   34 (256)
T cd08218           6 KKIGEGSFGKAILVKSKEDGKQYVIKEIN   34 (256)
T ss_pred             EEeccCCceEEEEEEEcCCCCEEEEEEEE
Confidence            56899999999999987 78999999753


No 287
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=60.83  E-value=15  Score=31.93  Aligned_cols=45  Identities=22%  Similarity=0.336  Sum_probs=29.2

Q ss_pred             cccceeeccceEEEEec-CCCE--EEEEecCCCcHH----HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGST--IALKVQHRNVRD----NANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~--VAVKVq~P~i~~----~i~~Dl~~l~~l  203 (227)
                      +.+|.++.|+||+|+.+ +|..  |++|.......+    .+...+.++..+
T Consensus        13 ~~lg~G~~g~V~~a~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~Ei~~l~~l   64 (303)
T cd05088          13 DVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKL   64 (303)
T ss_pred             eeecCCCCceEEEEEEccCCceeeEEEEEecccCCHHHHHHHHHHHHHHHHh
Confidence            67999999999999986 6764  566655544332    334444444443


No 288
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=60.38  E-value=16  Score=31.57  Aligned_cols=28  Identities=21%  Similarity=0.278  Sum_probs=24.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      +.+++++.|-||+|.-. +|+.|++|+..
T Consensus        25 ~~lg~g~~g~v~~~~~~~~~~~v~iK~~~   53 (293)
T cd06647          25 EKIGQGASGTVYTAIDVATGQEVAIKQMN   53 (293)
T ss_pred             eEecCCCCeEEEEEEEcCCCCEEEEEEec
Confidence            57999999999999865 78999999854


No 289
>PRK05231 homoserine kinase; Provisional
Probab=60.18  E-value=43  Score=29.60  Aligned_cols=49  Identities=10%  Similarity=0.009  Sum_probs=36.7

Q ss_pred             CCCCHHHHHHHHHHhcCC-ChhhhccccCccccceeeccceEEEEecCCCEEEEEecC
Q psy4056         130 PMSPMKDILAVLKEDLGK-DPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQH  186 (227)
Q Consensus       130 p~~~~~~v~~~l~~elG~-~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~  186 (227)
                      .+.+.+++.+++ +.+|. .+.      +-+|+++|+..++|+-...+| ..++|+-+
T Consensus         5 t~ls~~~l~~~l-~~y~~~~~~------~~~~l~~G~~n~~y~v~t~~g-~~vLK~~~   54 (319)
T PRK05231          5 TDVSDDELAAFL-APYDLGELL------SLKGIAEGIENSNFFLTTTQG-EYVLTLFE   54 (319)
T ss_pred             ccCCHHHHHHHH-HhcCCchhh------ccchhccccccceEEEEeCCC-cEEEEEec
Confidence            456778888888 66775 222      236899999999999987666 68999865


No 290
>KOG0658|consensus
Probab=60.05  E-value=9.3  Score=35.90  Aligned_cols=44  Identities=23%  Similarity=0.323  Sum_probs=34.6

Q ss_pred             CccccceeeccceEEEEec-CCCEEEEEecCCCcHHHHHHHHHHHH
Q psy4056         157 EPNPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDNANIDIKCME  201 (227)
Q Consensus       157 d~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~i~~Dl~~l~  201 (227)
                      +.+-+|+||.|=||+|.+. ++++||||=..|+=+ .-...+.+|+
T Consensus        28 ~~~liG~GsFg~Vyq~~~~e~~~~vAIKKv~~d~r-~knrEl~im~   72 (364)
T KOG0658|consen   28 AVRLIGSGSFGVVYQAKLRETEEEVAIKKVLQDKR-YKNRELQIMR   72 (364)
T ss_pred             eeEEEeecccceEEEEEEcCCCceeEEEEecCCCC-cCcHHHHHHH
Confidence            4567999999999999998 789999997666644 3455667766


No 291
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=60.03  E-value=12  Score=34.11  Aligned_cols=29  Identities=14%  Similarity=0.276  Sum_probs=25.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.+|.|+.|.||+|+.+ +|+.||+|+...
T Consensus        49 ~~lG~G~fg~Vy~~~~~~~~~~~aiK~i~~   78 (371)
T cd05622          49 KVIGRGAFGEVQLVRHKSTRKVYAMKLLSK   78 (371)
T ss_pred             EEEeecCCeEEEEEEECCCCcEEEEEEEEH
Confidence            56999999999999988 789999999753


No 292
>KOG0587|consensus
Probab=59.62  E-value=9.6  Score=39.73  Aligned_cols=54  Identities=22%  Similarity=0.428  Sum_probs=38.8

Q ss_pred             CChhhhccccCccccceeeccceEEEEec-CCCEEEEEecCCCcHH--HHHHHHHHHHH
Q psy4056         147 KDPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHRNVRD--NANIDIKCMEA  202 (227)
Q Consensus       147 ~~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~--~i~~Dl~~l~~  202 (227)
                      .++.+.|+-++  -++-|--|+|++++=+ +|+-+||||++|+.+.  .++....+++.
T Consensus        15 pdp~d~~ei~e--vig~Gtygkv~k~k~~~~~~~aa~kI~~~~~d~deEiE~eynil~~   71 (953)
T KOG0587|consen   15 PDPADIFEIIE--VIGNGTYGKVYKGRHVKTGQLAAIKIMDPTEDEEEEIELEYNMLKK   71 (953)
T ss_pred             CCCCCccEEEE--EEeeccceeEEEEeeeecCceeeeEeecCCccccHHHHHHHHHHHh
Confidence            34556664333  3888888999999876 9999999999998764  45555555544


No 293
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=59.53  E-value=24  Score=30.64  Aligned_cols=30  Identities=10%  Similarity=0.114  Sum_probs=26.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.++.|.||+|+.+ +|+.|+||+..++
T Consensus         7 ~~l~~g~~~~v~~~~~~~~~~~v~ik~~~~~   37 (305)
T cd05609           7 KLISNGAYGAVYLVRHKETRQRFAMKKINKQ   37 (305)
T ss_pred             eEeecCCCeeEEEEEECCCCcEEEEEEeehh
Confidence            56899999999999987 7899999987765


No 294
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=59.46  E-value=19  Score=31.08  Aligned_cols=46  Identities=20%  Similarity=0.325  Sum_probs=31.1

Q ss_pred             ccccceeeccceEEEEec-CCC--EEEEEecCCCcH----HHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGS--TIALKVQHRNVR----DNANIDIKCMEAL  203 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~--~VAVKVq~P~i~----~~i~~Dl~~l~~l  203 (227)
                      .+.++.++.|+||+|+++ +|.  .|++|+.+....    +.+..++.++..+
T Consensus         7 ~~~lg~g~~g~v~~~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~E~~~l~~l   59 (297)
T cd05089           7 EDVIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEFASENDHRDFAGELEVLCKL   59 (297)
T ss_pred             eeeecCCCcceEEEEEecCCCCcceeEEEEccccCCHHHHHHHHHHHHHHHhh
Confidence            357999999999999997 454  578887774433    2344455555443


No 295
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=59.45  E-value=18  Score=31.34  Aligned_cols=30  Identities=20%  Similarity=0.241  Sum_probs=25.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.+++++.|.||+|+-+ +|+.||+|.....
T Consensus        25 ~~lg~g~~g~v~~~~~~~~~~~vaiK~~~~~   55 (297)
T cd06656          25 EKIGQGASGTVYTAIDIATGQEVAIKQMNLQ   55 (297)
T ss_pred             eeeccCCCeEEEEEEECCCCCEEEEEEEecC
Confidence            56999999999999975 8999999987653


No 296
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=58.48  E-value=24  Score=30.06  Aligned_cols=34  Identities=24%  Similarity=0.319  Sum_probs=27.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDN  192 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~  192 (227)
                      ..++.++.|+||+|..+ +|..|++|.....-.+.
T Consensus        11 ~~lg~g~~g~v~~~~~~~~~~~~~~k~~~~~~~~~   45 (282)
T cd06643          11 GELGDGAFGKVYKAQNKETGVLAAAKVIDTKSEEE   45 (282)
T ss_pred             hhcccCCCeEEEEEEECCCCeEEEEEEeCCCCHHH
Confidence            45999999999999987 68899999887655443


No 297
>KOG0196|consensus
Probab=58.42  E-value=8.2  Score=40.05  Aligned_cols=73  Identities=18%  Similarity=0.257  Sum_probs=49.0

Q ss_pred             HhcCCCCCCHHHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEec-CC---CEEEEEecCCCcHHHHHHHHHH
Q psy4056         125 LHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLH-DG---STIALKVQHRNVRDNANIDIKC  199 (227)
Q Consensus       125 Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~-~G---~~VAVKVq~P~i~~~i~~Dl~~  199 (227)
                      ...-+.|+.+++--+.++ ||-++++--+..+| +-||++..|-|++|+|+ .|   ..||||-.+-|-.+.-+.|.-.
T Consensus       603 ~k~YiDP~TYEDPnqAvr-eFakEId~s~i~Ie-~VIGaGEFGEVc~GrLk~pgkre~~VAIKTLK~GytekqrrdFL~  679 (996)
T KOG0196|consen  603 TKTYIDPHTYEDPNQAVR-EFAKEIDPSCVKIE-KVIGAGEFGEVCSGRLKLPGKREITVAIKTLKAGYTEKQRRDFLS  679 (996)
T ss_pred             ceeecCCccccCccHHHH-HhhhhcChhheEEE-EEEecccccceecccccCCCCcceeEEEeeeccCccHHHHhhhhh
Confidence            444455665555444322 22233333333444 45999999999999999 55   4899999999999988888644


No 298
>KOG1094|consensus
Probab=58.41  E-value=12  Score=37.88  Aligned_cols=39  Identities=21%  Similarity=0.381  Sum_probs=33.8

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDI  197 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~~Dl  197 (227)
                      +-||++-.|-||...+.++..||||..||+..+.-+.|+
T Consensus       544 ekiGeGqFGEVhLCeveg~lkVAVK~Lr~~a~~~~r~~F  582 (807)
T KOG1094|consen  544 EKIGEGQFGEVHLCEVEGPLKVAVKILRPDATKNARNDF  582 (807)
T ss_pred             hhhcCcccceeEEEEecCceEEEEeecCcccchhHHHHH
Confidence            459999999999999977799999999999887765554


No 299
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=58.07  E-value=19  Score=30.06  Aligned_cols=43  Identities=14%  Similarity=0.261  Sum_probs=31.0

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcH-HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVR-DNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~-~~i~~Dl~~l~~  202 (227)
                      +-++.++.|+||+|.. .|+.|++|....+-. +.+..++.+++.
T Consensus        12 ~~lg~g~~~~v~~~~~-~~~~~~~k~~~~~~~~~~~~~e~~~l~~   55 (256)
T cd05082          12 QTIGKGEFGDVMLGDY-RGNKVAVKCIKNDATAQAFLAEASVMTQ   55 (256)
T ss_pred             eeecccCCCeEEEEEE-cCCcEEEEEeCCCchHHHHHHHHHHHHh
Confidence            4589999999999987 589999998765432 334455555443


No 300
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=57.94  E-value=23  Score=30.40  Aligned_cols=31  Identities=19%  Similarity=0.354  Sum_probs=25.0

Q ss_pred             cccceeeccceEEEEecC------CCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLHD------GSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~------G~~VAVKVq~P~i  189 (227)
                      +.++.++.|.||+|+.++      +..||||+.....
T Consensus        12 ~~lg~G~~g~Vy~~~~~~~~~~~~~~~vavK~~~~~~   48 (288)
T cd05061          12 RELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESA   48 (288)
T ss_pred             eeecCCCCcEEEEEEEeccCCCCcceEEEEEECCCcC
Confidence            569999999999998652      5589999876554


No 301
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=57.90  E-value=13  Score=31.36  Aligned_cols=33  Identities=12%  Similarity=0.157  Sum_probs=26.3

Q ss_pred             ccccceeeccceEEEEecCC----CEEEEEecCCCcH
Q psy4056         158 PNPMGAASLAQVHKATLHDG----STIALKVQHRNVR  190 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~~G----~~VAVKVq~P~i~  190 (227)
                      .+.++.++-|+||+|+..++    ..|+||+-+....
T Consensus        11 ~~~lg~g~~g~v~~~~~~~~~~~~~~v~ik~~~~~~~   47 (270)
T cd05056          11 GRCIGEGQFGDVYQGVYMSPENEKIAVAVKTCKNCTS   47 (270)
T ss_pred             eeeeCCccceeEEEEEEecCCCCCcceEEEecCCcCC
Confidence            35789999999999998743    4799998876653


No 302
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=57.34  E-value=13  Score=31.79  Aligned_cols=30  Identities=20%  Similarity=0.289  Sum_probs=23.4

Q ss_pred             cceeeccceEEEEecC-------------------------CCEEEEEecCCCcH
Q psy4056         161 MGAASLAQVHKATLHD-------------------------GSTIALKVQHRNVR  190 (227)
Q Consensus       161 iasASIaQVHrA~L~~-------------------------G~~VAVKVq~P~i~  190 (227)
                      ||.|+.|.||+|++..                         ...|+||+..+.-.
T Consensus         3 lG~G~~~~vy~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~k~~~~~~~   57 (274)
T cd05076           3 LGQGTRTNIYDGRLRVEGGGEPEEDEMEDEDPLVEGNNNGRELRVVLKVLDPSHR   57 (274)
T ss_pred             cCcccccceecceeEeccCCCCcccccccccccccccCCCeeeeEEEEecChHHH
Confidence            7899999999999741                         13699999887644


No 303
>KOG0597|consensus
Probab=57.33  E-value=11  Score=37.99  Aligned_cols=50  Identities=18%  Similarity=0.272  Sum_probs=35.4

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcHHHHHHHHHHHHHHHHHHHHh
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWV  210 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~  210 (227)
                      +-||-||.|-||+|+-| +++-||+|+.-..=+  -+.|+++++.-++++..+
T Consensus         8 e~iG~Gsfg~VYKgrrK~t~~~vAik~i~K~gr--~~k~l~~l~~ev~i~r~l   58 (808)
T KOG0597|consen    8 EMIGEGSFGRVYKGRRKYTIQVVAIKFIDKSGR--NEKELKNLRQEVRILRSL   58 (808)
T ss_pred             HHhcCCccceeeecccccceeEEEEEEehhcCC--chHHHHHHHHHHHHHHhc
Confidence            35899999999999998 889999998654322  344555555555555443


No 304
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=57.21  E-value=17  Score=32.48  Aligned_cols=30  Identities=23%  Similarity=0.454  Sum_probs=24.6

Q ss_pred             cccceeeccceEEEEec------CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH------DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~------~G~~VAVKVq~P~  188 (227)
                      +++|.++.|.||+|+..      +|+.||||+.+..
T Consensus        13 ~~lG~G~fg~Vy~a~~~~~~~~~~~~~va~K~~~~~   48 (337)
T cd05054          13 KPLGRGAFGKVIQASAFGIEKSASCRTVAVKMLKEG   48 (337)
T ss_pred             cccccCcCceEEeccccccccccccceeeeeeccCC
Confidence            67999999999999764      3578999987643


No 305
>PHA03211 serine/threonine kinase US3; Provisional
Probab=57.04  E-value=14  Score=35.44  Aligned_cols=42  Identities=7%  Similarity=0.057  Sum_probs=30.2

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCCCcHHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDNANIDIKCMEA  202 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~i~~Dl~~l~~  202 (227)
                      ...++.++.|.||+|+.. +|+.||||....   ..+..++.+++.
T Consensus       174 ~~~Lg~G~~G~Vy~a~~~~~~~~vavK~~~~---~~~~~E~~iL~~  216 (461)
T PHA03211        174 HRALTPGSEGCVFESSHPDYPQRVVVKAGWY---ASSVHEARLLRR  216 (461)
T ss_pred             EEEEccCCCeEEEEEEECCCCCEEEEecccc---cCHHHHHHHHHH
Confidence            356999999999999987 689999996432   233445555543


No 306
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=56.99  E-value=11  Score=33.56  Aligned_cols=28  Identities=18%  Similarity=0.370  Sum_probs=24.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      +.+|.++.|.||+++.+ +++.||+|+..
T Consensus         7 ~~lG~G~fg~V~~~~~~~~~~~~aiK~~~   35 (332)
T cd05623           7 KVIGRGAFGEVAVVKLKNADKVFAMKILN   35 (332)
T ss_pred             EEEEeCCCeEEEEEEECCCCCEEEEEEEe
Confidence            56999999999999988 67899999975


No 307
>KOG0581|consensus
Probab=56.53  E-value=16  Score=34.45  Aligned_cols=45  Identities=18%  Similarity=0.239  Sum_probs=39.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEec----CCCcHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQ----HRNVRDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq----~P~i~~~i~~Dl~~l~~l  203 (227)
                      .-+|+|+=|-|+++..+ +|+-.|.|+.    .|.+.+++...|.+++..
T Consensus        85 ~~lG~G~gG~V~kv~Hk~t~~i~AlK~I~~~~~~~~~~Qi~rEl~il~~~  134 (364)
T KOG0581|consen   85 GVLGSGNGGTVYKVRHKPTGKIYALKVILLNIDPALQKQILRELEILRSC  134 (364)
T ss_pred             hhcccCCCcEEEEEEEcCCCeEEEEEeecccCCHHHHHHHHHHHHHHhhC
Confidence            45999999999999998 8999999999    777788888888887653


No 308
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=56.43  E-value=17  Score=30.22  Aligned_cols=28  Identities=14%  Similarity=0.134  Sum_probs=24.6

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      +.++.++.|+|+.+.-+ +|+.||+|+.+
T Consensus         6 ~~lg~g~~g~v~~~~~~~~~~~~~iK~~~   34 (255)
T cd08219           6 RVVGEGSFGRALLVQHVNSDQKYAMKEIR   34 (255)
T ss_pred             EEeeccCCeEEEEEEEcCCCceEEEEEEE
Confidence            56899999999999987 79999999864


No 309
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=56.40  E-value=12  Score=31.65  Aligned_cols=31  Identities=23%  Similarity=0.403  Sum_probs=26.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      +.++.++.|+||+|+.+ +|+.||||+.+...
T Consensus         5 ~~lg~g~~~~v~~~~~~~~~~~~aik~~~~~~   36 (282)
T cd07831           5 GKIGEGTFSEVLKAQSRKTGKYYAIKCMKKHF   36 (282)
T ss_pred             eeccccccceEEEEEEcCCCcEEEEEEehhcc
Confidence            35889999999999987 79999999877654


No 310
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=56.09  E-value=22  Score=32.45  Aligned_cols=46  Identities=20%  Similarity=0.310  Sum_probs=32.1

Q ss_pred             ccccceeeccceEEEEec------CCCEEEEEecCCCcH----HHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH------DGSTIALKVQHRNVR----DNANIDIKCMEAL  203 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~------~G~~VAVKVq~P~i~----~~i~~Dl~~l~~l  203 (227)
                      .+.+|.++.|.||+|+..      +++.||||+.+....    +.+...+.+++.+
T Consensus        43 ~~~LG~G~fg~V~~~~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~E~~il~~l   98 (374)
T cd05106          43 GKTLGAGAFGKVVEATAFGLGKEDNVLRVAVKMLKASAHTDEREALMSELKILSHL   98 (374)
T ss_pred             hheecCCCcccEEEEEEecCCcccccceeEEEeccCCCCHHHHHHHHHHHHHHHhh
Confidence            367999999999999853      346899999876542    3344555555544


No 311
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They 
Probab=55.92  E-value=24  Score=28.92  Aligned_cols=30  Identities=23%  Similarity=0.284  Sum_probs=26.0

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.+..|.||++... +|++|++|+....
T Consensus         6 ~~l~~g~~~~v~~~~~~~~~~~~~ik~~~~~   36 (258)
T cd08215           6 KQIGKGSFGKVYLVRRKSDGKLYVLKEIDLS   36 (258)
T ss_pred             eeeccCCCeEEEEEEEcCCCcEEEEEEeecc
Confidence            56899999999999987 7999999997654


No 312
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=55.76  E-value=19  Score=29.67  Aligned_cols=30  Identities=27%  Similarity=0.227  Sum_probs=25.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      +.++.++.|.||+++-+ +|+.+++|+....
T Consensus         6 ~~i~~g~~~~v~~~~~~~~~~~~~ik~~~~~   36 (256)
T cd08530           6 KKLGKGSYGSVYKVKRLSDNQFYALKEVDLG   36 (256)
T ss_pred             eeecCCCceeEEEEEECCCCCEEEEEEEehh
Confidence            45888999999999866 8899999987654


No 313
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=55.52  E-value=26  Score=29.75  Aligned_cols=35  Identities=17%  Similarity=0.305  Sum_probs=27.2

Q ss_pred             cccceeeccceEEEEec------CCCEEEEEecCCCcHHHH
Q psy4056         159 NPMGAASLAQVHKATLH------DGSTIALKVQHRNVRDNA  193 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~------~G~~VAVKVq~P~i~~~i  193 (227)
                      +.++.++.|-||+|+..      +++.||||+.+.......
T Consensus        11 ~~lg~G~~g~V~~~~~~~~~~~~~~~~vaiK~~~~~~~~~~   51 (283)
T cd05091          11 EELGEDRFGKVYKGHLFGTAPGEQTQAVAIKTLKDKAEGPL   51 (283)
T ss_pred             HHhCCCCCCeEEEEEEecCCCCCceeEEEEEEccCCCCHHH
Confidence            35788999999999875      357899999986655443


No 314
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=55.21  E-value=16  Score=31.98  Aligned_cols=30  Identities=23%  Similarity=0.328  Sum_probs=24.5

Q ss_pred             cccceeeccceEEEEec----CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH----DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~----~G~~VAVKVq~P~  188 (227)
                      +.++.++.|.||+++-.    +|+.||||+.+..
T Consensus         2 ~~lg~G~~g~Vy~~~~~~~~~~~~~~aiK~~~~~   35 (318)
T cd05582           2 KVLGQGSFGKVFLVRKITGPDAGQLYAMKVLKKA   35 (318)
T ss_pred             ceeeeCCCEEEEEEEEeccCCCCCEEEEEEEEHH
Confidence            35899999999998753    6899999988653


No 315
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=55.19  E-value=29  Score=29.46  Aligned_cols=33  Identities=12%  Similarity=0.264  Sum_probs=26.5

Q ss_pred             cccceeeccceEEEEecC------CCEEEEEecCCCcHH
Q psy4056         159 NPMGAASLAQVHKATLHD------GSTIALKVQHRNVRD  191 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~------G~~VAVKVq~P~i~~  191 (227)
                      ++++.++.|+||+|..++      +..|++|........
T Consensus        12 ~~lg~g~~g~vy~~~~~~~~~~~~~~~v~ik~~~~~~~~   50 (277)
T cd05036          12 RALGHGAFGEVYEGLYRGRDGDAVELQVAVKTLPESCSE   50 (277)
T ss_pred             eECCCCCCCcEEEEEEecCCCCCCceeEEEEEcCCCCCH
Confidence            579999999999999974      568999987665543


No 316
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=55.16  E-value=14  Score=31.90  Aligned_cols=34  Identities=21%  Similarity=0.432  Sum_probs=26.4

Q ss_pred             cccceeeccceEEEEecC-------------CC--EEEEEecCCCcHHH
Q psy4056         159 NPMGAASLAQVHKATLHD-------------GS--TIALKVQHRNVRDN  192 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~-------------G~--~VAVKVq~P~i~~~  192 (227)
                      +.++.++.|.||+++..+             |+  .||||+.+++....
T Consensus        11 ~~lg~G~~g~v~~~~~~~~~~~~~~~~~~~~~~~~~vavK~~~~~~~~~   59 (295)
T cd05097          11 EKLGEGQFGEVHLCEAEGLAEFLGEGAPEFDGQPVLVAVKMLRADVTKT   59 (295)
T ss_pred             hccCCCCCceEEecccccchhhccccCcccCCCceEEEEEecCCCCCHH
Confidence            459999999999998642             22  59999999876543


No 317
>PF08667 BetR:  BetR domain;  InterPro: IPR013975 CheY-like phosphoacceptor (or receiver [REC]) domain is a common module in a variety of response regulators of the bacterial signal transduction systems. BetR is one of the many response regulators and is encoded mainly in Burkholderia spp. It is a N-terminal helix-turn-helix domain (HTH) and has been shown to be related to the XRE-type HTH domain (IPR001387 from INTERPRO), it has been suggested that BetR would have dimerization, protein-protein interaction, and activation/relief-of-inhibition properties [].
Probab=54.77  E-value=26  Score=28.89  Aligned_cols=90  Identities=18%  Similarity=0.249  Sum_probs=58.8

Q ss_pred             HHHHHHHHHHHHhcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCChhhhccccCccccc
Q psy4056          83 KEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMG  162 (227)
Q Consensus        83 ~~~a~~l~~~~~~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd~~Pia  162 (227)
                      ...+++++++|...|-.=-|-.+.++   ++|.-.+...-++|. .--|.+.+++.++ .+.||.+++++|..-+.+-..
T Consensus         4 ~~~~erV~~Ll~~~Gi~kr~~~s~LA---~iL~Is~ssa~RKL~-G~~~ftl~EI~~I-a~~fgvS~d~l~g~~~~~~~~   78 (147)
T PF08667_consen    4 QAIAERVRELLDRKGIPKRKHASELA---DILGISYSSAYRKLN-GKSPFTLEEIKKI-AKHFGVSPDELFGHSDNSGQN   78 (147)
T ss_pred             HHHHHHHHHHHHHcCCcchhhHHHHH---HHHCCCHHHHHHHhc-CCCCCCHHHHHHH-HHHhCcCHHHHHhhhhcccCC
Confidence            34688999999998866656556565   455556666666765 4455568888776 678999999999433332111


Q ss_pred             eeeccceEEEEecCC
Q psy4056         163 AASLAQVHKATLHDG  177 (227)
Q Consensus       163 sASIaQVHrA~L~~G  177 (227)
                      .+.-+-+|.|++..|
T Consensus        79 p~~~~~~~~ai~~~g   93 (147)
T PF08667_consen   79 PAAQNEMQDAIFYIG   93 (147)
T ss_pred             cchhhHHHhhhhhcc
Confidence            134455667777643


No 318
>KOG0577|consensus
Probab=54.59  E-value=7.5  Score=39.38  Aligned_cols=72  Identities=17%  Similarity=0.288  Sum_probs=45.2

Q ss_pred             HHHHHHHHhcCCChhhhccccCccccceeeccceEEEEec-CCCEEEEEecCCCcHHHHHHHHHHHHHHHHHHHHh-CCC
Q psy4056         136 DILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWV-FPE  213 (227)
Q Consensus       136 ~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~-~p~  213 (227)
                      +|..+|-+   .+++.+|.++.+  ||-||.|-||-|+-. +.+.||||=.--.=++..+.=-.|++- ++++..+ .|+
T Consensus        14 eiA~LF~k---~DPEklf~dLrE--IGHGSFGAVYfArd~~n~evVAIKKMsySGKQs~EKWqDIlKE-VrFL~~l~HPn   87 (948)
T KOG0577|consen   14 EIADLFFK---DDPEKLFSDLRE--IGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDILKE-VRFLRQLRHPN   87 (948)
T ss_pred             hHHHHHcc---CCHHHHHHHHHH--hcCCccceeEEeeccCccceeeeeeccccccccHHHHHHHHHH-HHHHHhccCCC
Confidence            44444443   478888876654  999999999999986 788999986544333333322233433 3444444 454


No 319
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=54.55  E-value=15  Score=37.88  Aligned_cols=30  Identities=13%  Similarity=0.108  Sum_probs=26.1

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      .+.++.+.-|.||+|+.+ +|+.||||....
T Consensus       695 ~~~ig~G~~g~Vy~~~~~~~~~~vavK~~~~  725 (968)
T PLN00113        695 ENVISRGKKGASYKGKSIKNGMQFVVKEIND  725 (968)
T ss_pred             ccEEccCCCeeEEEEEECCCCcEEEEEEccC
Confidence            457999999999999985 899999998754


No 320
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=54.14  E-value=19  Score=31.09  Aligned_cols=44  Identities=18%  Similarity=0.309  Sum_probs=30.4

Q ss_pred             cccceeeccceEEEEec-----------------CCCEEEEEecCCCcHH----HHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-----------------DGSTIALKVQHRNVRD----NANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-----------------~G~~VAVKVq~P~i~~----~i~~Dl~~l~~  202 (227)
                      +.++.++.|.||++..+                 ++..||||+.+.....    .+..++.+++.
T Consensus        11 ~~lg~G~~g~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~K~~~~~~~~~~~~~~~~E~~~l~~   75 (296)
T cd05095          11 EKLGEGQFGEVHLCEAEGMEKFMDKDFSLDVSGNQPVLVAVKMLREDANKNARNDFLKEIKIMSR   75 (296)
T ss_pred             eeccCCCCCeEEecccccccccccccccccCCCCceeEEEEEeccccCCHHHHHHHHHHHHHHHh
Confidence            46999999999998643                 3457999999876543    34444454443


No 321
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=54.04  E-value=30  Score=30.16  Aligned_cols=34  Identities=24%  Similarity=0.307  Sum_probs=28.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCcHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDN  192 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~  192 (227)
                      +.++.++.|.||+|... +|+.||+|+.+.+....
T Consensus         7 ~~lg~G~~g~v~~~~~~~~~~~~a~k~~~~~~~~~   41 (308)
T cd06615           7 GELGAGNGGVVTKVLHRPSGLIMARKLIHLEIKPA   41 (308)
T ss_pred             eeccCCCCeEEEEEEEcCCCeEEEEEEeccccCHH
Confidence            45899999999999977 78999999988765443


No 322
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=53.68  E-value=19  Score=32.80  Aligned_cols=28  Identities=14%  Similarity=0.260  Sum_probs=24.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      +.+|.++.|.||+|+.+ +|+.||+|+..
T Consensus        49 ~~lG~G~fg~Vy~~~~~~~~~~~aiK~~~   77 (370)
T cd05621          49 KVIGRGAFGEVQLVRHKSSQKVYAMKLLS   77 (370)
T ss_pred             EEEEecCCeEEEEEEECCCCCEEEEEEEE
Confidence            46999999999999987 68999999874


No 323
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=52.55  E-value=25  Score=29.02  Aligned_cols=44  Identities=16%  Similarity=0.212  Sum_probs=31.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC-c----HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN-V----RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~-i----~~~i~~Dl~~l~~  202 (227)
                      +.++.+..|.||+|... ++++||||+.... .    .+.+...+.+++.
T Consensus         6 ~~lg~g~~~~v~~~~~~~~~~~~~ik~~~~~~~~~~~~~~~~~e~~~l~~   55 (256)
T cd08220           6 RVVGRGAFGIVHLCRRKADQKLVIIKQIPVEQMTKDERLAAQNECQVLKL   55 (256)
T ss_pred             EEecccCceEEEEEEEcCCCcEEEEEEEeccccccHHHHHHHHHHHHHhh
Confidence            56899999999999986 7899999986543 1    2334444454443


No 324
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=51.82  E-value=25  Score=30.01  Aligned_cols=31  Identities=23%  Similarity=0.434  Sum_probs=24.9

Q ss_pred             cccceeeccceEEEEec-CCC----EEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGS----TIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~----~VAVKVq~P~i  189 (227)
                      +.+|.++-|.||+|+.. +|+    +|++|......
T Consensus        13 ~~lg~G~~~~vy~~~~~~~~~~~~~~~~~k~~~~~~   48 (279)
T cd05111          13 KLLGSGVFGTVHKGIWIPEGDSIKIPVAIKTIQDRS   48 (279)
T ss_pred             cccCccCCcceEEEEEcCCCCceeeEEEEeeccccc
Confidence            57999999999999986 565    58888876543


No 325
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=51.73  E-value=33  Score=28.78  Aligned_cols=31  Identities=19%  Similarity=0.394  Sum_probs=24.6

Q ss_pred             cccceeeccceEEEEecC-CC--EEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLHD-GS--TIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~-G~--~VAVKVq~P~i  189 (227)
                      +-++.++.|.||+|+..+ |+  .||||......
T Consensus         5 ~~ig~G~~g~V~~~~~~~~~~~~~~a~k~~~~~~   38 (272)
T cd05075           5 KTLGEGEFGSVMEGQLNQDDSILKVAVKTMKIAI   38 (272)
T ss_pred             cccCcccCceEEEeEEccCCCeeeEEEEecccCc
Confidence            358999999999999874 43  69999876654


No 326
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=51.69  E-value=36  Score=28.64  Aligned_cols=33  Identities=21%  Similarity=0.416  Sum_probs=26.3

Q ss_pred             cccceeeccceEEEEec-CCC---EEEEEecCCCcHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGS---TIALKVQHRNVRD  191 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~---~VAVKVq~P~i~~  191 (227)
                      +-++.++.|-||+|+.+ +|+   .||||+...+...
T Consensus        10 ~~lg~g~~g~vy~~~~~~~~~~~~~vaiK~~~~~~~~   46 (269)
T cd05065          10 EVIGAGEFGEVCRGRLKLPGKREIFVAIKTLKSGYTE   46 (269)
T ss_pred             eEecCCCCCeEEEEEEecCCCCceeEEEEEcCCCCCH
Confidence            45899999999999987 443   6999998876543


No 327
>COG3105 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=51.55  E-value=1e+02  Score=25.10  Aligned_cols=42  Identities=33%  Similarity=0.341  Sum_probs=26.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcChHHHHHHHHHHcC-CCCCcHH
Q psy4056          72 EEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGAL-EYLLPKE  117 (227)
Q Consensus        72 ~~~~~~~~~~h~~~a~~l~~~~~~lGg~~iKlGQ~lstr-~dllP~~  117 (227)
                      ++|.+....--.+.|+    ++..++--|-|+=|++|+. .+++|+.
T Consensus        51 d~~rqel~~HFa~sAe----Llktl~~dYqklyqHmA~ss~~Llpel   93 (138)
T COG3105          51 DEYRQELVKHFARSAE----LLKTLAQDYQKLYQHMAKSSTSLLPEL   93 (138)
T ss_pred             HHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHhhHhhhCccc
Confidence            4444444443333443    4555678899999999965 5688864


No 328
>PRK06148 hypothetical protein; Provisional
Probab=51.54  E-value=46  Score=35.28  Aligned_cols=57  Identities=25%  Similarity=0.334  Sum_probs=46.8

Q ss_pred             HhcCCCCCCHHHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEecCCCEEEEEecCCCc
Q psy4056         125 LHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNV  189 (227)
Q Consensus       125 Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i  189 (227)
                      +....|..+.+++++++++.+|..-       +-+|+++ .--++|+.+..+|+..++||-+|+-
T Consensus         4 ~~~~~p~~s~~~~~~~~~~~ygl~~-------~~~~L~s-~~d~nf~v~~~~g~~yVLKi~~~~~   60 (1013)
T PRK06148          4 LSHPAPEFTTKDAEALLAQHFGISA-------TATPLDG-ERDLNFRLTTDDGADYILKIVNPSE   60 (1013)
T ss_pred             CCCCCCCCCHHHHHHHHHHHcCCce-------EEeecCC-cCCceEEEEeCCCCeEEEEEcCCcc
Confidence            4556788999999999999999742       1257765 5689999998899999999999973


No 329
>KOG4250|consensus
Probab=51.45  E-value=9.5  Score=38.81  Aligned_cols=50  Identities=16%  Similarity=0.231  Sum_probs=37.3

Q ss_pred             ccCccccceeeccceEEEEec-CCCEEEEEecCC----CcHHHHHHHHHHHHHHH
Q psy4056         155 SIEPNPMGAASLAQVHKATLH-DGSTIALKVQHR----NVRDNANIDIKCMEALV  204 (227)
Q Consensus       155 ~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P----~i~~~i~~Dl~~l~~l~  204 (227)
                      ....+-+|-|--|+|++|+-+ .|+.||||+-++    --.+.....+.+|+.+-
T Consensus        15 W~~~e~LG~Ga~g~V~rgrnketG~~vAvK~~~~~~~~r~~e~~~~EieilkKLn   69 (732)
T KOG4250|consen   15 WEMDERLGKGAFGNVYRGRNKETGRLVAVKTFNKESSLRPRERWCREIEILKKLN   69 (732)
T ss_pred             eeehhhhcCCccceeeeecccccccchhHHhhhhhcccchHHHHHHHHHHHHHcC
Confidence            334567999999999999955 999999999877    33445556666666543


No 330
>PF12844 HTH_19:  Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B.
Probab=51.40  E-value=62  Score=21.55  Aligned_cols=63  Identities=19%  Similarity=0.239  Sum_probs=39.4

Q ss_pred             HHHHHHHHHhcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCChhhhccccC
Q psy4056          86 AEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIE  157 (227)
Q Consensus        86 a~~l~~~~~~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd  157 (227)
                      +++|++..++.|=+.-.+++.+...        ...++.....-...+ ......+.+.||.+++++|...|
T Consensus         1 G~~lk~~r~~~~lt~~~~a~~~~i~--------~~~i~~~e~g~~~~~-~~~l~~i~~~~~v~~~~l~~~~~   63 (64)
T PF12844_consen    1 GERLKELREEKGLTQKDLAEKLGIS--------RSTISKIENGKRKPS-VSTLKKIAEALGVSLDELFDGED   63 (64)
T ss_dssp             HHHHHHHHHHCT--HHHHHHHHTS---------HHHHHHHHTTSS--B-HHHHHHHHHHHTS-HHHHCCCHH
T ss_pred             CHHHHHHHHHcCCCHHHHHHHHCcC--------HHHHHHHHCCCcCCC-HHHHHHHHHHhCCCHHHHhccCC
Confidence            4577888888888888888876643        345555555544333 44456678999999999886543


No 331
>KOG0197|consensus
Probab=51.39  E-value=16  Score=35.59  Aligned_cols=43  Identities=14%  Similarity=0.254  Sum_probs=32.4

Q ss_pred             cceeeccceEEEEecCCCEEEEEecCCCcH--HHHHHHHHHHHHH
Q psy4056         161 MGAASLAQVHKATLHDGSTIALKVQHRNVR--DNANIDIKCMEAL  203 (227)
Q Consensus       161 iasASIaQVHrA~L~~G~~VAVKVq~P~i~--~~i~~Dl~~l~~l  203 (227)
                      ||+|-.|-||.|++.+..+||||.+.|+--  +.+.....+|+.+
T Consensus       214 LG~G~FG~V~~g~~~~~~~vavk~ik~~~m~~~~f~~Ea~iMk~L  258 (468)
T KOG0197|consen  214 LGSGQFGEVWLGKWNGSTKVAVKTIKEGSMSPEAFLREAQIMKKL  258 (468)
T ss_pred             hcCCccceEEEEEEcCCCcccceEEeccccChhHHHHHHHHHHhC
Confidence            788899999999996556999999999722  3444555565543


No 332
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=51.24  E-value=30  Score=29.15  Aligned_cols=32  Identities=22%  Similarity=0.373  Sum_probs=25.6

Q ss_pred             cccceeeccceEEEEec-CC---CEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLH-DG---STIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G---~~VAVKVq~P~i~  190 (227)
                      +-++.+..|+||+|+.+ +|   ..||+|..+++..
T Consensus        10 ~~lg~g~~g~v~~~~~~~~~~~~~~~~ik~~~~~~~   45 (267)
T cd05066          10 KVIGAGEFGEVCSGRLKLPGKREIPVAIKTLKAGYT   45 (267)
T ss_pred             eeecccCCCceEEEEEecCCCCceEEEEEECCCCCC
Confidence            56899999999999986 33   3799999887653


No 333
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=51.19  E-value=38  Score=28.79  Aligned_cols=31  Identities=16%  Similarity=0.286  Sum_probs=25.6

Q ss_pred             cccceeeccceEEEEec-----CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-----DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-----~G~~VAVKVq~P~i  189 (227)
                      +.++.++.|+||+|+..     +++.|++|...+.-
T Consensus        11 ~~lg~g~~g~vy~~~~~~~~~~~~~~~~ik~~~~~~   46 (283)
T cd05090          11 EELGECAFGKIYKGHLYLPGMDHAQLVAIKTLKDIN   46 (283)
T ss_pred             eeccccCCcceEEEEEecCCCCCcceEEEEeccCCC
Confidence            56899999999999863     56899999887644


No 334
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=51.18  E-value=14  Score=31.08  Aligned_cols=30  Identities=20%  Similarity=0.337  Sum_probs=24.5

Q ss_pred             ccceeeccceEEEEecC-------CCEEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLHD-------GSTIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~~-------G~~VAVKVq~P~i  189 (227)
                      .++.++.|.||+|+.++       ++.|+||....+.
T Consensus         2 ~lg~g~~g~vy~~~~~~~~~~~~~~~~~~iK~~~~~~   38 (269)
T cd05044           2 FLGSGAFGEVYEGTATDILGPGSGPIRVAVKTLRKGA   38 (269)
T ss_pred             ccccccceeEEeeeecccccCcccceeehhhhhhccc
Confidence            58999999999999863       3689999877665


No 335
>KOG0593|consensus
Probab=51.07  E-value=20  Score=33.51  Aligned_cols=43  Identities=23%  Similarity=0.264  Sum_probs=34.1

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecC-----CCcHHHHHHHHHHHHH
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQH-----RNVRDNANIDIKCMEA  202 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~-----P~i~~~i~~Dl~~l~~  202 (227)
                      -+|.||-|-|++.+-+ +|+-||||.=.     |.|.+.--.+++.|+.
T Consensus         9 kvGEGSYGvV~KCrnk~TgqIVAIKkF~Esedd~~VkKIAlREIrmLKq   57 (396)
T KOG0593|consen    9 KVGEGSYGVVMKCRNKDTGQIVAIKKFVESEDDPVVKKIALREIRMLKQ   57 (396)
T ss_pred             ccccCcceEEEEeccCCcccEEEEEeeccCCccHHHHHHHHHHHHHHHh
Confidence            3899999999999998 79999999754     5566666666666654


No 336
>KOG3622|consensus
Probab=50.97  E-value=2.2e+02  Score=30.99  Aligned_cols=120  Identities=15%  Similarity=0.088  Sum_probs=70.0

Q ss_pred             hhhhhhhheeEeec-cCccchhhHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCCcHHHHHHHHHHHHHHHHHHHHHH-Hh
Q psy4056          18 GSVIGGTGILLHRN-NYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELC-KM   95 (227)
Q Consensus        18 ~~~~~g~~~~~~~~-~~~~~~~~~~R~~R~~~~~~~i~~~y~~~l~~~~~~~~~~~~~~~~~~~~h~~~a~~l~~~~-~~   95 (227)
                      .+=++|.|+..|.+ +|++.   ..|+++.+..-.....||+..++..++ ..++++++...-++.+-.-..+--.+ .+
T Consensus       569 Lvk~l~~GL~Tyn~~rYkqf---~KriG~~~rhTl~yv~d~w~l~~~~nL-a~~~e~~eklQvE~d~l~lrA~~y~~~~~  644 (1572)
T KOG3622|consen  569 LVKILDNGLTTYNQPRYKQF---CKRIGISLRHTLRYVCDNWRLIRDQNL-ARPGEEHEKLQVEVDRLVLRALNYLIHQD  644 (1572)
T ss_pred             HHHHHHhhhhhcccHHHHHH---HHHHHHHHHHHHHHHhhhHHHHHhccc-cCChHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            34556778887722 33333   579999998889999999999888777 56666665444443221111111111 12


Q ss_pred             cChHHHHHHHHHHcCC-CCCcHHHHHHHH-HHhcCCCCCCHHHHHHHHHHhc
Q psy4056          96 NKGVYIKVGQHIGALE-YLLPKEYVETMK-VLHSKAPMSPMKDILAVLKEDL  145 (227)
Q Consensus        96 lGg~~iKlGQ~lstr~-dllP~~~~~~L~-~Lqd~~p~~~~~~v~~~l~~el  145 (227)
                      .=|+    =|++|+.+ +.+..|.+-.|- .|+...|.++-.++-..-+.++
T Consensus       645 ~LG~----wqf~sslPfgtls~e~~w~lfY~l~~~l~~~s~~~~~~~~~~~~  692 (1572)
T KOG3622|consen  645 TLGL----WQFVSSLPFGTLSEECRWRLFYALRSNLKKMSIHEIYDTPICEV  692 (1572)
T ss_pred             chhh----hhhhhcCCcccccHHHHHHHHHHHHccchhhhhhhcccchHHHh
Confidence            2233    38999987 457787665543 4444556666555444434333


No 337
>KOG0660|consensus
Probab=50.42  E-value=18  Score=33.96  Aligned_cols=29  Identities=24%  Similarity=0.337  Sum_probs=25.7

Q ss_pred             ccccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         158 PNPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      .+|+|.|+-|.|-.|+-+ +|+.||||=..
T Consensus        27 ~~~iG~GAyGvVcsA~~~~t~~~VAIKKi~   56 (359)
T KOG0660|consen   27 IEPIGRGAYGVVCSAKDKRTGEKVAIKKIL   56 (359)
T ss_pred             cccccCcceeeEEEEEEcCCCCEeehhhhh
Confidence            589999999999999988 89999999433


No 338
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=50.12  E-value=33  Score=30.20  Aligned_cols=45  Identities=18%  Similarity=0.200  Sum_probs=31.6

Q ss_pred             cccceeeccceEEEEec-C--CCEEEEEecCCCc-----HHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-D--GSTIALKVQHRNV-----RDNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~--G~~VAVKVq~P~i-----~~~i~~Dl~~l~~l  203 (227)
                      +.++.++-|.||+++.. +  |+.||||+.....     .+.+..++.+++.+
T Consensus         6 ~~lg~G~~g~vy~~~~~~~~~~~~~aiK~~~~~~~~~~~~~~~~~E~~~l~~l   58 (332)
T cd07857           6 KELGQGAYGIVCSARNAETSEEETVAIKKITNVFSKKILAKRALRELKLLRHF   58 (332)
T ss_pred             EEccccCCeEEEEEEeCCCCcCceEEEEEeccccccchhHHHHHHHHHHHHHh
Confidence            45889999999999987 4  7899999876432     23344455555443


No 339
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=49.43  E-value=34  Score=29.14  Aligned_cols=32  Identities=31%  Similarity=0.469  Sum_probs=26.4

Q ss_pred             cccceeeccceEEEEecC------CCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLHD------GSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~------G~~VAVKVq~P~i~  190 (227)
                      +++|.++-|.||+|..++      +..||+|+.+.+..
T Consensus        18 ~~ig~g~~g~v~~~~~~~~~~~~~~~~~a~k~~~~~~~   55 (293)
T cd05053          18 KPLGEGAFGQVVKAEAVGLDNPNETSTVAVKMLKDDAT   55 (293)
T ss_pred             eEecccccccEEEEEEecCCCCCCceeEEEEEccCCCC
Confidence            579999999999999862      36899999887644


No 340
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=49.23  E-value=29  Score=30.56  Aligned_cols=29  Identities=24%  Similarity=0.247  Sum_probs=25.2

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.++.+..|.||+|..+ +|+.||||..+.
T Consensus        13 ~~lg~g~~~~v~~~~~~~~~~~~~vK~~~~   42 (337)
T cd07852          13 QKLGKGAYGIVWKAIDRRTKEVVALKKIFD   42 (337)
T ss_pred             HhhcCCCCeeEEEEEEcCCCeEEEEEeecc
Confidence            56899999999999987 789999997754


No 341
>PRK11768 serine/threonine protein kinase; Provisional
Probab=48.08  E-value=1.1e+02  Score=27.67  Aligned_cols=70  Identities=13%  Similarity=0.011  Sum_probs=47.0

Q ss_pred             CCCCCHHHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEecCCCEEEEEecCCC--cHHHHHHHHHHHHHHHH
Q psy4056         129 APMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRN--VRDNANIDIKCMEALVH  205 (227)
Q Consensus       129 ~p~~~~~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~--i~~~i~~Dl~~l~~l~~  205 (227)
                      .+..+++.+...++.- |...+.-.     .+++ ..-.+||+-...+|+.+++||-+|+  -...+...+..+..+..
T Consensus         8 ~~~l~p~~~~~a~~~~-g~~~~~~~-----~~l~-s~eN~vy~v~~~~~~~~vlKv~r~~~~~~~~i~~E~~~l~~L~~   79 (325)
T PRK11768          8 FQTLTPDLILDALESL-GLRVDGRL-----LALN-SYENRVYQFGDEDGRRVVAKFYRPERWSDAQILEEHAFALELAE   79 (325)
T ss_pred             CCCCChHHHHHHHHHc-CCCCccce-----Eeec-cccceEEEEecCCCCEEEEEEcCcccCCHHHHHHHHHHHHHHHH
Confidence            4455667777777655 65432211     1222 2567899999888999999999987  46667777777766654


No 342
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=47.70  E-value=41  Score=28.03  Aligned_cols=28  Identities=29%  Similarity=0.299  Sum_probs=22.5

Q ss_pred             ccceeeccceEEEEecC----CCEEEEEecCC
Q psy4056         160 PMGAASLAQVHKATLHD----GSTIALKVQHR  187 (227)
Q Consensus       160 PiasASIaQVHrA~L~~----G~~VAVKVq~P  187 (227)
                      .++.++.|+||+|+..+    +..||+|....
T Consensus         2 ~lg~g~~g~v~~~~~~~~~~~~~~~aiK~~~~   33 (262)
T cd05058           2 VIGKGHFGCVYHGTLIDSDGQKIHCAVKSLNR   33 (262)
T ss_pred             cccccCCceEEEEEEecCCCceEEEEEEecCc
Confidence            47899999999999752    35899998654


No 343
>PF13443 HTH_26:  Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A.
Probab=47.66  E-value=45  Score=22.18  Aligned_cols=59  Identities=22%  Similarity=0.341  Sum_probs=31.5

Q ss_pred             HHHHHHhcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCChhhhccc
Q psy4056          89 LLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFAS  155 (227)
Q Consensus        89 l~~~~~~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~  155 (227)
                      |...+.+.|-..-++++-..     +++.   .++++...-+..+.-+.-..|.+.||.+++++|..
T Consensus         2 L~~~m~~~~it~~~La~~~g-----is~~---tl~~~~~~~~~~~~~~~l~~ia~~l~~~~~el~~~   60 (63)
T PF13443_consen    2 LKELMAERGITQKDLARKTG-----ISRS---TLSRILNGKPSNPSLDTLEKIAKALNCSPEELFEY   60 (63)
T ss_dssp             HHHHHHHTT--HHHHHHHHT-------HH---HHHHHHTTT-----HHHHHHHHHHHT--HHHCTEC
T ss_pred             HHHHHHHcCCCHHHHHHHHC-----cCHH---HHHHHHhcccccccHHHHHHHHHHcCCCHHHHhhc
Confidence            55666777777777776554     3332   44555554433344455566799999999999853


No 344
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=47.62  E-value=30  Score=30.09  Aligned_cols=46  Identities=22%  Similarity=0.274  Sum_probs=32.2

Q ss_pred             ccccceeeccceEEEEec------CCCEEEEEecCCCcHH----HHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH------DGSTIALKVQHRNVRD----NANIDIKCMEAL  203 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~------~G~~VAVKVq~P~i~~----~i~~Dl~~l~~l  203 (227)
                      .+.++.++.|+||+|+..      ++..||||+.+.....    .+...+.+++.+
T Consensus        40 ~~~ig~G~~g~V~~~~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~E~~~l~~l   95 (302)
T cd05055          40 GKTLGAGAFGKVVEATAYGLSKSDAVMKVAVKMLKPTAHSSEREALMSELKIMSHL   95 (302)
T ss_pred             cceeeccCCeeEEEEEEecCCCCCceeEEEEEecCccCChHHHHHHHHHHHHHHhc
Confidence            457999999999999853      4568999988766543    344455555443


No 345
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=45.75  E-value=36  Score=28.67  Aligned_cols=45  Identities=11%  Similarity=0.242  Sum_probs=31.7

Q ss_pred             cccceeeccceEEEEec------CCCEEEEEecCCCcH----HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH------DGSTIALKVQHRNVR----DNANIDIKCMEAL  203 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~------~G~~VAVKVq~P~i~----~~i~~Dl~~l~~l  203 (227)
                      .-++.++.|.||+|+.+      +.+.|++|+-...-.    +.+..++.+++.+
T Consensus        11 ~~lg~g~~g~v~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~E~~~l~~l   65 (275)
T cd05046          11 TTLGRGEFGEVFLAKAKGIEEEGGETLVLVKALQKTKDENLQSEFRRELDMFRKL   65 (275)
T ss_pred             eeecccceeEEEEEEeccCCcCCCcceEEEEccCCccchHHHHHHHHHHHHHHhc
Confidence            34899999999999976      346899998865433    3455555655543


No 346
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.70  E-value=74  Score=28.87  Aligned_cols=67  Identities=18%  Similarity=0.230  Sum_probs=54.3

Q ss_pred             HHHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEecCCCEEEEEecCCCcHHHHHHHHHHHHHHHHH
Q psy4056         134 MKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHV  206 (227)
Q Consensus       134 ~~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~  206 (227)
                      |..|-+.+.+.+|..  ++   -+.+++..+.|-|.++-.. +..++-||++.-.-...+.+...-|+.+++-
T Consensus         2 w~~i~~qlse~~g~~--~i---~er~~v~gG~inea~~v~d-g~~~~FvK~n~~~~~~~f~AEa~gL~~la~s   68 (286)
T COG3001           2 WQAISQQLSEQLGEG--EI---KEREEVSGGDINEAWRLRD-GTDPFFVKCNQREQLSMFTAEADGLELLARS   68 (286)
T ss_pred             hHHHHHHHHHHhCch--hh---hcccccCCccccceeEeec-CCcceEEEecchhhHHHHHHHHHHHHHHHhc
Confidence            678889999999987  32   2457788888888776553 5569999999999999999999999988865


No 347
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=45.67  E-value=32  Score=29.10  Aligned_cols=34  Identities=9%  Similarity=0.197  Sum_probs=28.0

Q ss_pred             cccceeeccceEEEEecC-----CCEEEEEecCCCcHHH
Q psy4056         159 NPMGAASLAQVHKATLHD-----GSTIALKVQHRNVRDN  192 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~-----G~~VAVKVq~P~i~~~  192 (227)
                      +-++.+..|.||+|...+     +..|++|+...+....
T Consensus        12 ~~i~~g~~g~V~~~~~~~~~~~~~~~v~~k~~~~~~~~~   50 (280)
T cd05043          12 DLLQEGTFGRIFYGILIDEKPGKEEEVFVKTVKDHASEI   50 (280)
T ss_pred             eeecccCCceEEEEEEecCCCCceeEEEEEEccCCCCHH
Confidence            458999999999999986     7899999987665433


No 348
>KOG0201|consensus
Probab=44.63  E-value=23  Score=34.32  Aligned_cols=53  Identities=19%  Similarity=0.362  Sum_probs=38.3

Q ss_pred             CChhhhccccCccccceeeccceEEEEec-CCCEEEEEecCCCcHHH----HHHHHHHHH
Q psy4056         147 KDPSEIFASIEPNPMGAASLAQVHKATLH-DGSTIALKVQHRNVRDN----ANIDIKCME  201 (227)
Q Consensus       147 ~~~~~~F~~fd~~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~----i~~Dl~~l~  201 (227)
                      .++...|..+  +-|+-+|.|-||+|.-. .++.||+||..=+-.+-    +..|+..+.
T Consensus         9 ~~~~~~~~~~--~~IgrGsfG~Vyk~~d~~t~k~vAiKii~Le~~~deIediqqei~~Ls   66 (467)
T KOG0201|consen    9 IDPELLYTKL--ELIGRGSFGEVYKAIDNKTKKVVAIKIIDLEEAEDEIEDIQQEISVLS   66 (467)
T ss_pred             CCcccccccc--hhccccccceeeeeeeccccceEEEEEechhhcchhhHHHHHHHHHHH
Confidence            3556677776  45999999999999975 78999999987544333    444555443


No 349
>KOG0580|consensus
Probab=44.50  E-value=23  Score=32.05  Aligned_cols=45  Identities=24%  Similarity=0.293  Sum_probs=35.3

Q ss_pred             ccC-ccccceeeccceEEEEec-CCCEEEEEecC------CCcHHHHHHHHHH
Q psy4056         155 SIE-PNPMGAASLAQVHKATLH-DGSTIALKVQH------RNVRDNANIDIKC  199 (227)
Q Consensus       155 ~fd-~~PiasASIaQVHrA~L~-~G~~VAVKVq~------P~i~~~i~~Dl~~  199 (227)
                      +|| ..|+|=|=.|+||.|+.+ ++--||+||..      -++++++...+.+
T Consensus        23 dfeigr~LgkgkFG~vYlarekks~~IvalKVlfKsqi~~~~v~~qlrREiEI   75 (281)
T KOG0580|consen   23 DFEIGRPLGKGKFGNVYLAREKKSLFIVALKVLFKSQILKTQVEHQLRREIEI   75 (281)
T ss_pred             hccccccccCCccccEeEeeeccCCcEEEEeeeeHHHHHHhcchhhhhheeEe
Confidence            455 579999999999999998 78899999864      4566666666554


No 350
>KOG0668|consensus
Probab=44.29  E-value=36  Score=30.84  Aligned_cols=30  Identities=13%  Similarity=0.241  Sum_probs=27.8

Q ss_pred             cCCCEEEEEecCCCcHHHHHHHHHHHHHHH
Q psy4056         175 HDGSTIALKVQHRNVRDNANIDIKCMEALV  204 (227)
Q Consensus       175 ~~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~  204 (227)
                      .|.++++|||..|==.+.|..++.+|+.+.
T Consensus        61 ~~~eK~ViKiLKPVkkkKIkREikIL~nL~   90 (338)
T KOG0668|consen   61 TNNEKCVIKILKPVKKKKIKREIKILQNLR   90 (338)
T ss_pred             CCCceEEEeeechHHHHHHHHHHHHHHhcc
Confidence            489999999999999999999999998876


No 351
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=44.27  E-value=53  Score=27.78  Aligned_cols=31  Identities=16%  Similarity=0.282  Sum_probs=24.9

Q ss_pred             cccceeeccceEEEEec------CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH------DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~------~G~~VAVKVq~P~i  189 (227)
                      +.++.++.|+||+|+.+      +++.||||+.+...
T Consensus        12 ~~ig~G~~g~v~~~~~~~~~~~~~~~~~aik~~~~~~   48 (277)
T cd05062          12 RELGQGSFGMVYEGIAKGVVKDEPETRVAIKTVNEAA   48 (277)
T ss_pred             eeeccccCCeEEEEEeccCCCCCceeEEEEEeccccC
Confidence            56899999999999864      35789999887653


No 352
>PHA02882 putative serine/threonine kinase; Provisional
Probab=43.73  E-value=20  Score=31.07  Aligned_cols=29  Identities=10%  Similarity=0.194  Sum_probs=23.6

Q ss_pred             cccceeeccceEEEEecC----CCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLHD----GSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~----G~~VAVKVq~P  187 (227)
                      +-+|.|+.|.||+|...+    +..+|+|+...
T Consensus        18 ~~LG~G~fG~Vy~~~~~~~~~~~~~~~~k~~~~   50 (294)
T PHA02882         18 KLIGCGGFGCVYETQCASDHCINNQAVAKIENL   50 (294)
T ss_pred             eEEecCCCceEEEEEEcCCcccccceEEEeccc
Confidence            459999999999999874    56888887543


No 353
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=43.55  E-value=39  Score=28.03  Aligned_cols=28  Identities=14%  Similarity=0.184  Sum_probs=23.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQH  186 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~  186 (227)
                      +.++.++.|+|+.++.. +|+.|++|.-.
T Consensus         6 ~~ig~g~~g~v~~~~~~~~~~~~~~k~~~   34 (256)
T cd08221           6 RVLGKGAFGEATLYRRTEDDSLVVWKEVN   34 (256)
T ss_pred             eEecccCCceEEEEEEcCCCcEEEEEEEe
Confidence            46899999999988876 79999999643


No 354
>KOG0200|consensus
Probab=43.25  E-value=48  Score=32.93  Aligned_cols=32  Identities=31%  Similarity=0.372  Sum_probs=27.9

Q ss_pred             ccceeeccceEEEEec----C----CCEEEEEecCCCcHH
Q psy4056         160 PMGAASLAQVHKATLH----D----GSTIALKVQHRNVRD  191 (227)
Q Consensus       160 PiasASIaQVHrA~L~----~----G~~VAVKVq~P~i~~  191 (227)
                      ++|++-.|||++|.++    .    -..||||....+...
T Consensus       303 ~lg~g~fG~v~~~~~~~~~~~~~~~~~~VaVK~~k~~~~~  342 (609)
T KOG0200|consen  303 YLGEGAFGQVVKALLFGLSKALLSIYVTVAVKMLKENASS  342 (609)
T ss_pred             eeecccccceEeEEEeecccccccceEEEEEEecccccCc
Confidence            9999999999999987    1    358999999888876


No 355
>KOG1035|consensus
Probab=41.78  E-value=17  Score=39.37  Aligned_cols=56  Identities=16%  Similarity=0.246  Sum_probs=38.9

Q ss_pred             hhccccCc-cccceeeccceEEEEec-CCCEEEEE-ecCCCcHHHHHHHHHHHHHHHHH
Q psy4056         151 EIFASIEP-NPMGAASLAQVHKATLH-DGSTIALK-VQHRNVRDNANIDIKCMEALVHV  206 (227)
Q Consensus       151 ~~F~~fd~-~PiasASIaQVHrA~L~-~G~~VAVK-Vq~P~i~~~i~~Dl~~l~~l~~~  206 (227)
                      ..+.+|++ .++|=|-.|+|++++=| ||++.||| |..+.-.+.....++=.+.++++
T Consensus       476 RY~~DFEEL~lLGkGGFG~VvkVRNKlDGr~YAIKKIpl~~s~~~~skI~rEVk~LArL  534 (1351)
T KOG1035|consen  476 RYLNDFEELELLGKGGFGSVVKVRNKLDGREYAIKKIPLKASDKLYSKILREVKLLARL  534 (1351)
T ss_pred             hHhhhhHHHHHhcCCCCceEEEEeecccchhhhhhhccCchHHHHHHHHHHHHHHHhhc
Confidence            35566765 78999999999999998 99999998 44444344444444444444443


No 356
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning]
Probab=41.46  E-value=28  Score=31.51  Aligned_cols=35  Identities=20%  Similarity=0.208  Sum_probs=30.0

Q ss_pred             ccceeeccceEEEEecCCCEEEEEecCCCcHHHHH
Q psy4056         160 PMGAASLAQVHKATLHDGSTIALKVQHRNVRDNAN  194 (227)
Q Consensus       160 PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~  194 (227)
                      |+.+|==|-||+|.-.+|..|||||.+......-.
T Consensus        55 ~istGKEA~Vy~a~~~~~~~~avKiyr~~t~~fk~   89 (268)
T COG1718          55 CISTGKEANVYLAETGDGRYVAVKIYRTSTSEFKR   89 (268)
T ss_pred             eecCCcceEEEeeccCCCceEEEEEEehhhhhhhh
Confidence            78888889999999989999999999987665433


No 357
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=40.66  E-value=60  Score=28.59  Aligned_cols=46  Identities=22%  Similarity=0.356  Sum_probs=30.8

Q ss_pred             ccccceeeccceEEEEec--------CCCEEEEEecCCCcHH----HHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLH--------DGSTIALKVQHRNVRD----NANIDIKCMEAL  203 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~--------~G~~VAVKVq~P~i~~----~i~~Dl~~l~~l  203 (227)
                      ..+++.++.|+||.|+-.        .+..||+|+.......    .+..++.+++.+
T Consensus        17 ~~~ig~G~~g~v~~~~~~~~~~~~~~~~~~vaiK~~~~~~~~~~~~~~~~E~~~l~~l   74 (334)
T cd05100          17 GKPLGEGCFGQVVMAEAIGIDKDKPNKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMI   74 (334)
T ss_pred             cceeccccCCcEEEEEEeccCCccCCcceeEEEEEcccccCHHHHHHHHHHHHHHHhh
Confidence            358999999999999753        1247999988755433    344445554433


No 358
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=40.53  E-value=40  Score=28.67  Aligned_cols=28  Identities=7%  Similarity=0.052  Sum_probs=25.0

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      ++.++.|+|++++-+ +|+.+|+|+-.+.
T Consensus        24 lg~g~~g~v~~~~~~~~~~~~~~k~~~~~   52 (267)
T PHA03390         24 LIDGKFGKVSVLKHKPTQKLFVQKIIKAK   52 (267)
T ss_pred             ecCCCceEEEEEEEcCCCcEEEEEEEehh
Confidence            699999999999987 8899999997764


No 359
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=40.13  E-value=26  Score=34.29  Aligned_cols=31  Identities=10%  Similarity=0.212  Sum_probs=24.9

Q ss_pred             ccccceeeccceEEEEe-----------------cCCCEEEEEecCCC
Q psy4056         158 PNPMGAASLAQVHKATL-----------------HDGSTIALKVQHRN  188 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L-----------------~~G~~VAVKVq~P~  188 (227)
                      .+-||.|+.|.||+|.+                 .+|+.||||..+..
T Consensus       150 ~~~LG~GgFG~VYkG~~~~~~~~~v~~~~~~~~~~~~r~VAVK~l~~~  197 (507)
T PLN03224        150 RDKLGGGNFGITFEGLRLQADDQGVTQRSKLTAEQKKRRVVLKRVNMD  197 (507)
T ss_pred             eeEeecCCCeEEEEEEecccccchhhhhccccccccCceEEEEEeccc
Confidence            36799999999999975                 25678999987643


No 360
>KOG0983|consensus
Probab=39.68  E-value=27  Score=32.40  Aligned_cols=40  Identities=25%  Similarity=0.405  Sum_probs=29.9

Q ss_pred             ccceeeccceEEEEec-CCCEEEEEecCCCc-H---HHHHHHHHH
Q psy4056         160 PMGAASLAQVHKATLH-DGSTIALKVQHRNV-R---DNANIDIKC  199 (227)
Q Consensus       160 PiasASIaQVHrA~L~-~G~~VAVKVq~P~i-~---~~i~~Dl~~  199 (227)
                      -+|++|-|||.+++.+ .|.-.|||-.+-.= .   ++|-.|+.+
T Consensus        99 dlGsGtcG~V~k~~~rs~~~iiAVK~M~rt~Nkee~kRILmDldv  143 (391)
T KOG0983|consen   99 DLGSGTCGQVWKMRFRSTGHIIAVKQMRRTGNKEENKRILMDLDV  143 (391)
T ss_pred             hhcCCCccceEEEEEcccceEEEEEeecccCCHHHHHHHHHhhhH
Confidence            4899999999999998 79999999766432 2   234455554


No 361
>PF02520 DUF148:  Domain of unknown function DUF148;  InterPro: IPR003677 This entry represents the domain DUF148, which has no known function.
Probab=38.62  E-value=1.7e+02  Score=22.14  Aligned_cols=63  Identities=10%  Similarity=0.168  Sum_probs=49.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHhcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCCCCHHHHHHH
Q psy4056          76 NLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAV  140 (227)
Q Consensus        76 ~~~~~~h~~~a~~l~~~~~~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~  140 (227)
                      ......+...-+.+-..+.+|+.++-|+-.++. ..++-+.+-.+.+..|.++.|+. ...+.-+
T Consensus        43 ~~~~~~~~~~~~~~~~vi~~L~~a~~~l~~I~~-n~~lT~~q~~~~I~~l~~~~~~e-~~~l~~i  105 (113)
T PF02520_consen   43 AQVQAQKEEVRKNVTAVISNLSSAFAKLSAILD-NKSLTRQQQQEAIDALRKQYPEE-VDTLFFI  105 (113)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc-CcccCHHHHHHHHHHHHHHCCHH-HHHHHHH
Confidence            334455566667788888999999999999998 44588899999999999999988 4444333


No 362
>PF15508 NAAA-beta:  beta subunit of N-acylethanolamine-hydrolyzing acid amidase
Probab=38.37  E-value=1.3e+02  Score=22.31  Aligned_cols=30  Identities=23%  Similarity=0.299  Sum_probs=20.9

Q ss_pred             HHHHHHHHHHcCCCCCcHHHHHHHHHHhcC
Q psy4056          99 VYIKVGQHIGALEYLLPKEYVETMKVLHSK  128 (227)
Q Consensus        99 ~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~  128 (227)
                      ++-.+.++++.....+|++|.++++.+-+.
T Consensus        49 ~~~~v~~~~~~l~~~~~~~~~~EirGIA~~   78 (95)
T PF15508_consen   49 VLDFVDKLLPHLLRYLPQPYAEEIRGIAKA   78 (95)
T ss_pred             HHHHHHHHHHHHHHhCCHHHHHHHHHHHHH
Confidence            555566666655567788888888877543


No 363
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=37.83  E-value=56  Score=27.33  Aligned_cols=29  Identities=21%  Similarity=0.271  Sum_probs=24.6

Q ss_pred             cccceeeccceEEEEecC--CCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLHD--GSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~--G~~VAVKVq~P  187 (227)
                      +.++.+..|.||+|..++  ++.||||....
T Consensus         6 ~~ig~G~~~~v~~~~~~~~~~~~~avk~~~~   36 (269)
T cd08528           6 EHLGSGAFGCVYKVRKKNNGQNLLALKEINV   36 (269)
T ss_pred             hhhcCCCCceEEEEEEcCCCCceeeeeEeec
Confidence            458999999999999985  68999998654


No 364
>KOG0582|consensus
Probab=36.99  E-value=78  Score=31.02  Aligned_cols=50  Identities=20%  Similarity=0.353  Sum_probs=36.3

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCCCcHHHHHHHHHHHHHHHHHHHHh-CCC
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWV-FPE  213 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~-~p~  213 (227)
                      ||.|-=|+||+|+-. .|+.||||+..  ++ ....|+..++.-...+..+ .|+
T Consensus        34 IG~G~sa~V~~A~c~p~~e~VAIK~in--LE-kc~~~ld~l~kE~~~msl~~HPN   85 (516)
T KOG0582|consen   34 IGVGASAVVYLARCIPTNEVVAIKIIN--LE-KCNNDLDALRKEVQTMSLIDHPN   85 (516)
T ss_pred             EeccceeEeeeeeecccCCEEEEEEee--hh-hhhhhHHHHHHHHHHhhhcCCCC
Confidence            666655999999987 78999999874  33 4566677777777666554 344


No 365
>KOG2052|consensus
Probab=36.99  E-value=46  Score=32.52  Aligned_cols=45  Identities=11%  Similarity=0.228  Sum_probs=35.9

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcHHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALV  204 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~  204 (227)
                      +-||.|=.|-|.||.+ -|+.|||||=.--=++.....-.+.+.++
T Consensus       217 e~IGkGRyGEVwrG~w-rGe~VAVKiF~srdE~SWfrEtEIYqTvm  261 (513)
T KOG2052|consen  217 EIIGKGRFGEVWRGRW-RGEDVAVKIFSSRDERSWFRETEIYQTVM  261 (513)
T ss_pred             EEecCccccceeeccc-cCCceEEEEecccchhhhhhHHHHHHHHH
Confidence            4589999999999999 59999999977777777666666665544


No 366
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=36.89  E-value=67  Score=27.39  Aligned_cols=32  Identities=28%  Similarity=0.402  Sum_probs=25.4

Q ss_pred             cccceeeccceEEEEec------CCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLH------DGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~------~G~~VAVKVq~P~i~  190 (227)
                      +.++.++.|.||+|+..      ++..|++|+.+.+..
T Consensus         6 ~~lg~g~~g~vy~~~~~~~~~~~~~~~~~~k~~~~~~~   43 (290)
T cd05045           6 KTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENAS   43 (290)
T ss_pred             ccccCcCCcceEEEEEecCCCCCcceeEEEEecCCCCC
Confidence            45889999999999864      336899999887654


No 367
>KOG1164|consensus
Probab=36.55  E-value=49  Score=29.58  Aligned_cols=48  Identities=15%  Similarity=0.249  Sum_probs=37.9

Q ss_pred             ccccceeeccceEEEEecCC--CEEEEEecCCCcHH---HHHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLHDG--STIALKVQHRNVRD---NANIDIKCMEALVH  205 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~~G--~~VAVKVq~P~i~~---~i~~Dl~~l~~l~~  205 (227)
                      ...+|+++.||||.+.-.+.  +.+|+|+.......   .+..+..++..+..
T Consensus        23 ~~~iG~G~fG~V~~v~~~~~~~~~~a~K~e~~~~~~~~~~l~~E~~vl~~l~~   75 (322)
T KOG1164|consen   23 GKKIGEGGFGAVYLVSDKSEKNKEYAKKLEKKELGSKPSVLKIEIQVLKKLEK   75 (322)
T ss_pred             eeeccccCCceEEEEEecCCCCeeEEEEEEEecccCCCccchhHHHHHHHHhh
Confidence            46799999999999997643  58999999875433   57778888777765


No 368
>KOG4717|consensus
Probab=36.36  E-value=20  Score=35.88  Aligned_cols=22  Identities=32%  Similarity=0.489  Sum_probs=16.1

Q ss_pred             ccceEEEEec------CCCEEEEEecCC
Q psy4056         166 LAQVHKATLH------DGSTIALKVQHR  187 (227)
Q Consensus       166 IaQVHrA~L~------~G~~VAVKVq~P  187 (227)
                      |||=|-|+.|      .|++|||||.-.
T Consensus        26 lG~GHFAVVKLArHVFTGekVAVKviDK   53 (864)
T KOG4717|consen   26 LGRGHFAVVKLARHVFTGEKVAVKVIDK   53 (864)
T ss_pred             hcCCceehhhhhhhhcccceeEEEEecc
Confidence            5555666654      899999998654


No 369
>PF11932 DUF3450:  Protein of unknown function (DUF3450);  InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function. However, they are found in an operon along with components of a TonB transport system (typified by Vibrio cholerae TonB2 [], and are predicted to be localized to the periplasmic space. Caution: the low-complexity nature of these sequences produces spurious BLAST hits to chromosome segregation ATPases (which are much longer in length and contain canonical Walker motifs). Accordingly, some members are misidentified as such.
Probab=35.75  E-value=2.7e+02  Score=24.22  Aligned_cols=76  Identities=18%  Similarity=0.151  Sum_probs=42.6

Q ss_pred             HHHHHHHHHcCCCCCcHHHHHHHHHHhc---CCCCCCHHHHHHHHH-----HhcCCChhhhccccCccccceeeccceEE
Q psy4056         100 YIKVGQHIGALEYLLPKEYVETMKVLHS---KAPMSPMKDILAVLK-----EDLGKDPSEIFASIEPNPMGAASLAQVHK  171 (227)
Q Consensus       100 ~iKlGQ~lstr~dllP~~~~~~L~~Lqd---~~p~~~~~~v~~~l~-----~elG~~~~~~F~~fd~~PiasASIaQVHr  171 (227)
                      .-.|-+++.....+..++-.+.+..|.+   +..-.+-+..+.+++     .++|..+                  .||.
T Consensus       111 ~~~L~~~v~~d~Pf~~~eR~~Rl~~L~~~l~~~dv~~~ek~r~vlea~~~E~~yg~~i------------------~~~~  172 (251)
T PF11932_consen  111 IDELEQFVELDLPFLLEERQERLARLRAMLDDADVSLAEKFRRVLEAYQIEMEYGRTI------------------EVYQ  172 (251)
T ss_pred             HHHHHHHHhcCCCCChHHHHHHHHHHHHhhhccCCCHHHHHHHHHHHHHHHHHhCCce------------------eEEE
Confidence            3344555555544555655554444444   333333344555533     3444433                  3588


Q ss_pred             EEec-CCCEEEEEecCCCcHHHH
Q psy4056         172 ATLH-DGSTIALKVQHRNVRDNA  193 (227)
Q Consensus       172 A~L~-~G~~VAVKVq~P~i~~~i  193 (227)
                      +++. ||+++-|.+.|=|--..+
T Consensus       173 ~~i~~dG~~~~V~~LrlGr~~l~  195 (251)
T PF11932_consen  173 GTITLDGEERQVDFLRLGRVALY  195 (251)
T ss_pred             EEEeECCeEEEEEEEeecchhhe
Confidence            8876 899999998887765443


No 370
>KOG0591|consensus
Probab=35.62  E-value=52  Score=30.63  Aligned_cols=34  Identities=29%  Similarity=0.430  Sum_probs=25.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEE-ecCCCcHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALK-VQHRNVRDN  192 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVK-Vq~P~i~~~  192 (227)
                      +-||-||.|-||++.-. ||..||.| ||+-.+...
T Consensus        25 ~~IG~GsFg~vykv~~~~~g~l~a~K~i~f~~md~k   60 (375)
T KOG0591|consen   25 KKIGRGSFGEVYKVQCLLDGKLVALKKIQFGMMDAK   60 (375)
T ss_pred             HHHcCCcchheEEeeeccCcchhhhhhcchhhccHH
Confidence            35889999999999765 99999987 444444433


No 371
>PF03298 Stanniocalcin:  Stanniocalcin family;  InterPro: IPR004978  Stanniocalcin (STC) is a calcium- and phosphate-regulating hormone produced in bony fish by the corpuscles of Stannius, which are located close to the kidney. It is a major antihypercalcemic hormone in fish. Recent results suggest that the biological repertoires of STCs in mammals will be considerably larger than in fish and may not be limited to mineral metabolism.; GO: 0005179 hormone activity, 0005576 extracellular region
Probab=34.91  E-value=26  Score=30.52  Aligned_cols=66  Identities=17%  Similarity=0.266  Sum_probs=49.5

Q ss_pred             hcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCChhhhccccCcccccee
Q psy4056          95 MNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAA  164 (227)
Q Consensus        95 ~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd~~PiasA  164 (227)
                      .|-..+.++-|    -+|+||..+..+|-..--.+....-+.++.-+...+|.++..+|..+...|-++.
T Consensus       140 ~N~~ai~evvq----~~dlF~~r~y~ellq~ll~C~e~~~~~~~~~~~~~~g~~~~~l~~~lq~~~~~~~  205 (208)
T PF03298_consen  140 SNPEAIVEVVQ----FPDLFPNRYYVELLQSLLECDEETVEAVRDSLMSQLGPNMASLFQLLQNCPCASQ  205 (208)
T ss_pred             hChHHHHHhee----chhhcCchHHHHHHHHHHhccHHHHHHHHHHHHHHHhhhHHHHHHHhccCCCcCC
Confidence            34444444444    3678998877777777777777788889999999999999999988877766543


No 372
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning]
Probab=34.64  E-value=66  Score=29.10  Aligned_cols=42  Identities=19%  Similarity=0.125  Sum_probs=33.9

Q ss_pred             EEEecCCCcHHHHHHHHHHHHHHHHHHHHhCCCCCcchHHHHHHh
Q psy4056         181 ALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKR  225 (227)
Q Consensus       181 AVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~~p~~~~~~l~~E~~~  225 (227)
                      ||.+.||+..+.+..|+.++..   ++++.=++.+...++++++.
T Consensus       213 aV~~~hp~a~e~L~RDv~Ni~~---fF~r~gv~~d~e~~l~~i~~  254 (268)
T COG1718         213 AVTIDHPNAFEFLERDVRNIAR---FFRRKGVEADPEELLEEIKG  254 (268)
T ss_pred             ccccCCCchHHHHHHHHHHHHH---HHHHcCCCCCHHHHHHHHhh
Confidence            6677899999999999998644   55666677888888888765


No 373
>KOG0198|consensus
Probab=34.51  E-value=60  Score=29.86  Aligned_cols=44  Identities=20%  Similarity=0.265  Sum_probs=30.7

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc---HHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV---RDNANIDIKCMEA  202 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i---~~~i~~Dl~~l~~  202 (227)
                      +-+|.+|.|.||.|+.+ +|+..|||-.-=.-   .+.+...+.+|..
T Consensus        23 ~~lG~Gs~G~V~l~~~~~~g~~~AvK~v~~~~~~~~~~l~~Ei~iL~~   70 (313)
T KOG0198|consen   23 KLLGRGSFGSVYLATNKKTGELMAVKSVELEDSPTSESLEREIRILSR   70 (313)
T ss_pred             ccccCccceEEEEEEecCCCcceeeeeeecccchhHHHHHHHHHHHHh
Confidence            56899999999999998 59999999544331   2234444444443


No 374
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=33.40  E-value=1.1e+02  Score=25.71  Aligned_cols=32  Identities=19%  Similarity=0.315  Sum_probs=26.4

Q ss_pred             cccceeeccceEEEEecC------CCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLHD------GSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~------G~~VAVKVq~P~i~  190 (227)
                      +.++.++.|.||+|..++      +..|++|..+.+..
T Consensus        12 ~~lg~g~~g~v~~~~~~~~~~~~~~~~~aik~~~~~~~   49 (277)
T cd05032          12 RELGQGSFGMVYEGLAKGVVKGEPETRVAIKTVNENAS   49 (277)
T ss_pred             eEecCCCCceEEEEEEeccCCCCcceeEEEEecCCccC
Confidence            569999999999999863      36899999877653


No 375
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=33.38  E-value=88  Score=27.47  Aligned_cols=33  Identities=18%  Similarity=0.095  Sum_probs=27.4

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVRDN  192 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~  192 (227)
                      ++++.+-.|+|+.+.. +++++|||+-+|.....
T Consensus        37 ~~l~~~~f~~v~l~~~-~~~~~iiKvf~~~~~~~   69 (232)
T PRK10359         37 KVFRNIDDTKVSLIDT-DYGKYILKVFAPKVKRT   69 (232)
T ss_pred             EEecCCCceEEEEEec-CCCcEEEEEechhcCch
Confidence            5788899999999766 78899999999887543


No 376
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=33.14  E-value=66  Score=27.74  Aligned_cols=26  Identities=12%  Similarity=0.134  Sum_probs=20.0

Q ss_pred             ceeeccceEEEEecCCCEEEEEecCCC
Q psy4056         162 GAASLAQVHKATLHDGSTIALKVQHRN  188 (227)
Q Consensus       162 asASIaQVHrA~L~~G~~VAVKVq~P~  188 (227)
                      +.++.+.|++++. +|+.||||+...+
T Consensus        11 ~~~~~v~~~~~~~-~~~~~avK~~~~~   36 (314)
T cd08216          11 EDLMIVHLAKHKP-TNTLVAVKKINLD   36 (314)
T ss_pred             cCCceEEEEEecC-CCCEEEEEEEecc
Confidence            4556677777776 8999999997755


No 377
>smart00811 Alpha_kinase Alpha-kinase family. This family is a novel family of eukaryotic protein kinase catalytic domains, which have no detectable similarity to conventional kinases. The family contains myosin heavy chain kinases and Elongation Factor-2 kinase and a bifunctional ion channel. This family is known as the alpha-kinase family. The structure of the kinase domain revealed unexpected similarity to eukaryotic protein kinases in the catalytic core as well as to metabolic enzymes with ATP-grasp domains.
Probab=32.99  E-value=1.7e+02  Score=24.90  Aligned_cols=58  Identities=12%  Similarity=0.101  Sum_probs=42.8

Q ss_pred             ccccCccccceeeccceEEEEec----CCCEEEEEecCCCcH----HHHHHHHHHHHHHHHHHHHh
Q psy4056         153 FASIEPNPMGAASLAQVHKATLH----DGSTIALKVQHRNVR----DNANIDIKCMEALVHVVAWV  210 (227)
Q Consensus       153 F~~fd~~PiasASIaQVHrA~L~----~G~~VAVKVq~P~i~----~~i~~Dl~~l~~l~~~~~~~  210 (227)
                      ...+++.|.|-|..=.+|+++..    .|+..|+|.-.+...    +..-.|++.-.....+++.+
T Consensus        11 ~v~i~~~pFa~G~~R~a~~~~~~~~~~~~~~~V~K~~~~~~~~~~~~~yf~d~~~q~~a~~~a~~F   76 (198)
T smart00811       11 GVKIELKPFAKGAMRVAFRVKDLSEFGSGTECVAKYFKKEYKNTVEDRYFEDVEMQMVAKKFAEEF   76 (198)
T ss_pred             EEEEcCCccCCCceeeeEEEEEeccCCCCCEEEEEEeccccCCchHHHHHHHHHHHHHHHHHHHHH
Confidence            45778999999999999999985    689999998888753    33445777655544454443


No 378
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=32.59  E-value=67  Score=26.92  Aligned_cols=30  Identities=17%  Similarity=0.305  Sum_probs=23.5

Q ss_pred             cceeeccceEEEEecCC---CEEEEEecCCCcH
Q psy4056         161 MGAASLAQVHKATLHDG---STIALKVQHRNVR  190 (227)
Q Consensus       161 iasASIaQVHrA~L~~G---~~VAVKVq~P~i~  190 (227)
                      +|.++.|+||+|+..++   ..|+||.......
T Consensus         3 lg~G~fg~v~~~~~~~~~~~~~~~~k~~~~~~~   35 (269)
T cd05042           3 IGNGWFGKVLLGEAHRGMSKARVVVKELRASAT   35 (269)
T ss_pred             CCccCCceEEEEEEecCCCCeEEEEeecCccCC
Confidence            78899999999987644   5799997765543


No 379
>KOG0588|consensus
Probab=32.23  E-value=37  Score=34.78  Aligned_cols=46  Identities=20%  Similarity=0.232  Sum_probs=37.1

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC------cHHHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN------VRDNANIDIKCMEALV  204 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~------i~~~i~~Dl~~l~~l~  204 (227)
                      .-+|.||=|-|-.|+-. +|+.+||||.--.      ....|+.+|.+|+.+-
T Consensus        18 kTLG~Gstg~vrlakh~~TGqlaaiKii~k~~~~s~s~~~~IerEIviMkLi~   70 (786)
T KOG0588|consen   18 KTLGKGSTGCVRLAKHAETGQLAAIKIIPKRSELSSSQPAGIEREIVIMKLIE   70 (786)
T ss_pred             ccccCCCCceehhhhcccccceeEEEeeccccccccccccchhhhhHHHHHhc
Confidence            35899999999999976 8999999997655      3567788888887654


No 380
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH). The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibio
Probab=31.46  E-value=86  Score=26.42  Aligned_cols=42  Identities=14%  Similarity=0.028  Sum_probs=32.7

Q ss_pred             eeccceEEEEecCCCEEEEEecCCCcHHHHHHHHHHHHHHHHH
Q psy4056         164 ASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHV  206 (227)
Q Consensus       164 ASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~  206 (227)
                      +|-++||+... +|++++||+..+.-...+..+..+++.+...
T Consensus        10 ~~~~~v~~~~~-~~~~~~vk~~~~~~~~~~~~E~~~l~~l~~~   51 (244)
T cd05150          10 QSGATVYRLDG-KNPGLYLKIAPSGPTYELEREAERLRWLAGK   51 (244)
T ss_pred             CCcCeEEEEcC-CCCcEEEEecCCCcccchHHHHHHHHHHHhc
Confidence            37799999987 5689999999876555677788888877653


No 381
>PF12162 STAT1_TAZ2bind:  STAT1 TAZ2 binding domain;  InterPro: IPR022752 This entry represents the C-terminal domain of STAT1, which selectively binds the TAZ2 domain of CRB (CREB-binding protein) []. This group of eukaryotic proteins is approximately 20 amino acids in length, and is found in association with PF02865 from PFAM, PF00017 from PFAM, PF01017 from PFAM, PF02864 from PFAM. By binding to CRB, it becomes a transcriptional activator and can initiate transcription of certain genes. ; GO: 0003700 sequence-specific DNA binding transcription factor activity; PDB: 2KA6_B.
Probab=31.40  E-value=30  Score=19.75  Aligned_cols=18  Identities=11%  Similarity=-0.035  Sum_probs=8.0

Q ss_pred             HHHhcCCCCCCHHHHHHH
Q psy4056         123 KVLHSKAPMSPMKDILAV  140 (227)
Q Consensus       123 ~~Lqd~~p~~~~~~v~~~  140 (227)
                      ++|||+.-|+++++..++
T Consensus         1 srlqdnmmPMSPddy~~l   18 (23)
T PF12162_consen    1 SRLQDNMMPMSPDDYDEL   18 (23)
T ss_dssp             S---TS---S-HHHHHHH
T ss_pred             CchhhcccCCCHHHHHHH
Confidence            468999999998876554


No 382
>KOG0661|consensus
Probab=30.79  E-value=55  Score=32.22  Aligned_cols=55  Identities=13%  Similarity=0.172  Sum_probs=37.0

Q ss_pred             cceeeccceEEEEec-CCCEEEEEecCCCcHHHHHHHHHHHHHHHHHHHHhCCCCCcch
Q psy4056         161 MGAASLAQVHKATLH-DGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLW  218 (227)
Q Consensus       161 iasASIaQVHrA~L~-~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~~p~~~~~~  218 (227)
                      +|.|+.|-|++|+-+ +|+.||||=..--...  ..|...|+-+-.+ .++-|.=++..
T Consensus        18 lGDGTfGsV~la~~~~~~~~VAIK~MK~Kf~s--~ee~~nLREvksL-~kln~hpniik   73 (538)
T KOG0661|consen   18 LGDGTFGSVYLAKSKETGELVAIKKMKKKFYS--WEECMNLREVKSL-RKLNPHPNIIK   73 (538)
T ss_pred             hcCCcceeEEEeeecCCCceeeHHHHHhhhcc--HHHHHHHHHHHHH-HhcCCCCcchh
Confidence            788999999999988 8999999965544433  4566666665443 44444433333


No 383
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins. Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phospha
Probab=30.44  E-value=54  Score=27.24  Aligned_cols=25  Identities=16%  Similarity=0.089  Sum_probs=21.5

Q ss_pred             eeccceEEEEec-CCCEEEEEecCCC
Q psy4056         164 ASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       164 ASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      |++|-||+++-+ +|+.||+|+.+..
T Consensus         4 g~~~~v~~~~~~~~~~~~~~K~i~~~   29 (237)
T cd05576           4 GVIDKVLLVMDTRTQQTFILKGLRKS   29 (237)
T ss_pred             cccceEEEEEEccCCcEEEEEeecch
Confidence            678889999886 8999999998775


No 384
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=29.89  E-value=94  Score=26.99  Aligned_cols=33  Identities=27%  Similarity=0.413  Sum_probs=26.3

Q ss_pred             ccccceeeccceEEEEec--------CCCEEEEEecCCCcH
Q psy4056         158 PNPMGAASLAQVHKATLH--------DGSTIALKVQHRNVR  190 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~--------~G~~VAVKVq~P~i~  190 (227)
                      .+.++.++.|.||+|+-.        ++..||+|+.+....
T Consensus        17 ~~~lg~G~~g~vy~~~~~~~~~~~~~~~~~~aiK~~~~~~~   57 (314)
T cd05099          17 GKPLGEGCFGQVVRAEAYGIDKSRPDQTVTVAVKMLKDNAT   57 (314)
T ss_pred             eeeecCCCcccEEEeeecccCCccCCcceEEEEEecCCCCC
Confidence            467999999999999752        345799999887654


No 385
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity 
Probab=29.57  E-value=34  Score=28.70  Aligned_cols=30  Identities=20%  Similarity=0.458  Sum_probs=23.1

Q ss_pred             cccceeeccceEEEEec-CC-------CEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DG-------STIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G-------~~VAVKVq~P~  188 (227)
                      ++++.++.|+||+|..+ +|       .+|++|+....
T Consensus         1 ~~lg~G~~~~Vy~~~~~~~~~~~~~~~~~~~~k~~~~~   38 (258)
T cd05078           1 ESLGQGTFTKIFKGIRREVGDYGELHKTEVLLKVLDKS   38 (258)
T ss_pred             CCCCcccchhheeeeecccccccccccchhhHHhhcch
Confidence            46899999999999875 23       35999987544


No 386
>PF08277 PAN_3:  PAN-like domain;  InterPro: IPR006583 PAN domains have significant functional versatility fulfilling diverse biological functions by mediating protein-protein or protein-carbohydrate interactions []. These domains contain a hair-pin loop like structure, similar to knottins, but the pattern of disulphide bonds differs The PAN-3 or CW is a domain associated with a number of Caenorhabditis elegans hypothetical proteins.
Probab=29.06  E-value=47  Score=22.72  Aligned_cols=21  Identities=29%  Similarity=0.550  Sum_probs=14.1

Q ss_pred             eeccceEEEEecCCCEEEEEe
Q psy4056         164 ASLAQVHKATLHDGSTIALKV  184 (227)
Q Consensus       164 ASIaQVHrA~L~~G~~VAVKV  184 (227)
                      +++.+|-+-.-.+|..||+|+
T Consensus        51 ~~i~~v~~~~~~~~~~VA~K~   71 (71)
T PF08277_consen   51 GSISTVQKTDSSSGNKVAFKI   71 (71)
T ss_pred             CCEEEEEEeecCCCeEEEEEC
Confidence            345555554445899999996


No 387
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=28.65  E-value=71  Score=34.17  Aligned_cols=29  Identities=10%  Similarity=0.126  Sum_probs=25.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      ..|+.++.|.||+|+.+ +++.||+|+...
T Consensus        19 ~kLG~GgFGtVYLAkdk~tg~~vAlKvIk~   48 (1021)
T PTZ00266         19 KKIGNGRFGEVFLVKHKRTQEFFCWKAISY   48 (1021)
T ss_pred             EEEecCCCeEEEEEEECCCCeEEEEEEEec
Confidence            56999999999999987 678999998764


No 388
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. ETNK is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate, and displays negligible activity towards N-methylated derivatives of Etn. The Drosophila ETNK is implicated in development and neuronal function. Mammals contain two ETNK proteins, ETNK1 and ETNK2. ETNK1 selectively increases Etn uptake and phosphorylation, as well as PtdEtn synthesis. ETNK2 is found primarily in the liver and reproductive tissues. It plays a critical role in regulating placental hemostasis to support late embryo
Probab=28.36  E-value=83  Score=26.21  Aligned_cols=47  Identities=6%  Similarity=0.063  Sum_probs=34.4

Q ss_pred             ccccceeeccceEEEEecC--CCEEEEEecCCCcHHHH--HHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLHD--GSTIALKVQHRNVRDNA--NIDIKCMEALV  204 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~~--G~~VAVKVq~P~i~~~i--~~Dl~~l~~l~  204 (227)
                      -+|+..|...+||+-+..+  ++.|++|+-.++-...+  +.+..+++.+.
T Consensus         3 i~~l~gG~tN~~~~v~~~~~~~~~~vlR~~~~~~~~~~d~~~E~~~~~~l~   53 (235)
T cd05157           3 FKRFTGGITNKLVKVSNKEDNQDAVLVRVYGNKTELIIDRERELRIHKLLS   53 (235)
T ss_pred             EEEcCCcccceEEEEEcCCCCCCeEEEEEccCCccceecHHHHHHHHHHHH
Confidence            3688899999999998865  78999999888744333  34556665554


No 389
>KOG0663|consensus
Probab=28.05  E-value=47  Score=31.52  Aligned_cols=31  Identities=19%  Similarity=0.169  Sum_probs=26.5

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCCc
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRNV  189 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i  189 (227)
                      +-|+.||-|-||||+-+ +++-||+|=.+++-
T Consensus        82 nrI~EGtyGiVYRakdk~t~eIVALKr~kmek  113 (419)
T KOG0663|consen   82 NRIEEGTYGVVYRAKDKKTDEIVALKRLKMEK  113 (419)
T ss_pred             hhcccCcceeEEEeccCCcceeEEeeeccccc
Confidence            45999999999999987 89999998766654


No 390
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=27.27  E-value=79  Score=30.59  Aligned_cols=32  Identities=19%  Similarity=0.262  Sum_probs=24.5

Q ss_pred             cCccccceeeccceEEEEecCCCEEEEEecCCC
Q psy4056         156 IEPNPMGAASLAQVHKATLHDGSTIALKVQHRN  188 (227)
Q Consensus       156 fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~  188 (227)
                      ...+.+|.++-|.||+|.+ .|+.+++|+..+.
T Consensus       336 ~~~~~iG~G~~g~Vy~~~~-~~~~~v~k~~~~~  367 (535)
T PRK09605        336 IPDHLIGKGAEADIKKGEY-LGRDAVIKERVPK  367 (535)
T ss_pred             CccceeccCCcEEEEEEee-cCccceeEEEecc
Confidence            3467899999999999987 5666777765543


No 391
>KOG0592|consensus
Probab=27.20  E-value=30  Score=34.48  Aligned_cols=27  Identities=30%  Similarity=0.332  Sum_probs=24.3

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEec
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQ  185 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq  185 (227)
                      +-+|-||-.+|++|+-+ .|+++||||.
T Consensus        79 ~~lGeGSYStV~~A~~~~t~keYAiKVl  106 (604)
T KOG0592|consen   79 KILGEGSYSTVVLAREKATGKEYAIKVL  106 (604)
T ss_pred             heeccccceeEEEeeecCCCceeeHhhh
Confidence            34999999999999987 7999999985


No 392
>PF01163 RIO1:  RIO1 family;  InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents RIO kinase, they exhibit little sequence similarity with eukaryotic protein kinases, and are classified as atypical protein kinases []. The conformation of ATP when bound to the RIO kinases is unique when compared with ePKs, such as serine/threonine kinases or the insulin receptor tyrosine kinase, suggesting that the detailed mechanism by which the catalytic aspartate of RIO kinases participates in phosphoryl transfer may not be identical to that employed in known serine/threonine ePKs. Representatives of the RIO family are present in organisms varying from Archaea to humans, although the RIO3 proteins have only been identified in multicellular eukaryotes, to date.   Yeast Rio1 and Rio2 proteins are required for proper cell cycle progression and chromosome maintenance, and are necessary for survival of the cells. These proteins are involved in the processing of 20 S pre-rRNA via late 18 S rRNA processing. ; GO: 0003824 catalytic activity, 0005524 ATP binding; PDB: 1TQP_A 1ZAR_A 1TQI_A 1ZAO_A 1TQM_A 3RE4_A 1ZTH_B 1ZP9_A 1ZTF_A.
Probab=27.13  E-value=57  Score=27.49  Aligned_cols=21  Identities=29%  Similarity=0.328  Sum_probs=16.7

Q ss_pred             eEEEEecCCCEEEEEecCCCc
Q psy4056         169 VHKATLHDGSTIALKVQHRNV  189 (227)
Q Consensus       169 VHrA~L~~G~~VAVKVq~P~i  189 (227)
                      ||.|.-.+|++||||+=+.+.
T Consensus         2 Vy~~~~~~~~~~a~K~~r~~~   22 (188)
T PF01163_consen    2 VYHAIDPDGEEVAVKIYRTGR   22 (188)
T ss_dssp             EEEEEECTTEEEEEEEE-S--
T ss_pred             EEEEECCCCCEEEEEEeccCc
Confidence            889998899999999988764


No 393
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=26.86  E-value=3.6e+02  Score=22.13  Aligned_cols=71  Identities=10%  Similarity=0.093  Sum_probs=51.2

Q ss_pred             HHHHHHHHHHHHHHHHhcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCChhhhccccCc
Q psy4056          79 SKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEP  158 (227)
Q Consensus        79 ~~~h~~~a~~l~~~~~~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd~  158 (227)
                      .++-+..+.+|+.+-+++|=+.-.||+.+..     ...+   ++++...- ..|..++...|.+.||.++.++|.+.+.
T Consensus        64 ~~l~~~~g~~Ir~~Re~~glSqeeLA~~lgv-----s~s~---IsriE~G~-~~Ps~~~l~kLa~~Lgvsl~el~~e~~~  134 (154)
T TIGR00270        64 EELVEDYGIIIRREREKRGWSQEQLAKKIQE-----KESL---IKKIENAE-IEPEPKVVEKLEKLLKIKLREQVPEIKI  134 (154)
T ss_pred             HHHHHHHHHHHHHHHHHcCCCHHHHHHHhCC-----CHHH---HHHHHCCC-CCCCHHHHHHHHHHhCCCHHHHccchhh
Confidence            3566678899999999999999999987763     3444   44444322 3344567788899999999998865544


No 394
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only]
Probab=26.05  E-value=3.2e+02  Score=25.22  Aligned_cols=64  Identities=14%  Similarity=0.163  Sum_probs=44.9

Q ss_pred             CHHHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEecCCCEEEEEecCCC-cHHHHHHHHHHHHHHHH
Q psy4056         133 PMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRN-VRDNANIDIKCMEALVH  205 (227)
Q Consensus       133 ~~~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~-i~~~i~~Dl~~l~~l~~  205 (227)
                      +.+....+.+..+|..       -+..+++| +-..||+-...||+. ++||-+|+ -+..+...+..|..++.
T Consensus        13 ~~~~~~~l~~~~~g~~-------~~~~~l~s-~eN~~f~~~~~~g~~-iLki~~~~~~~~~i~~el~~l~~La~   77 (331)
T COG2334          13 SDEAAAALEAYHYGLD-------GSLRGLNS-EENSNFRVQTEDGRY-ILKIYRPGWTRAEIPFELALLQHLAE   77 (331)
T ss_pred             hHHHHHHHHhcCcCcc-------cccccccc-ccCceEEEEecCCCe-EEEEecCCCCHHHHHHHHHHHHHHHH
Confidence            3344444455555543       13467888 889999999988888 99999998 66667777777666654


No 395
>PRK01964 4-oxalocrotonate tautomerase; Provisional
Probab=24.68  E-value=55  Score=22.17  Aligned_cols=33  Identities=9%  Similarity=0.186  Sum_probs=25.9

Q ss_pred             HHHHHHHHHhcCCChhhhccccCccccceeecc
Q psy4056         135 KDILAVLKEDLGKDPSEIFASIEPNPMGAASLA  167 (227)
Q Consensus       135 ~~v~~~l~~elG~~~~~~F~~fd~~PiasASIa  167 (227)
                      +.+-+.+.+.+|.+.+++|..|++.|-.-=|+|
T Consensus        22 ~~it~~l~~~lg~p~~~v~V~i~e~~~~~w~~g   54 (64)
T PRK01964         22 REVTEAISATLDVPKERVRVIVNEVPSSHWGVA   54 (64)
T ss_pred             HHHHHHHHHHhCcChhhEEEEEEEcChHHeeEC
Confidence            445666788999999999999998886655554


No 396
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=24.39  E-value=1.2e+02  Score=25.19  Aligned_cols=29  Identities=21%  Similarity=0.163  Sum_probs=23.0

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHR  187 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P  187 (227)
                      +.++.++.|.||+++.. .+..+++|+.+.
T Consensus         6 ~~ig~g~~g~v~~~~~~~~~~~~~~~~~~~   35 (260)
T cd08222           6 QRLGKGSFGTVYLVKDKKAVAEERLKVLKE   35 (260)
T ss_pred             eeecCCCCceEEEEEecCCCCcceEEEecc
Confidence            56999999999999876 456677777654


No 397
>TIGR02721 ycfN_thiK thiamine kinase. Members of this family are the ycfN gene product of Escherichia coli, now identified as the salvage enzyme thiamine kinase (thiK), and additional proteobacterial homologs taken to be orthologs with equivalent function.
Probab=23.82  E-value=1.5e+02  Score=25.26  Aligned_cols=46  Identities=11%  Similarity=0.211  Sum_probs=34.6

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcHH---HHHHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVRD---NANIDIKCMEALVH  205 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~---~i~~Dl~~l~~l~~  205 (227)
                      .|+..|--.++|+.+ .+|++++||+..++-..   ....+..+++.+..
T Consensus         2 ~~~~~G~tn~~y~~~-~~~~~~vlR~~~~~~~~~~~~r~~E~~~l~~l~~   50 (256)
T TIGR02721         2 QTLSGGLTNRSWRIE-HPGISFVWRPQSPVCKALGVDRQREYQILQALSA   50 (256)
T ss_pred             CcCCCcCcCCeEEEE-eCCccEEEeeCCcccccccCcHHHHHHHHHHHHh
Confidence            367788889999888 47889999997776433   35667777777765


No 398
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172. This model describes a paralogous family of five proteins, likely to be enzymes, in the rumen bacterium Fibrobacter succinogenes S85. Members show homology to proteins described by PFAM model pfam01636, a phosphotransferase enzyme family associated with resistance to aminoglycoside antibiotics. However, members of this family score below the current trusted and noise cutoffs for pfam01636.
Probab=22.37  E-value=1.7e+02  Score=25.05  Aligned_cols=45  Identities=7%  Similarity=0.087  Sum_probs=35.1

Q ss_pred             ccccceeeccceEEEEecCCCEEEEEecCCCc-HHHHHHHHHHHHHHHH
Q psy4056         158 PNPMGAASLAQVHKATLHDGSTIALKVQHRNV-RDNANIDIKCMEALVH  205 (227)
Q Consensus       158 ~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i-~~~i~~Dl~~l~~l~~  205 (227)
                      .+|+++|-=+=||+.   .|.+.++|+.+|+. ...+..+.++++.+..
T Consensus         6 ~~~i~~G~t~~~y~~---~~~~~VlR~~~~~~~~~~i~~E~~~l~~l~~   51 (226)
T TIGR02172         6 WTQTGEGGNGESYTH---KTGKWMLKLYNPGFDKETIKREFDASRKVFS   51 (226)
T ss_pred             heeecCCCCcceeEe---cCCCEEEEeCCCCCCHHHHHHHHHHHHHHHH
Confidence            478999999999973   36678999999977 4557777778777653


No 399
>PF11517 Nab2:  Nuclear abundant poly(A) RNA-bind protein 2 (Nab2);  InterPro: IPR021083 Nab2 is a yeast heterogeneous nuclear ribonucleoprotein that modulates poly(A) tail length and mRNA. This is the N-terminal domain of the protein which mediates interactions with the C-terminal globular domain, Myosin-like protein 1 and the mRNA export factor, Gfd1 []. The N-terminal domain of Nab2 shows a structure of a helical fold. The N-terminal domain of Nab2 is thought to mediate protein:protein interactions that facilitate the nuclear export of mRNA []. An essential hydrophobic Phe73 patch on the N-terminal domain is thought to be an important component of the interface between Nab2 and Mlp1 [].; PDB: 3LCN_B 2V75_A 2JPS_A.
Probab=22.32  E-value=28  Score=26.97  Aligned_cols=43  Identities=16%  Similarity=0.274  Sum_probs=20.2

Q ss_pred             cHHHHHHHHHHhcCCCCCCHHHHHHHHHHhc-----CCChhhhccccC
Q psy4056         115 PKEYVETMKVLHSKAPMSPMKDILAVLKEDL-----GKDPSEIFASIE  157 (227)
Q Consensus       115 P~~~~~~L~~Lqd~~p~~~~~~v~~~l~~el-----G~~~~~~F~~fd  157 (227)
                      |++..++|+.|.|.+++..+..+-+..-.++     |.+++.+...+.
T Consensus        47 ~esivqELssLFD~vs~~~l~~VVQtaF~ale~Lq~Ge~~e~iv~Ki~   94 (107)
T PF11517_consen   47 VESIVQELSSLFDSVSTEALTDVVQTAFFALEALQQGETVENIVSKIR   94 (107)
T ss_dssp             HHHHHHHHHHH-TTS-HHHHHHHHHHHHHHHHHHHTT--HHHHHHHHH
T ss_pred             HHHHHHHHHHHHhccCHHHHHHHHHHHHHHHHHHhCCCcHHHHHHHHH
Confidence            4566666666666666555544333222221     556666665554


No 400
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme. 4-oxalocrotonate tautomerase is a homohexamer in which each monomer is very small, at about 62 amino acids. Pro-1 of the mature protein serves as a general base. The enzyme functions in meta-cleavage pathways of aromatic hydrocarbon catabolism. Because several Arg residues located near the active site in the crystal structure of Pseudomonas putida are not conserved among all members of this family, because the literature describes a general role in the isomerization of beta,gamma-unsaturated enones to their alpha,beta-isomers, and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function.
Probab=22.30  E-value=63  Score=21.53  Aligned_cols=33  Identities=18%  Similarity=0.344  Sum_probs=25.8

Q ss_pred             HHHHHHHHHhcCCChhhhccccCccccceeecc
Q psy4056         135 KDILAVLKEDLGKDPSEIFASIEPNPMGAASLA  167 (227)
Q Consensus       135 ~~v~~~l~~elG~~~~~~F~~fd~~PiasASIa  167 (227)
                      ..+-+.+.+.+|.+.++++..|++.|-..=++|
T Consensus        22 ~~it~~l~~~lg~~~~~v~V~i~e~~~~~w~~g   54 (63)
T TIGR00013        22 EGVTEAMAETLGANLESIVVIIDEMPKNNYGIG   54 (63)
T ss_pred             HHHHHHHHHHhCCCcccEEEEEEEcCHHHeeEC
Confidence            345667788899999999999998886665554


No 401
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=22.25  E-value=1.7e+02  Score=24.54  Aligned_cols=30  Identities=13%  Similarity=0.229  Sum_probs=22.2

Q ss_pred             ccceeeccceEEEEecCCC---EEEEEecCCCc
Q psy4056         160 PMGAASLAQVHKATLHDGS---TIALKVQHRNV  189 (227)
Q Consensus       160 PiasASIaQVHrA~L~~G~---~VAVKVq~P~i  189 (227)
                      ++|.++.|.||+|...++.   .+++|......
T Consensus         2 ~lg~G~~g~v~~~~~~~~~~~~~~~~k~~~~~~   34 (268)
T cd05086           2 EIGNGWFGKVLLSEIYTDTGVARVVVKELKANA   34 (268)
T ss_pred             cCCCCcCceEEEEEEEcCCCcceEEEEEecCCC
Confidence            5889999999999876543   56677655543


No 402
>KOG0610|consensus
Probab=22.05  E-value=82  Score=30.49  Aligned_cols=30  Identities=20%  Similarity=0.366  Sum_probs=25.9

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN  188 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~  188 (227)
                      .-+|+|.||-||.+.++ ++.--|+||.--.
T Consensus        83 k~LG~GdiG~VyL~~l~~t~~~fAmKVmdK~  113 (459)
T KOG0610|consen   83 KRLGCGDIGTVYLVELRGTNCLFAMKVMDKE  113 (459)
T ss_pred             HHcCCCCceeEEEEEecCCCceEEEEEecHH
Confidence            45999999999999998 4689999998654


No 403
>PRK00745 4-oxalocrotonate tautomerase; Provisional
Probab=21.95  E-value=70  Score=21.30  Aligned_cols=33  Identities=21%  Similarity=0.158  Sum_probs=25.8

Q ss_pred             HHHHHHHHHhcCCChhhhccccCccccceeecc
Q psy4056         135 KDILAVLKEDLGKDPSEIFASIEPNPMGAASLA  167 (227)
Q Consensus       135 ~~v~~~l~~elG~~~~~~F~~fd~~PiasASIa  167 (227)
                      +.+-+.+.+.+|.+.+++|..|++.|-..-++|
T Consensus        22 ~~it~~l~~~~~~p~~~v~V~i~e~~~~~w~~g   54 (62)
T PRK00745         22 EEITRVTVETLGCPPESVDIIITDVKRENWATG   54 (62)
T ss_pred             HHHHHHHHHHcCCChhHEEEEEEEcChHHeeEC
Confidence            345667888999999999999998876665554


No 404
>cd06461 M2_ACE Peptidase family M2 Angiotensin converting enzyme (ACE, EC 3.4.15.1) is a membrane-bound, zinc dependent dipeptidase that catalyzes the conversion of the decapeptide angiotensin I to the potent vasopressor ocatapeptide angiotensin II, by removing two C-terminal amino acids. There are two forms of the enzyme in humans, the ubiquitous somatic ACE and the sperm-specific germinal ACE, both encoded by the same gene through transcription from alternative promoters. Somatic ACE has two tandem active sites with distinct catalytic properties, whereas germinal ACE, the function of which is largely unknown, has just a single active site. Recently, an ACE homolog, ACE2, has been identified in humans that differs from ACE; it preferentially removes carboxy-terminal hydrophobic or basic amino acids and appears to be important in cardiac function. ACE homologs (also known as members of the M2 gluzincin family) have been found in a wide variety of species, including those that neither h
Probab=21.89  E-value=2.6e+02  Score=27.29  Aligned_cols=81  Identities=9%  Similarity=0.005  Sum_probs=52.4

Q ss_pred             CCcHHHHHHHHHHHHHHHHHHHHHHHhcChHHHHHHHHHHc-------CCCCCcHHHHHHHHHHhcCCCCCCHHHHHHHH
Q psy4056          69 PTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGA-------LEYLLPKEYVETMKVLHSKAPMSPMKDILAVL  141 (227)
Q Consensus        69 ~~~~~~~~~~~~~h~~~a~~l~~~~~~lGg~~iKlGQ~lst-------r~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l  141 (227)
                      .+.++....+.+.|...+..+...+.++=-+.-|.++.+.-       |.+.=++++.+....+...+-|. +.++.+.+
T Consensus        44 ~D~~~r~~aW~~w~~~~g~~~~~~y~~lV~lrn~~A~~~Gf~n~~~~wR~~Ye~~d~~~~~e~i~~~v~Pl-y~~Lh~~~  122 (477)
T cd06461          44 RDYDELLYAWEGWRDAVGPPMRPLYERYVELANEAAKLNGFVDAGEYWRSEYETPDFEQDVERLWEELKPL-YLQLHAYV  122 (477)
T ss_pred             CCHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHcCCCCHHHHhHhcCCHHHHHHHHHHHHHHHHHH-HHHHHHHH
Confidence            34456666666777667666666655543333333333321       44555678888888888888887 77778888


Q ss_pred             HHhcCCChh
Q psy4056         142 KEDLGKDPS  150 (227)
Q Consensus       142 ~~elG~~~~  150 (227)
                      ++.||....
T Consensus       123 r~~L~~~y~  131 (477)
T cd06461         123 RRKLRKKYG  131 (477)
T ss_pred             HHHHHHhcc
Confidence            888886653


No 405
>KOG0615|consensus
Probab=21.36  E-value=81  Score=30.59  Aligned_cols=46  Identities=17%  Similarity=0.382  Sum_probs=32.0

Q ss_pred             cccceeeccceEEEEec-CCCEEEEEecCCC--------cHHH--HHHHHHHHHHHH
Q psy4056         159 NPMGAASLAQVHKATLH-DGSTIALKVQHRN--------VRDN--ANIDIKCMEALV  204 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~-~G~~VAVKVq~P~--------i~~~--i~~Dl~~l~~l~  204 (227)
                      +-+|+|-.|-|-.|.=+ +|+.||||+.+-.        ....  +...+.+|+.+.
T Consensus       178 ~~LGsGafg~Vkla~e~~tgk~vAiKIi~krk~~~~s~~~~~~~~v~~EieILkkL~  234 (475)
T KOG0615|consen  178 KTLGSGAFGLVKLAYEKKTGKQVAIKIINKRKSTGCSRAIAKTRDVQNEIEILKKLS  234 (475)
T ss_pred             eeecCCceeEEEEEEEcccCcEEEeeeeehhhcccccccccchhhhHHHHHHHHhcC
Confidence            45888888888888776 8999999997643        2222  336666666543


No 406
>PF13565 HTH_32:  Homeodomain-like domain
Probab=21.35  E-value=2e+02  Score=19.66  Aligned_cols=35  Identities=23%  Similarity=0.278  Sum_probs=29.4

Q ss_pred             cHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCCh
Q psy4056         115 PKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDP  149 (227)
Q Consensus       115 P~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~  149 (227)
                      +++..+.+..+-..-|-.+..++...|++++|.++
T Consensus        32 ~~e~~~~i~~~~~~~p~wt~~~i~~~L~~~~g~~~   66 (77)
T PF13565_consen   32 DPEQRERIIALIEEHPRWTPREIAEYLEEEFGISV   66 (77)
T ss_pred             cHHHHHHHHHHHHhCCCCCHHHHHHHHHHHhCCCC
Confidence            67777888888888888899999999999998654


No 407
>PF14875 PIP49_N:  N-term cysteine-rich ER, FAM69
Probab=20.86  E-value=72  Score=26.49  Aligned_cols=22  Identities=18%  Similarity=0.291  Sum_probs=16.8

Q ss_pred             cceeeccceEEEEecCCCEEEEE
Q psy4056         161 MGAASLAQVHKATLHDGSTIALK  183 (227)
Q Consensus       161 iasASIaQVHrA~L~~G~~VAVK  183 (227)
                      +.+..=-|||.|.. .|++|++|
T Consensus        78 L~~~~~~~Vy~g~W-~~~~vviK   99 (158)
T PF14875_consen   78 LSHKPGKQVYSGSW-KGRPVVIK   99 (158)
T ss_pred             hCCCCCceEEEEEE-CCcEEEEE
Confidence            33444458999997 68899999


No 408
>PLN02756 S-methyl-5-thioribose kinase
Probab=20.74  E-value=1.9e+02  Score=27.85  Aligned_cols=58  Identities=16%  Similarity=0.244  Sum_probs=39.9

Q ss_pred             CCCCCCHHHHHHHHHHh------cCCChhhhccccCccccceeeccceEEEEecCCCEEEEEecCCCcH
Q psy4056         128 KAPMSPMKDILAVLKED------LGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVR  190 (227)
Q Consensus       128 ~~p~~~~~~v~~~l~~e------lG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~  190 (227)
                      ...+++.+.+..-+.+.      +|..    +....-++++-|.+..||+-+. +|+.|+||...|+++
T Consensus         5 ~y~~l~~~~l~~yl~~~~~~~~~l~g~----~~~l~~~eiggGn~N~VyrV~~-~~~svVVKqa~p~~r   68 (418)
T PLN02756          5 EFRPLDEKSLVEYIKATPALSSKIGND----LDDLKIKEVGDGNLNFVYIVVS-SSGSFVIKQALPYIR   68 (418)
T ss_pred             ccccCCHHHHHHHHHHccchhhhcCCC----CCCceEEEcCCCceeeEEEEEc-CCccEEEEeCCcccc
Confidence            34455556666655554      4322    2345678899999999999775 566899998887776


No 409
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms]
Probab=20.28  E-value=1.1e+02  Score=26.65  Aligned_cols=43  Identities=26%  Similarity=0.370  Sum_probs=30.3

Q ss_pred             cceeeccceEEEEecCCCEEEEEecCCCcH-HHHHHHHHHHHHHH
Q psy4056         161 MGAASLAQVHKATLHDGSTIALKVQHRNVR-DNANIDIKCMEALV  204 (227)
Q Consensus       161 iasASIaQVHrA~L~~G~~VAVKVq~P~i~-~~i~~Dl~~l~~l~  204 (227)
                      +|-|--+-||.+..+ |.+||+|||+++-. ..++..-++++.+.
T Consensus        30 L~KG~~s~Vyl~~~~-~~~~a~Kvrr~ds~r~~l~kEakiLeil~   73 (201)
T COG2112          30 LAKGTTSVVYLGEWR-GGEVALKVRRRDSPRRNLEKEAKILEILA   73 (201)
T ss_pred             hhcccccEEEEeecc-CceEEEEEecCCcchhhHHHHHHHHHHhh
Confidence            455555668888884 66999999998765 45666666665544


No 410
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase:  Catalyzes the isomerization of unsaturated ketones. The structure is a homohexamer that is arranged as a trimer of dimers. The hexamer contains six active sites, each formed by residues from three monomers, two from one dimer and the third from a neighboring monomer.  Each monomer is a beta-alpha-beta fold with two small beta strands at the C-terminus that fold back on themselves. A pair of monomers form a dimer with two-fold symmetry, consisting of a 4-stranded beta sheet with two helices on one side and two additional small beta strands at each end. The dimers are assembled around a 3-fold axis of rotation to form a hexamer, with the short beta strands from each dimer contacting the neighboring dimers.
Probab=20.04  E-value=76  Score=20.66  Aligned_cols=33  Identities=18%  Similarity=0.265  Sum_probs=24.6

Q ss_pred             HHHHHHHHHhcCCChhhhccccCccccceeecc
Q psy4056         135 KDILAVLKEDLGKDPSEIFASIEPNPMGAASLA  167 (227)
Q Consensus       135 ~~v~~~l~~elG~~~~~~F~~fd~~PiasASIa  167 (227)
                      +.+-+.+.+.+|.+.++++..|++.|-..=++|
T Consensus        21 ~~i~~~l~~~~g~~~~~v~V~i~e~~~~~~~~g   53 (58)
T cd00491          21 ERVTEAVSEILGAPEATIVVIIDEMPKENWGIG   53 (58)
T ss_pred             HHHHHHHHHHhCcCcccEEEEEEEeCchhceEC
Confidence            445667788899999999999988775554443


Done!