Query         psy4072
Match_columns 191
No_of_seqs    201 out of 1316
Neff          8.8 
Searched_HMMs 46136
Date          Sat Aug 17 00:38:02 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4072.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4072hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1701|consensus               99.9 8.6E-29 1.9E-33  201.9   3.2  155    3-158   273-466 (468)
  2 KOG4577|consensus               99.9 1.1E-25 2.3E-30  175.5  -6.2  152    3-185    32-191 (383)
  3 KOG1044|consensus               99.9 6.9E-23 1.5E-27  172.7   5.2  151    3-190   132-282 (670)
  4 KOG2272|consensus               99.8 8.3E-23 1.8E-27  156.9  -1.0  120    1-153   192-311 (332)
  5 KOG2272|consensus               99.8 1.8E-23   4E-28  160.4  -6.2  150    3-158    72-256 (332)
  6 KOG1701|consensus               99.8 1.2E-22 2.5E-27  166.2  -2.1  121   34-159   276-397 (468)
  7 KOG1703|consensus               99.7 8.2E-19 1.8E-23  151.2   3.0  123    3-158   302-424 (479)
  8 KOG1703|consensus               99.7 5.3E-19 1.2E-23  152.4   1.5  117    3-151   362-478 (479)
  9 KOG1044|consensus               99.6 2.5E-15 5.4E-20  127.4   4.3  150    4-159    16-195 (670)
 10 PF00412 LIM:  LIM domain;  Int  99.5   4E-15 8.8E-20   92.2   3.4   56    7-63      1-56  (58)
 11 PF00412 LIM:  LIM domain;  Int  99.5   2E-14 4.2E-19   89.1   3.1   58   97-155     1-58  (58)
 12 KOG1700|consensus               99.4 9.6E-14 2.1E-18  106.7   0.7  154    4-161     7-173 (200)
 13 smart00132 LIM Zinc-binding do  98.8 3.1E-09 6.7E-14   59.9   2.8   38    6-43      1-38  (39)
 14 smart00132 LIM Zinc-binding do  98.7 1.1E-08 2.4E-13   57.6   2.6   38   96-133     1-38  (39)
 15 KOG4577|consensus               98.6 6.4E-10 1.4E-14   87.7  -6.6   65   94-161    33-97  (383)
 16 KOG1702|consensus               98.1 1.3E-07 2.8E-12   71.5  -3.4   89   95-185     5-98  (264)
 17 KOG0490|consensus               97.8 1.6E-06 3.5E-11   68.0  -2.1  115    9-153     1-118 (235)
 18 KOG1700|consensus               97.6   3E-05 6.5E-10   59.8   1.9   68   95-164     8-75  (200)
 19 KOG1702|consensus               97.4 1.3E-05 2.8E-10   60.8  -2.1   61    3-65      3-63  (264)
 20 PF14446 Prok-RING_1:  Prokaryo  90.6    0.17 3.7E-06   30.4   1.5   39   94-132     5-51  (54)
 21 PF08394 Arc_trans_TRASH:  Arch  88.2    0.29 6.2E-06   27.1   1.2   26    7-32      1-26  (37)
 22 PF08394 Arc_trans_TRASH:  Arch  86.1    0.49 1.1E-05   26.1   1.3   29   97-125     1-29  (37)
 23 PF14446 Prok-RING_1:  Prokaryo  85.8    0.53 1.1E-05   28.3   1.5   30    4-33      5-36  (54)
 24 PRK14890 putative Zn-ribbon RN  82.7    0.62 1.3E-05   28.5   0.8   28    4-41      7-34  (59)
 25 KOG0490|consensus               81.0    0.56 1.2E-05   36.5   0.3   53  100-153     2-54  (235)
 26 PF09943 DUF2175:  Uncharacteri  80.5    0.58 1.3E-05   31.9   0.2   30   34-63      4-33  (101)
 27 PF10367 Vps39_2:  Vacuolar sor  79.2     1.4   3E-05   29.9   1.8   28   96-123    80-107 (109)
 28 PF10367 Vps39_2:  Vacuolar sor  77.1     2.1 4.5E-05   28.9   2.2   28   34-62     80-108 (109)
 29 COG1645 Uncharacterized Zn-fin  76.2     1.7 3.7E-05   31.1   1.6   22   34-61     30-51  (131)
 30 PF09943 DUF2175:  Uncharacteri  73.6     1.1 2.3E-05   30.6  -0.0   29   96-124     4-32  (101)
 31 PF07754 DUF1610:  Domain of un  69.5     2.8 6.1E-05   20.8   1.0   12   97-108     1-12  (24)
 32 PF13240 zinc_ribbon_2:  zinc-r  67.9     2.8   6E-05   20.5   0.8   10    7-16      2-11  (23)
 33 smart00504 Ubox Modified RING   67.2     7.5 0.00016   23.4   2.9   45   33-107     2-48  (63)
 34 PF14835 zf-RING_6:  zf-RING of  64.7     5.6 0.00012   24.8   1.8   30   79-108    25-54  (65)
 35 PF06677 Auto_anti-p27:  Sjogre  62.7       3 6.4E-05   23.6   0.3   22   34-60     19-40  (41)
 36 PF11781 RRN7:  RNA polymerase   62.3     5.2 0.00011   21.9   1.2   22   34-60     10-31  (36)
 37 PF07191 zinc-ribbons_6:  zinc-  61.5       5 0.00011   25.5   1.2   46   80-133    15-61  (70)
 38 KOG2462|consensus               60.9     3.5 7.6E-05   33.2   0.6   16   30-45    128-143 (279)
 39 PF07503 zf-HYPF:  HypF finger;  59.2     4.5 9.8E-05   22.0   0.7   31    7-43      2-32  (35)
 40 PF14471 DUF4428:  Domain of un  58.2     4.4 9.5E-05   24.0   0.5   30  124-154     1-30  (51)
 41 COG2888 Predicted Zn-ribbon RN  56.2     4.5 9.8E-05   24.7   0.4   27   95-131    10-36  (61)
 42 PF11571 Med27:  Mediator compl  55.7     2.9 6.2E-05   27.9  -0.6   16   89-104    49-64  (90)
 43 PF06906 DUF1272:  Protein of u  54.5      16 0.00034   22.1   2.5   24   82-105    29-52  (57)
 44 PF02069 Metallothio_Pro:  Prok  54.0     7.4 0.00016   23.2   1.0   23   35-58     10-32  (52)
 45 PF10235 Cript:  Microtubule-as  53.9      13 0.00027   24.9   2.2   24   81-106    58-81  (90)
 46 COG2191 Formylmethanofuran deh  52.7     7.4 0.00016   30.0   1.1   31  123-154   173-203 (206)
 47 COG2191 Formylmethanofuran deh  50.8     6.5 0.00014   30.3   0.5   30   33-63    173-202 (206)
 48 KOG1734|consensus               50.6       4 8.7E-05   32.9  -0.6   43    3-45    223-283 (328)
 49 PLN03208 E3 ubiquitin-protein   48.8      52  0.0011   25.3   5.1   12  123-134    69-80  (193)
 50 PF00645 zf-PARP:  Poly(ADP-rib  48.4       5 0.00011   25.9  -0.3   30   95-124     8-47  (82)
 51 PF10083 DUF2321:  Uncharacteri  47.6      13 0.00027   27.5   1.6   53   81-136    27-82  (158)
 52 PF13248 zf-ribbon_3:  zinc-rib  47.0      13 0.00028   18.5   1.1   10   35-44      5-14  (26)
 53 KOG3579|consensus               46.4     9.5 0.00021   31.0   0.9   13   33-45    269-281 (352)
 54 PF00130 C1_1:  Phorbol esters/  44.3      17 0.00037   21.1   1.6   14    3-16     10-23  (53)
 55 PF01258 zf-dskA_traR:  Prokary  43.4     2.1 4.6E-05   23.2  -2.3   10   35-44      6-15  (36)
 56 PF06827 zf-FPG_IleRS:  Zinc fi  43.3     7.1 0.00015   20.1  -0.2   11   95-105     2-12  (30)
 57 KOG2893|consensus               42.9     8.4 0.00018   30.5   0.1   39    3-45      9-47  (341)
 58 KOG0320|consensus               42.4      14 0.00031   27.9   1.3   29   79-107   150-180 (187)
 59 cd00162 RING RING-finger (Real  42.4      15 0.00032   19.7   1.1   26    7-33      2-27  (45)
 60 PF04570 DUF581:  Protein of un  42.2      17 0.00036   22.2   1.3   12   34-45     18-29  (58)
 61 COG4847 Uncharacterized protei  39.9      11 0.00024   25.3   0.3   31   96-126     8-38  (103)
 62 PRK00420 hypothetical protein;  38.9      16 0.00034   25.5   0.9   25   33-62     24-48  (112)
 63 PF13920 zf-C3HC4_3:  Zinc fing  38.2      42 0.00092   19.2   2.7   27   79-105    19-48  (50)
 64 cd02336 ZZ_RSC8 Zinc finger, Z  37.9      41 0.00089   19.3   2.4   35  124-159     2-38  (45)
 65 KOG0978|consensus               37.7      12 0.00025   34.4   0.2   31   79-109   660-693 (698)
 66 PF12773 DZR:  Double zinc ribb  36.9      22 0.00047   20.4   1.2    8  125-132    32-39  (50)
 67 PF03107 C1_2:  C1 domain;  Int  36.7      35 0.00077   17.5   1.9   12    6-17      2-13  (30)
 68 PF13834 DUF4193:  Domain of un  34.5      12 0.00025   25.5  -0.3   30  121-150    69-98  (99)
 69 PF12674 Zn_ribbon_2:  Putative  34.2      16 0.00035   23.8   0.4   30  124-153     2-35  (81)
 70 PF05502 Dynactin_p62:  Dynacti  33.8      12 0.00027   32.9  -0.3  105   55-181     6-121 (483)
 71 PRK00807 50S ribosomal protein  33.6      39 0.00085   20.0   2.0   23   34-56      3-27  (52)
 72 PRK12495 hypothetical protein;  33.5      22 0.00047   27.8   1.1   25   32-62     42-66  (226)
 73 COG0068 HypF Hydrogenase matur  33.1      14  0.0003   34.0  -0.1   34    3-42    100-133 (750)
 74 PF03854 zf-P11:  P-11 zinc fin  32.8     8.6 0.00019   22.4  -0.9   23   83-105    22-46  (50)
 75 PF04981 NMD3:  NMD3 family ;    32.7      24 0.00051   27.8   1.2   23   35-64      1-23  (236)
 76 PF13639 zf-RING_2:  Ring finge  31.9      18  0.0004   20.1   0.3   29   96-124     2-31  (44)
 77 PRK14559 putative protein seri  31.0      22 0.00048   32.5   0.9   25   81-105    14-38  (645)
 78 PF07649 C1_3:  C1-like domain;  29.6      18 0.00038   18.5  -0.0   11    6-16      2-12  (30)
 79 PF01286 XPA_N:  XPA protein N-  27.9      21 0.00045   19.3   0.1   17    4-20      3-19  (34)
 80 PF09723 Zn-ribbon_8:  Zinc rib  27.8      16 0.00035   20.4  -0.4   10  123-132     6-15  (42)
 81 COG5152 Uncharacterized conser  26.9      18  0.0004   27.8  -0.3   28   79-106   213-242 (259)
 82 cd02249 ZZ Zinc finger, ZZ typ  26.8      43 0.00094   19.0   1.3    9  145-153    24-32  (46)
 83 KOG4739|consensus               26.0      36 0.00079   26.9   1.2   27   79-105    22-48  (233)
 84 COG4357 Zinc finger domain con  25.9     6.9 0.00015   26.4  -2.4   38    7-45     38-75  (105)
 85 PF10886 DUF2685:  Protein of u  25.1      60  0.0013   19.4   1.7   15    6-20      3-17  (54)
 86 PF06689 zf-C4_ClpX:  ClpX C4-t  24.2      45 0.00097   18.6   1.0   29  124-152     3-32  (41)
 87 PF06750 DiS_P_DiS:  Bacterial   24.2      33 0.00071   22.9   0.5   40    3-45     32-71  (92)
 88 smart00659 RPOLCX RNA polymera  24.0      36 0.00079   19.4   0.6   12   33-44      3-14  (44)
 89 PF10892 DUF2688:  Protein of u  24.0      16 0.00034   22.1  -0.9   20   83-102    27-46  (60)
 90 cd02340 ZZ_NBR1_like Zinc fing  23.7      41 0.00088   19.0   0.8   11    6-16      2-12  (43)
 91 TIGR00598 rad14 DNA repair pro  23.5      27 0.00059   26.3   0.0   12  180-191    68-79  (172)
 92 PF02591 DUF164:  Putative zinc  23.2      16 0.00034   21.8  -1.1   12   34-45     24-35  (56)
 93 PF10764 Gin:  Inhibitor of sig  23.1      59  0.0013   18.7   1.4   31  125-158     2-32  (46)
 94 smart00291 ZnF_ZZ Zinc-binding  22.9      91   0.002   17.4   2.2    9  145-153    28-36  (44)
 95 PF14634 zf-RING_5:  zinc-RING   22.5      29 0.00064   19.4   0.0   21   81-101    21-43  (44)
 96 KOG1829|consensus               22.5      23  0.0005   31.9  -0.6   33   31-63    339-375 (580)
 97 KOG1813|consensus               22.2      37  0.0008   27.8   0.5   28   79-106   258-287 (313)
 98 PF00096 zf-C2H2:  Zinc finger,  21.9      32  0.0007   15.9   0.1   13   33-45      1-13  (23)
 99 PF12855 Ecl1:  Life-span regul  21.3      36 0.00079   19.4   0.2   11   35-45      9-19  (43)
100 PF05181 XPA_C:  XPA protein C-  20.7      61  0.0013   19.3   1.1   11  180-190    38-48  (52)
101 KOG3476|consensus               20.6      42 0.00092   22.2   0.5   27   79-107    66-92  (100)
102 PRK11595 DNA utilization prote  20.5      59  0.0013   25.3   1.4   11   34-44      7-17  (227)

No 1  
>KOG1701|consensus
Probab=99.95  E-value=8.6e-29  Score=201.88  Aligned_cols=155  Identities=24%  Similarity=0.512  Sum_probs=128.9

Q ss_pred             CCCcccccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhccc-----ccc---------
Q psy4072           3 RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSE-----KNQ---------   68 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~-----~~~---------   68 (191)
                      .+.+|++|+|.|.++.....||++.||..||+|..|++.|.+. .||.+||++||+.||....     +.+         
T Consensus       273 ~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq-~FY~v~~k~~CE~cyq~tlekC~~Cg~~I~d~iLrA  351 (468)
T KOG1701|consen  273 YFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQ-SFYQVDGKPYCEGCYQDTLEKCNKCGEPIMDRILRA  351 (468)
T ss_pred             hhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccc-cccccCCcccchHHHHHHHHHHhhhhhHHHHHHHHh
Confidence            3568999999999988877899999999999999999999999 9999999999999997532     221         


Q ss_pred             ---eecccc--------------ceeeeCCeecchhhhhhhhhhhhhhcCCCccCCC-----eEEEecCccccccccccc
Q psy4072          69 ---FLDENC--------------TCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKRED-----FVMRAKNKIYHVQCFCCV  126 (191)
Q Consensus        69 ---~~~~~c--------------~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~-----~~~~~~~~~~H~~Cf~C~  126 (191)
                         ..+-.|              .....++.+||.+||++.||++|+.|+++|++.|     ..|+++++.||.+|++|.
T Consensus       352 ~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~G~~etvRvvamdr~fHv~CY~CE  431 (468)
T KOG1701|consen  352 LGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPRDGKDETVRVVAMDRDFHVNCYKCE  431 (468)
T ss_pred             cccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCCCCCcceEEEEEccccccccceehh
Confidence               111111              1236778999999999999999999999998643     346789999999999999


Q ss_pred             cCCCCCCC---CCceeeeCCccCCccccccccCCC
Q psy4072         127 VCGKQLVP---GDEFALREDGLFCKDDHEGMDKSS  158 (191)
Q Consensus       127 ~C~~~l~~---~~~~~~~~~~~~C~~c~~~~~~~~  158 (191)
                      .|+..|+.   +...+-.++.++|+.|+.++.+..
T Consensus       432 DCg~~LS~e~e~qgCyPld~HllCk~Ch~~Rl~~~  466 (468)
T KOG1701|consen  432 DCGLLLSSEEEGQGCYPLDGHLLCKTCHLKRLQAG  466 (468)
T ss_pred             hcCccccccCCCCcceeccCceeechhhhhhhccc
Confidence            99999982   445788899999999988776543


No 2  
>KOG4577|consensus
Probab=99.89  E-value=1.1e-25  Score=175.53  Aligned_cols=152  Identities=37%  Similarity=0.862  Sum_probs=126.7

Q ss_pred             CCCcccccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhcccccceeccccceeeeCCe
Q psy4072           3 RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGK   82 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~~~~~~~~~c~~~~~~~~   82 (191)
                      ..++|++|++.|.+++++. ++++.||..|++|+.|..+|...  +|                            .++++
T Consensus        32 eip~CagC~q~IlDrFilK-vl~R~wHs~CLkCs~C~~qL~dr--CF----------------------------sR~~s   80 (383)
T KOG4577|consen   32 EIPICAGCDQHILDRFILK-VLDRHWHSSCLKCSDCHDQLADR--CF----------------------------SREGS   80 (383)
T ss_pred             ccccccchHHHHHHHHHHH-HHhhhhhhhhcchhhhhhHHHHH--Hh----------------------------hcCCc
Confidence            5789999999999999986 67999999999999999999986  33                            39999


Q ss_pred             ecchhhhhhhhhhhhhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeee-CCccCCccccccccCCC---
Q psy4072          83 TYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALR-EDGLFCKDDHEGMDKSS---  158 (191)
Q Consensus        83 ~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~-~~~~~C~~c~~~~~~~~---  158 (191)
                      +||+++|.++|+.+|..|...|.+...+-.|.+..||..||.|..|++.|..|+.|++. +.++.|+..|+.....-   
T Consensus        81 ~yCkedFfKrfGTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~k~~~~  160 (383)
T KOG4577|consen   81 VYCKEDFFKRFGTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQKHCNE  160 (383)
T ss_pred             eeehHHHHHHhCCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHhccccc
Confidence            99999999999999999999999875445678899999999999999999999999877 56699999998655433   


Q ss_pred             ----CCCCCCCCCCCCCCCccCCCCCCCCcc
Q psy4072         159 ----NGENNNNNTNINNNLHNLNNEGSNSGK  185 (191)
Q Consensus       159 ----~~~~~~~~~~~~~~~~~~~~~~~~~~~  185 (191)
                          +++...+++..+.+...+-..+.||-|
T Consensus       161 l~gd~~nKRPRTTItAKqLETLK~AYn~SpK  191 (383)
T KOG4577|consen  161 LEGDASNKRPRTTITAKQLETLKQAYNTSPK  191 (383)
T ss_pred             cccccccCCCcceeeHHHHHHHHHHhcCCCc
Confidence                344556667777776666555555543


No 3  
>KOG1044|consensus
Probab=99.87  E-value=6.9e-23  Score=172.69  Aligned_cols=151  Identities=27%  Similarity=0.602  Sum_probs=120.8

Q ss_pred             CCCcccccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhcccccceeccccceeeeCCe
Q psy4072           3 RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGK   82 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~~~~~~~~~c~~~~~~~~   82 (191)
                      ++..|++|++.|..+..+ +|+++.||..||+|..|...|.+.                              |+.+||.
T Consensus       132 ~ps~cagc~~~lk~gq~l-lald~qwhv~cfkc~~c~~vL~ge------------------------------y~skdg~  180 (670)
T KOG1044|consen  132 GPSTCAGCGEELKNGQAL-LALDKQWHVSCFKCKSCSAVLNGE------------------------------YMSKDGV  180 (670)
T ss_pred             CCccccchhhhhhcccee-eeeccceeeeeeehhhhcccccce------------------------------eeccCCC
Confidence            567899999999977766 499999999999999999999885                              5569999


Q ss_pred             ecchhhhhhhhhhhhhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCCccCCccccccccCCCCCCC
Q psy4072          83 TYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSSNGEN  162 (191)
Q Consensus        83 ~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~~  162 (191)
                      |||+.||...|+.+|..|.+.|.  ++++.|.+++||+.|-+|+.|+..+..|+..++.+..+|-..|-.    ....+.
T Consensus       181 pyce~dy~~~fgvkc~~c~~fis--gkvLqag~kh~HPtCARCsRCgqmF~eGEEMYlQGs~iWHP~C~q----a~~tE~  254 (670)
T KOG1044|consen  181 PYCEKDYQAKFGVKCEECEKFIS--GKVLQAGDKHFHPTCARCSRCGQMFGEGEEMYLQGSEIWHPDCKQ----ATKTEE  254 (670)
T ss_pred             cchhhhhhhhcCeehHHhhhhhh--hhhhhccCcccCcchhhhhhhccccccchheeeccccccCCcccc----ccchhh
Confidence            99999999999999999999999  458999999999999999999999999999999999999888832    222222


Q ss_pred             CCCCCCCCCCCccCCCCCCCCcceeeee
Q psy4072         163 NNNNTNINNNLHNLNNEGSNSGKIQLYL  190 (191)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~  190 (191)
                      ...++..++.+.+.+..+++.|..|-++
T Consensus       255 i~~~~rtst~Si~~~~~~Ss~Gsp~~ti  282 (670)
T KOG1044|consen  255 ILKPGRTSTESIYSRPGSSTPGSPGHTI  282 (670)
T ss_pred             cccCCCCCcccccCCCCCCCCCCCCcEe
Confidence            2333333333344444555555555443


No 4  
>KOG2272|consensus
Probab=99.84  E-value=8.3e-23  Score=156.86  Aligned_cols=120  Identities=29%  Similarity=0.633  Sum_probs=109.3

Q ss_pred             CCCCCcccccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhcccccceeccccceeeeC
Q psy4072           1 KRRLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRD   80 (191)
Q Consensus         1 ~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~~~~~~~~~c~~~~~~   80 (191)
                      +.+.++|..|++||.++.+.  ++|+.||.++|+|+.|.+|+-+.                             ..|++.
T Consensus       192 ~mgipiCgaC~rpIeervi~--amgKhWHveHFvCa~CekPFlGH-----------------------------rHYEkk  240 (332)
T KOG2272|consen  192 KMGIPICGACRRPIEERVIF--AMGKHWHVEHFVCAKCEKPFLGH-----------------------------RHYEKK  240 (332)
T ss_pred             ccCCcccccccCchHHHHHH--HhccccchhheeehhcCCcccch-----------------------------hhhhhc
Confidence            35789999999999988775  89999999999999999998877                             445699


Q ss_pred             CeecchhhhhhhhhhhhhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCCccCCcccccc
Q psy4072          81 GKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEG  153 (191)
Q Consensus        81 ~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~  153 (191)
                      |.+||+.+|.++|+..|..|+.+|.++  ++.+.++.|-++||.|+.|.+.|....+|++.|-+|.|+.||.+
T Consensus       241 GlaYCe~h~~qLfG~~CF~C~~~i~G~--vv~al~KawCv~cf~Cs~Cdkkl~~K~Kf~E~DmkP~CKkCy~r  311 (332)
T KOG2272|consen  241 GLAYCETHYHQLFGNLCFICNRVIGGD--VVSALNKAWCVECFSCSTCDKKLTQKNKFYEFDMKPVCKKCYDR  311 (332)
T ss_pred             CchhHHHHHHHHhhhhheecCCccCcc--HHHHhhhhhccccccccccccccccccceeeeccchHHHHHHhh
Confidence            999999999999999999999999853  78899999999999999999999877889999999999999974


No 5  
>KOG2272|consensus
Probab=99.84  E-value=1.8e-23  Score=160.44  Aligned_cols=150  Identities=23%  Similarity=0.503  Sum_probs=126.9

Q ss_pred             CCCcccccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhcccc---cceecccc-----
Q psy4072           3 RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEK---NQFLDENC-----   74 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~~---~~~~~~~c-----   74 (191)
                      .+|.|+.|++-|.|+.+.  +++.+||+.||+|..|++.|.+. .++...|+..|..|-.+...   +++...+|     
T Consensus        72 faPcC~kC~EFiiGrVik--amnnSwHp~CF~Cd~Cn~~Lad~-gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD  148 (332)
T KOG2272|consen   72 FAPCCGKCGEFIIGRVIK--AMNNSWHPACFRCDLCNKHLADQ-GFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHID  148 (332)
T ss_pred             hchhhcccccchhhHHHH--hhccccCcccchhHHHHHHHhhh-hhHhhcchHHhhhhhhhhcccccceeehhhhhhhcc
Confidence            368899999999999776  88999999999999999999998 78888999999988765221   12221111     


Q ss_pred             ---------------------------ceeeeCCeecchhhhhhhhhhhhhhcCCCccCCCeEEEecCcccccccccccc
Q psy4072          75 ---------------------------TCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVV  127 (191)
Q Consensus        75 ---------------------------~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~  127 (191)
                                                 .-.+..|..||..|+.++--|+|..|.++|.  |+++.++|+.||.+.|+|+.
T Consensus       149 ~~~l~fr~d~yH~yHFkCt~C~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIe--ervi~amgKhWHveHFvCa~  226 (332)
T KOG2272|consen  149 EQPLTFRGDPYHPYHFKCTTCGKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIE--ERVIFAMGKHWHVEHFVCAK  226 (332)
T ss_pred             cccccccCCCCCccceecccccccccchhhhhccceeccccccccCCcccccccCchH--HHHHHHhccccchhheeehh
Confidence                                       1125668899999999888899999999998  67889999999999999999


Q ss_pred             CCCCCCCCCceeeeCCccCCccccccccCCC
Q psy4072         128 CGKQLVPGDEFALREDGLFCKDDHEGMDKSS  158 (191)
Q Consensus       128 C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~  158 (191)
                      |.+|+- |...++..|..||+.+|.++|+--
T Consensus       227 CekPFl-GHrHYEkkGlaYCe~h~~qLfG~~  256 (332)
T KOG2272|consen  227 CEKPFL-GHRHYEKKGLAYCETHYHQLFGNL  256 (332)
T ss_pred             cCCccc-chhhhhhcCchhHHHHHHHHhhhh
Confidence            999998 889999999999999999998765


No 6  
>KOG1701|consensus
Probab=99.84  E-value=1.2e-22  Score=166.20  Aligned_cols=121  Identities=26%  Similarity=0.535  Sum_probs=113.1

Q ss_pred             cccccccccCCCceEEeeCCeecccchhhcccccceeccccceeeeCCeecchhhhhhhhhhhhhhcCCCccCCCeEEEe
Q psy4072          34 RCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGTKCEKCNLNFKREDFVMRA  113 (191)
Q Consensus        34 ~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~~~~~~~~~c~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~  113 (191)
                      .|..|++.|.+...-..+++.+||..||++..+.+.|..+ .||..|+++||+.||.... .+|..|++.|+  |+++.|
T Consensus       276 iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq-~FY~v~~k~~CE~cyq~tl-ekC~~Cg~~I~--d~iLrA  351 (468)
T KOG1701|consen  276 ICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQ-SFYQVDGKPYCEGCYQDTL-EKCNKCGEPIM--DRILRA  351 (468)
T ss_pred             hhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccc-cccccCCcccchHHHHHHH-HHHhhhhhHHH--HHHHHh
Confidence            7899999999997888899999999999999999999988 8999999999999998765 79999999999  789999


Q ss_pred             cCccccccccccccCCCCCCCCCceeee-CCccCCccccccccCCCC
Q psy4072         114 KNKIYHVQCFCCVVCGKQLVPGDEFALR-EDGLFCKDDHEGMDKSSN  159 (191)
Q Consensus       114 ~~~~~H~~Cf~C~~C~~~l~~~~~~~~~-~~~~~C~~c~~~~~~~~~  159 (191)
                      .|+.||+.||+|..|.+.|. |..|.+. ++++||..+|.+.|+++.
T Consensus       352 ~GkayHp~CF~Cv~C~r~ld-gipFtvd~~n~v~Cv~dfh~kfAPrC  397 (468)
T KOG1701|consen  352 LGKAYHPGCFTCVVCARCLD-GIPFTVDSQNNVYCVPDFHKKFAPRC  397 (468)
T ss_pred             cccccCCCceEEEEeccccC-CccccccCCCceeeehhhhhhcCcch
Confidence            99999999999999999998 8899877 666999999999999995


No 7  
>KOG1703|consensus
Probab=99.73  E-value=8.2e-19  Score=151.23  Aligned_cols=123  Identities=25%  Similarity=0.574  Sum_probs=109.1

Q ss_pred             CCCcccccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhcccccceeccccceeeeCCe
Q psy4072           3 RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGK   82 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~~~~~~~~~c~~~~~~~~   82 (191)
                      ..+.|..|.+.|.+..++ +++++.||+.+|.|..|...|...                             .+...+|.
T Consensus       302 ~~p~c~~c~~~i~~~~~i-~~~~~~~h~~~~~c~~~~~~~~~~-----------------------------~~~~~~g~  351 (479)
T KOG1703|consen  302 TRPLCLSCNQKIRSVKVI-VALGKEWHPEHFSCEVCAIVILDG-----------------------------GPRELDGK  351 (479)
T ss_pred             ccccccccccCcccceeE-eeccccccccceeeccccccccCC-----------------------------CccccCCC
Confidence            358999999999994343 389999999999999999999887                             33348999


Q ss_pred             ecchhhhhhhhhhhhhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCCccCCccccccccCCC
Q psy4072          83 TYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSS  158 (191)
Q Consensus        83 ~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~  158 (191)
                      +||.+|+...+++.|.+|.++|.  +..|.+.+..||++||.|..|++++. ...|+..++.+||..||..++.++
T Consensus       352 ~~c~~~~~~~~~p~C~~C~~~i~--~~~v~a~~~~wH~~cf~C~~C~~~~~-~~~~~~~~~~pyce~~~~~~~~~~  424 (479)
T KOG1703|consen  352 ILCHECFHAPFRPNCKRCLLPIL--EEGVCALGRLWHPECFVCADCGKPLK-NSSFFESDGEPYCEDHYKKLFTTK  424 (479)
T ss_pred             ccHHHHHHHhhCccccccCCchH--HhHhhhccCeechhceeeecccCCCC-CCcccccCCccchhhhHhhhcccc
Confidence            99999999999999999999999  45788889999999999999999998 668999999999999999999754


No 8  
>KOG1703|consensus
Probab=99.73  E-value=5.3e-19  Score=152.38  Aligned_cols=117  Identities=29%  Similarity=0.608  Sum_probs=106.3

Q ss_pred             CCCcccccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhcccccceeccccceeeeCCe
Q psy4072           3 RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGK   82 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~~~~~~~~~c~~~~~~~~   82 (191)
                      ..+.|.+|+++|.++.+.  |+++.||+.||.|..|+++|.+. .                            |+..++.
T Consensus       362 ~~p~C~~C~~~i~~~~v~--a~~~~wH~~cf~C~~C~~~~~~~-~----------------------------~~~~~~~  410 (479)
T KOG1703|consen  362 FRPNCKRCLLPILEEGVC--ALGRLWHPECFVCADCGKPLKNS-S----------------------------FFESDGE  410 (479)
T ss_pred             hCccccccCCchHHhHhh--hccCeechhceeeecccCCCCCC-c----------------------------ccccCCc
Confidence            468899999999998886  67999999999999999999998 3                            4459999


Q ss_pred             ecchhhhhhhhhhhhhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCCccCCcccc
Q psy4072          83 TYCKRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH  151 (191)
Q Consensus        83 ~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~  151 (191)
                      |||+.||.+++..+|..|.++|...+..+.+.+..||..||+|..|...|. +..|+...+.++|..|+
T Consensus       411 pyce~~~~~~~~~~~~~~~~p~~~~~~~ie~~~~~~h~~~F~c~~c~~~l~-~~~~~~~~~~p~c~~~~  478 (479)
T KOG1703|consen  411 PYCEDHYKKLFTTKCDYCKKPVEFGSRQIEADGSPFHGDCFRCANCMKKLT-KKTFFETLDKPLCQKHF  478 (479)
T ss_pred             cchhhhHhhhccccchhccchhHhhhhHhhccCccccccceehhhhhcccc-CCceeecCCccccccCC
Confidence            999999999999999999999886677889999999999999999999998 77899999999999885


No 9  
>KOG1044|consensus
Probab=99.55  E-value=2.5e-15  Score=127.42  Aligned_cols=150  Identities=22%  Similarity=0.476  Sum_probs=106.9

Q ss_pred             CCcccccccccccceeEeecCCCcccccCccccccccccCCCceEEee-C---------------------Ceecccchh
Q psy4072           4 LSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVR-D---------------------GKTYCKRDY   61 (191)
Q Consensus         4 ~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~-~---------------------g~~yc~~c~   61 (191)
                      ...|..|.+.-.+..+-  +.+..||..||+|..|+..|... .||.. +                     |+.||+.||
T Consensus        16 ~i~c~~c~~kc~gevlr--v~d~~fhi~cf~c~~cg~~la~~-gff~k~~~~~ygt~~c~~~~~gevvsa~gktyh~~cf   92 (670)
T KOG1044|consen   16 GIKCDKCRKKCSGEVLR--VNDNHFHINCFQCKKCGRNLAEG-GFFTKPENRLYGTDDCRAFVEGEVVSTLGKTYHPKCF   92 (670)
T ss_pred             ceehhhhCCccccceeE--eeccccceeeeeccccCCCcccc-cceecccceeecccchhhhccceeEecccceeccccc
Confidence            34699999999987654  45999999999999999999887 45443 3                     334444444


Q ss_pred             hcccccceeccccceeeeCCeecchhhhhhh-------hh-hhhhhcCCCccCCCeEEEecCccccccccccccCCCCCC
Q psy4072          62 VSSEKNQFLDENCTCFVRDGKTYCKRDYVRL-------FG-TKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLV  133 (191)
Q Consensus        62 ~~~~~~~~~~~~c~~~~~~~~~~C~~c~~~~-------~~-~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~  133 (191)
                      .+..+...+.-.-..........|+.|....       .. ..|++|++.|..+ .++.|+++.||..||+|..|...|.
T Consensus        93 ~cs~ck~pf~~g~~vt~~gk~~~c~~c~~~~~~~p~~~~~ps~cagc~~~lk~g-q~llald~qwhv~cfkc~~c~~vL~  171 (670)
T KOG1044|consen   93 SCSTCKSPFKSGDKVTFSGKECLCQTCSQPMPVSPAESYGPSTCAGCGEELKNG-QALLALDKQWHVSCFKCKSCSAVLN  171 (670)
T ss_pred             eecccCCCCCCCCeeeecchhhhhhhhcCcccCCcccccCCccccchhhhhhcc-ceeeeeccceeeeeeehhhhccccc
Confidence            4444332221100111222334555554321       12 2799999999876 5777899999999999999999996


Q ss_pred             CCCceeeeCCccCCccccccccCCCC
Q psy4072         134 PGDEFALREDGLFCKDDHEGMDKSSN  159 (191)
Q Consensus       134 ~~~~~~~~~~~~~C~~c~~~~~~~~~  159 (191)
                       | .+...++.+||..+|...|+.+.
T Consensus       172 -g-ey~skdg~pyce~dy~~~fgvkc  195 (670)
T KOG1044|consen  172 -G-EYMSKDGVPYCEKDYQAKFGVKC  195 (670)
T ss_pred             -c-eeeccCCCcchhhhhhhhcCeeh
Confidence             5 68889999999999999999884


No 10 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.54  E-value=4e-15  Score=92.21  Aligned_cols=56  Identities=34%  Similarity=0.804  Sum_probs=45.9

Q ss_pred             ccccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhc
Q psy4072           7 CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVS   63 (191)
Q Consensus         7 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~   63 (191)
                      |++|+++|.+.++++.++|+.||+.||+|..|+++|.+. .++..+|++||..||.+
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~-~~~~~~~~~~C~~c~~~   56 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDG-DFYEKDGKPYCKDCYQK   56 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTS-SEEEETTEEEEHHHHHH
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCC-eeEeECCEEECHHHHhh
Confidence            889999999988875589999999999999999999998 46765555555555543


No 11 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.48  E-value=2e-14  Score=89.10  Aligned_cols=58  Identities=29%  Similarity=0.666  Sum_probs=52.4

Q ss_pred             hhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCCccCCcccccccc
Q psy4072          97 CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMD  155 (191)
Q Consensus        97 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~  155 (191)
                      |.+|+++|.+++.++.+.++.||++||+|..|+++|.. ..++..++++||..||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~-~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLND-GDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTT-SSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCC-CeeEeECCEEECHHHHhhhC
Confidence            78999999988877789999999999999999999984 45899999999999998765


No 12 
>KOG1700|consensus
Probab=99.37  E-value=9.6e-14  Score=106.67  Aligned_cols=154  Identities=23%  Similarity=0.419  Sum_probs=111.0

Q ss_pred             CCcccccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhccccccee--ccccc---eee
Q psy4072           4 LSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFL--DENCT---CFV   78 (191)
Q Consensus         4 ~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~~~~~~--~~~c~---~~~   78 (191)
                      ...|..|++.|+-.+.+. ..|..||+.||.|..|.+.|... .+..+++.+||..|+.....++..  .+..+   -..
T Consensus         7 ~~kc~~c~k~vy~~e~~~-~~g~~~hk~c~~c~~~~k~l~~~-~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~~~~   84 (200)
T KOG1700|consen    7 TDKCNACGKTVYFVEKVQ-KDGVDFHKECFKCEKCKKTLTLS-GYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAGGLG   84 (200)
T ss_pred             cchhhhccCcchHHHHHh-ccCcchhhhHHhccccccccccc-cccccccccccccchHhhhCcccccccccccccCCCC
Confidence            347999999999877764 78999999999999999999998 788899999999987665543211  11000   000


Q ss_pred             eCCe---ecc-----hhhhhhhhhhhhhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCCccCCccc
Q psy4072          79 RDGK---TYC-----KRDYVRLFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDD  150 (191)
Q Consensus        79 ~~~~---~~C-----~~c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c  150 (191)
                      .++.   .+.     ...........|.+|.+.+.+.+.+ ...+..||..||+|+.|+..|+ ...+...++.++|..+
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~g~~~~c~~c~k~vy~~Ek~-~~~~~~~hk~cfrc~~~~~~ls-~~~~~~~~g~l~~~~~  162 (200)
T KOG1700|consen   85 KDGKSLNESKPNQSAKFQVFAGEKEKCARCQKTVYPLEKV-TGNGLEFHKSCFRCTHCGKKLS-PKNYAALEGVLYCKHH  162 (200)
T ss_pred             cccccccccccccchhHHhhhccccccccccceeeehHHH-hhhhhhhhhhheeecccccccC-CcchhhcCCccccchh
Confidence            0110   111     1111112224899999999987754 4589999999999999999998 4578888999999888


Q ss_pred             cccccCCCCCC
Q psy4072         151 HEGMDKSSNGE  161 (191)
Q Consensus       151 ~~~~~~~~~~~  161 (191)
                      +..++......
T Consensus       163 ~~~~~~~~~~~  173 (200)
T KOG1700|consen  163 FAQLFKGKGNY  173 (200)
T ss_pred             hheeecCCCcc
Confidence            77766555433


No 13 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.82  E-value=3.1e-09  Score=59.90  Aligned_cols=38  Identities=32%  Similarity=0.815  Sum_probs=32.6

Q ss_pred             cccccccccccceeEeecCCCcccccCccccccccccC
Q psy4072           6 LCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLD   43 (191)
Q Consensus         6 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   43 (191)
                      .|.+|+++|.+.+....+.++.||+.||+|..|+.+|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            58999999999733335789999999999999999986


No 14 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.70  E-value=1.1e-08  Score=57.59  Aligned_cols=38  Identities=39%  Similarity=0.906  Sum_probs=34.0

Q ss_pred             hhhhcCCCccCCCeEEEecCccccccccccccCCCCCC
Q psy4072          96 KCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLV  133 (191)
Q Consensus        96 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~  133 (191)
                      +|.+|+++|.+.+..+.+.++.||+.||+|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            48899999997656788899999999999999999985


No 15 
>KOG4577|consensus
Probab=98.58  E-value=6.4e-10  Score=87.66  Aligned_cols=65  Identities=23%  Similarity=0.529  Sum_probs=58.2

Q ss_pred             hhhhhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCCccCCccccccccCCCCCC
Q psy4072          94 GTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSSNGE  161 (191)
Q Consensus        94 ~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~  161 (191)
                      -++|++|.+.|.+. .++.++++.||..|++|+.|..+|.  +..+.+++.+||+++|.++|+++..+
T Consensus        33 ip~CagC~q~IlDr-FilKvl~R~wHs~CLkCs~C~~qL~--drCFsR~~s~yCkedFfKrfGTKCsa   97 (383)
T KOG4577|consen   33 IPICAGCDQHILDR-FILKVLDRHWHSSCLKCSDCHDQLA--DRCFSREGSVYCKEDFFKRFGTKCSA   97 (383)
T ss_pred             cccccchHHHHHHH-HHHHHHhhhhhhhhcchhhhhhHHH--HHHhhcCCceeehHHHHHHhCCcchh
Confidence            37999999999954 5678899999999999999999995  68889999999999999999999654


No 16 
>KOG1702|consensus
Probab=98.11  E-value=1.3e-07  Score=71.49  Aligned_cols=89  Identities=19%  Similarity=0.345  Sum_probs=69.4

Q ss_pred             hhhhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCCccCCccccccccCCCCCCCCCC-----CCCC
Q psy4072          95 TKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSSNGENNNN-----NTNI  169 (191)
Q Consensus        95 ~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~~~~~-----~~~~  169 (191)
                      +.|..|++.+.+.|. +..+++.||..||.|..|+.+|. ...+...+.++||..+|.+..++....++..     .+.-
T Consensus         5 ~n~~~cgk~vYPvE~-v~cldk~whk~cfkce~c~mtln-mKnyKgy~kkpycn~hYpkq~at~~adTPEm~Rik~n~en   82 (264)
T KOG1702|consen    5 CNREDCGKTVYPVEE-VKCLDKVWHKQCFKCEVCGMTLN-MKNYKGYDKKPYCNPHYPKQVATVMADTPEMRRIKENTEN   82 (264)
T ss_pred             chhhhhccccccHHH-HhhHHHHHHHHhheeeeccCChh-hhhccccccCCCcCcccccceeeeecCCHHHHHHHhhhcc
Confidence            367889998888764 56789999999999999999997 6677778889999999998887765444322     2445


Q ss_pred             CCCCccCCCCCCCCcc
Q psy4072         170 NNNLHNLNNEGSNSGK  185 (191)
Q Consensus       170 ~~~~~~~~~~~~~~~~  185 (191)
                      .++++.+++.++++|+
T Consensus        83 qS~vkY~~e~ekmKG~   98 (264)
T KOG1702|consen   83 QSNVKYHAEYEKMKGT   98 (264)
T ss_pred             chhhhhHHHHHHhcCC
Confidence            5667777888888876


No 17 
>KOG0490|consensus
Probab=97.83  E-value=1.6e-06  Score=68.03  Aligned_cols=115  Identities=43%  Similarity=0.878  Sum_probs=91.4

Q ss_pred             ccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhcccccceeccccceeeeCCeecchhh
Q psy4072           9 GCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRD   88 (191)
Q Consensus         9 ~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~~~~~~~~~c~~~~~~~~~~C~~c   88 (191)
                      .|+..|.+...+. ..+..||..|..|..|...|......+.                            ++|..||..+
T Consensus         1 ~~~~~~~~~~~l~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------------------------~~g~~~~~~d   51 (235)
T KOG0490|consen    1 GCGRQILDRYLLR-VLDRYWHASCLKCAECDNPLGVGDTCFS----------------------------KDGSIYCKRD   51 (235)
T ss_pred             CCCccccchHHhh-cccHHHHHHHHhhhhhcchhccCCCccc----------------------------CCCccccccc
Confidence            4788888888775 5599999999999999999972212332                            4888888888


Q ss_pred             hhh--hhhhhhhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCC-ccCCcccccc
Q psy4072          89 YVR--LFGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALRED-GLFCKDDHEG  153 (191)
Q Consensus        89 ~~~--~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~-~~~C~~c~~~  153 (191)
                      |..  .+..+|.+|...|...|.+..+..+. |..||.|..|...+..+..+.+..+ +..|...+..
T Consensus        52 ~~~~~~~~~rr~rt~~~~~ql~~ler~f~~~-h~Pd~~~r~~la~~~~~~e~rVqvwFqnrrak~r~~  118 (235)
T KOG0490|consen   52 YQREFKFSKRCARCKFTISQLDELERAFEKV-HLPCFACRECLALLLTGDEFRVQVWFQNRRAKDRKE  118 (235)
T ss_pred             chhhhhccccccCCCCCcCHHHHHHHhhcCC-CcCccchHHHHhhcCCCCeeeeehhhhhhcHhhhhh
Confidence            887  66679999999987666666667777 9999999999988877888888877 6888877643


No 18 
>KOG1700|consensus
Probab=97.60  E-value=3e-05  Score=59.79  Aligned_cols=68  Identities=24%  Similarity=0.425  Sum_probs=56.0

Q ss_pred             hhhhhcCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCCccCCccccccccCCCCCCCCC
Q psy4072          95 TKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSSNGENNN  164 (191)
Q Consensus        95 ~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~~~~~~~  164 (191)
                      .+|.+|++.+...+++. ..+..||+.||+|..|.+.|. ...+...++.+||..++...+++.......
T Consensus         8 ~kc~~c~k~vy~~e~~~-~~g~~~hk~c~~c~~~~k~l~-~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~   75 (200)
T KOG1700|consen    8 DKCNACGKTVYFVEKVQ-KDGVDFHKECFKCEKCKKTLT-LSGYSEHEGVPYCKNCHVAQFGPKGGGFGK   75 (200)
T ss_pred             chhhhccCcchHHHHHh-ccCcchhhhHHhccccccccc-cccccccccccccccchHhhhCcccccccc
Confidence            58999999998766544 689999999999999999998 456777899999999888888887654443


No 19 
>KOG1702|consensus
Probab=97.42  E-value=1.3e-05  Score=60.80  Aligned_cols=61  Identities=23%  Similarity=0.477  Sum_probs=52.0

Q ss_pred             CCCcccccccccccceeEeecCCCcccccCccccccccccCCCceEEeeCCeecccchhhccc
Q psy4072           3 RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDYVSSE   65 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~   65 (191)
                      ....|..|++.+++.+.+. .+++.||..||+|..|+.+|... .+-.++.++||..+|-...
T Consensus         3 ~k~n~~~cgk~vYPvE~v~-cldk~whk~cfkce~c~mtlnmK-nyKgy~kkpycn~hYpkq~   63 (264)
T KOG1702|consen    3 KKCNREDCGKTVYPVEEVK-CLDKVWHKQCFKCEVCGMTLNMK-NYKGYDKKPYCNPHYPKQV   63 (264)
T ss_pred             ccchhhhhccccccHHHHh-hHHHHHHHHhheeeeccCChhhh-hccccccCCCcCcccccce
Confidence            3456889999999877764 78999999999999999999887 6667999999999996543


No 20 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=90.60  E-value=0.17  Score=30.40  Aligned_cols=39  Identities=33%  Similarity=0.796  Sum_probs=27.2

Q ss_pred             hhhhhhcCCCccCCCeEEE--ecCcccccccc----cccc--CCCCC
Q psy4072          94 GTKCEKCNLNFKREDFVMR--AKNKIYHVQCF----CCVV--CGKQL  132 (191)
Q Consensus        94 ~~~C~~C~~~I~~~~~~~~--~~~~~~H~~Cf----~C~~--C~~~l  132 (191)
                      +.+|..|+++|.++|.++.  .-+..||++|+    .|..  |+..+
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~~~~g~C~~~~c~~~~   51 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPECGAPYHRDCWEKAGGCINYSCGTGF   51 (54)
T ss_pred             CccChhhCCcccCCCCEEECCCCCCcccHHHHhhCCceEeccCCCCc
Confidence            4589999999975554554  34788999998    4654  55444


No 21 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=88.20  E-value=0.29  Score=27.05  Aligned_cols=26  Identities=27%  Similarity=0.551  Sum_probs=17.7

Q ss_pred             ccccccccccceeEeecCCCcccccC
Q psy4072           7 CVGCGGQIHDQYILRVAPDLEWHAAC   32 (191)
Q Consensus         7 C~~C~~~I~~~~~~~~~~~~~~H~~C   32 (191)
                      |..|+++|.+..++.-..|+.||.-|
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~fCC   26 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYYFCC   26 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEEEEC
Confidence            67788888876665445677776444


No 22 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=86.10  E-value=0.49  Score=26.12  Aligned_cols=29  Identities=31%  Similarity=0.717  Sum_probs=20.7

Q ss_pred             hhhcCCCccCCCeEEEecCcccccccccc
Q psy4072          97 CEKCNLNFKREDFVMRAKNKIYHVQCFCC  125 (191)
Q Consensus        97 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C  125 (191)
                      |+-|+..|.+...++...++.|+.-|-.|
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~fCC~tC   29 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYYFCCPTC   29 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEEEECHHH
Confidence            66788888876556677788887655444


No 23 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=85.82  E-value=0.53  Score=28.30  Aligned_cols=30  Identities=20%  Similarity=0.459  Sum_probs=20.4

Q ss_pred             CCcccccccccc--cceeEeecCCCcccccCc
Q psy4072           4 LSLCVGCGGQIH--DQYILRVAPDLEWHAACL   33 (191)
Q Consensus         4 ~~~C~~C~~~I~--~~~~~~~~~~~~~H~~Cf   33 (191)
                      ...|..|+++|.  ++-++-..-+..||.+|.
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~   36 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPECGAPYHRDCW   36 (54)
T ss_pred             CccChhhCCcccCCCCEEECCCCCCcccHHHH
Confidence            457889999995  333433456778888886


No 24 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=82.66  E-value=0.62  Score=28.47  Aligned_cols=28  Identities=21%  Similarity=0.515  Sum_probs=16.5

Q ss_pred             CCcccccccccccceeEeecCCCcccccCccccccccc
Q psy4072           4 LSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQF   41 (191)
Q Consensus         4 ~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~   41 (191)
                      .+.|..|+.+|.+.+... .         |.|-.|++.
T Consensus         7 ~~~CtSCg~~i~~~~~~~-~---------F~CPnCG~~   34 (59)
T PRK14890          7 PPKCTSCGIEIAPREKAV-K---------FLCPNCGEV   34 (59)
T ss_pred             CccccCCCCcccCCCccC-E---------eeCCCCCCe
Confidence            456777777776655321 2         666666655


No 25 
>KOG0490|consensus
Probab=80.96  E-value=0.56  Score=36.45  Aligned_cols=53  Identities=23%  Similarity=0.663  Sum_probs=40.4

Q ss_pred             cCCCccCCCeEEEecCccccccccccccCCCCCCCCCceeeeCCccCCcccccc
Q psy4072         100 CNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHEG  153 (191)
Q Consensus       100 C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~  153 (191)
                      |+..|.+. ..+.+.+..||..|..|..|...+..+...+..++..||...+.+
T Consensus         2 ~~~~~~~~-~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~d~~~   54 (235)
T KOG0490|consen    2 CGRQILDR-YLLRVLDRYWHASCLKCAECDNPLGVGDTCFSKDGSIYCKRDYQR   54 (235)
T ss_pred             CCccccch-HHhhcccHHHHHHHHhhhhhcchhccCCCcccCCCcccccccchh
Confidence            56667643 345566999999999999999999633445544888999999887


No 26 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=80.54  E-value=0.58  Score=31.88  Aligned_cols=30  Identities=10%  Similarity=0.099  Sum_probs=14.5

Q ss_pred             cccccccccCCCceEEeeCCeecccchhhc
Q psy4072          34 RCAECHQFLDENCTCFVRDGKTYCKRDYVS   63 (191)
Q Consensus        34 ~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~   63 (191)
                      +|..|+.++.....|....+.+-|-.||..
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~~   33 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFRE   33 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHHH
Confidence            455555555444334333445555555544


No 27 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=79.20  E-value=1.4  Score=29.87  Aligned_cols=28  Identities=25%  Similarity=0.566  Sum_probs=16.7

Q ss_pred             hhhhcCCCccCCCeEEEecCcccccccc
Q psy4072          96 KCEKCNLNFKREDFVMRAKNKIYHVQCF  123 (191)
Q Consensus        96 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf  123 (191)
                      .|+.|+++|.....++-..+..+|..|+
T Consensus        80 ~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   80 KCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CccCcCCcCCCceEEEeCCCeEEecccc
Confidence            5777777776543333334566676664


No 28 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=77.06  E-value=2.1  Score=28.94  Aligned_cols=28  Identities=18%  Similarity=0.271  Sum_probs=19.8

Q ss_pred             cccccccccCCCceEEe-eCCeecccchhh
Q psy4072          34 RCAECHQFLDENCTCFV-RDGKTYCKRDYV   62 (191)
Q Consensus        34 ~C~~C~~~l~~~~~~~~-~~g~~yc~~c~~   62 (191)
                      .|..|+++|... .|.. .+|.++|..|+.
T Consensus        80 ~C~vC~k~l~~~-~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   80 KCSVCGKPLGNS-VFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CccCcCCcCCCc-eEEEeCCCeEEeccccc
Confidence            588999999886 4443 367777777753


No 29 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=76.22  E-value=1.7  Score=31.07  Aligned_cols=22  Identities=32%  Similarity=0.771  Sum_probs=17.0

Q ss_pred             cccccccccCCCceEEeeCCeecccchh
Q psy4072          34 RCAECHQFLDENCTCFVRDGKTYCKRDY   61 (191)
Q Consensus        34 ~C~~C~~~l~~~~~~~~~~g~~yc~~c~   61 (191)
                      .|..|+.||      |..+|++||+-|-
T Consensus        30 hCp~Cg~PL------F~KdG~v~CPvC~   51 (131)
T COG1645          30 HCPKCGTPL------FRKDGEVFCPVCG   51 (131)
T ss_pred             hCcccCCcc------eeeCCeEECCCCC
Confidence            478888877      3478888888886


No 30 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=73.65  E-value=1.1  Score=30.61  Aligned_cols=29  Identities=24%  Similarity=0.451  Sum_probs=14.0

Q ss_pred             hhhhcCCCccCCCeEEEecCccccccccc
Q psy4072          96 KCEKCNLNFKREDFVMRAKNKIYHVQCFC  124 (191)
Q Consensus        96 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~  124 (191)
                      +|..|+++|..++..--..+..-|-.||+
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~   32 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFR   32 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHH
Confidence            45556666655432222233445555554


No 31 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=69.52  E-value=2.8  Score=20.76  Aligned_cols=12  Identities=17%  Similarity=0.642  Sum_probs=6.6

Q ss_pred             hhhcCCCccCCC
Q psy4072          97 CEKCNLNFKRED  108 (191)
Q Consensus        97 C~~C~~~I~~~~  108 (191)
                      |.+|+..|.+.+
T Consensus         1 C~sC~~~i~~r~   12 (24)
T PF07754_consen    1 CTSCGRPIAPRE   12 (24)
T ss_pred             CccCCCcccCcc
Confidence            455666665443


No 32 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=67.90  E-value=2.8  Score=20.46  Aligned_cols=10  Identities=50%  Similarity=1.315  Sum_probs=5.6

Q ss_pred             cccccccccc
Q psy4072           7 CVGCGGQIHD   16 (191)
Q Consensus         7 C~~C~~~I~~   16 (191)
                      |..|+.+|.+
T Consensus         2 Cp~CG~~~~~   11 (23)
T PF13240_consen    2 CPNCGAEIED   11 (23)
T ss_pred             CcccCCCCCC
Confidence            5556665544


No 33 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=67.21  E-value=7.5  Score=23.37  Aligned_cols=45  Identities=13%  Similarity=0.248  Sum_probs=28.2

Q ss_pred             ccccccccccCCCceEEeeCCeecccchhhcccccceeccccceeeeCCeecchhhhhhhhh--hhhhhcCCCccCC
Q psy4072          33 LRCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFG--TKCEKCNLNFKRE  107 (191)
Q Consensus        33 f~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~~~~~~~~~~c~~~~~~~~~~C~~c~~~~~~--~~C~~C~~~I~~~  107 (191)
                      |.|..|+..+...  +..                            ..|..||+.+..+.+.  ..|+.|++++...
T Consensus         2 ~~Cpi~~~~~~~P--v~~----------------------------~~G~v~~~~~i~~~~~~~~~cP~~~~~~~~~   48 (63)
T smart00504        2 FLCPISLEVMKDP--VIL----------------------------PSGQTYERRAIEKWLLSHGTDPVTGQPLTHE   48 (63)
T ss_pred             cCCcCCCCcCCCC--EEC----------------------------CCCCEEeHHHHHHHHHHCCCCCCCcCCCChh
Confidence            5678888887775  333                            4456666666554432  3687888777543


No 34 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=64.67  E-value=5.6  Score=24.81  Aligned_cols=30  Identities=17%  Similarity=0.358  Sum_probs=16.6

Q ss_pred             eCCeecchhhhhhhhhhhhhhcCCCccCCC
Q psy4072          79 RDGKTYCKRDYVRLFGTKCEKCNLNFKRED  108 (191)
Q Consensus        79 ~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~  108 (191)
                      .=...||..|..+.++..|+.|..|....|
T Consensus        25 ~CeH~fCs~Ci~~~~~~~CPvC~~Paw~qD   54 (65)
T PF14835_consen   25 GCEHIFCSSCIRDCIGSECPVCHTPAWIQD   54 (65)
T ss_dssp             SSS--B-TTTGGGGTTTB-SSS--B-S-SS
T ss_pred             cCccHHHHHHhHHhcCCCCCCcCChHHHHH
Confidence            335678888888888888999998876554


No 35 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=62.72  E-value=3  Score=23.58  Aligned_cols=22  Identities=36%  Similarity=0.845  Sum_probs=12.3

Q ss_pred             cccccccccCCCceEEeeCCeecccch
Q psy4072          34 RCAECHQFLDENCTCFVRDGKTYCKRD   60 (191)
Q Consensus        34 ~C~~C~~~l~~~~~~~~~~g~~yc~~c   60 (191)
                      .|..|+.||-..     ++|+.||..|
T Consensus        19 ~Cp~C~~PL~~~-----k~g~~~Cv~C   40 (41)
T PF06677_consen   19 HCPDCGTPLMRD-----KDGKIYCVSC   40 (41)
T ss_pred             ccCCCCCeeEEe-----cCCCEECCCC
Confidence            456777776543     4555555443


No 36 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=62.28  E-value=5.2  Score=21.86  Aligned_cols=22  Identities=32%  Similarity=0.652  Sum_probs=11.8

Q ss_pred             cccccccccCCCceEEeeCCeecccch
Q psy4072          34 RCAECHQFLDENCTCFVRDGKTYCKRD   60 (191)
Q Consensus        34 ~C~~C~~~l~~~~~~~~~~g~~yc~~c   60 (191)
                      .|..|+..     .+...+|..||..|
T Consensus        10 ~C~~C~~~-----~~~~~dG~~yC~~c   31 (36)
T PF11781_consen   10 PCPVCGSR-----WFYSDDGFYYCDRC   31 (36)
T ss_pred             cCCCCCCe-----EeEccCCEEEhhhC
Confidence            46777554     24445555555444


No 37 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=61.48  E-value=5  Score=25.48  Aligned_cols=46  Identities=17%  Similarity=0.399  Sum_probs=20.3

Q ss_pred             CCeecchhhhhhhh-hhhhhhcCCCccCCCeEEEecCccccccccccccCCCCCC
Q psy4072          80 DGKTYCKRDYVRLF-GTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLV  133 (191)
Q Consensus        80 ~~~~~C~~c~~~~~-~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~  133 (191)
                      ++..+|..|-.... ...|+.|++++.    ++.|-|..    =|.|..|+..++
T Consensus        15 ~~~~~C~~C~~~~~~~a~CPdC~~~Le----~LkACGAv----dYFC~~c~gLiS   61 (70)
T PF07191_consen   15 GGHYHCEACQKDYKKEAFCPDCGQPLE----VLKACGAV----DYFCNHCHGLIS   61 (70)
T ss_dssp             TTEEEETTT--EEEEEEE-TTT-SB-E----EEEETTEE----EEE-TTTT-EE-
T ss_pred             CCEEECccccccceecccCCCcccHHH----HHHHhccc----ceeeccCCceee
Confidence            34555555533211 147888888774    45554431    155777777665


No 38 
>KOG2462|consensus
Probab=60.86  E-value=3.5  Score=33.22  Aligned_cols=16  Identities=19%  Similarity=0.532  Sum_probs=12.3

Q ss_pred             ccCccccccccccCCC
Q psy4072          30 AACLRCAECHQFLDEN   45 (191)
Q Consensus        30 ~~Cf~C~~C~~~l~~~   45 (191)
                      ...++|..|++.+...
T Consensus       128 ~~r~~c~eCgk~ysT~  143 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTS  143 (279)
T ss_pred             CCceeccccccccccc
Confidence            3467899999988765


No 39 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=59.17  E-value=4.5  Score=21.97  Aligned_cols=31  Identities=19%  Similarity=0.545  Sum_probs=18.7

Q ss_pred             ccccccccccceeEeecCCCcccccCccccccccccC
Q psy4072           7 CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLD   43 (191)
Q Consensus         7 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~   43 (191)
                      |..|.+++.+      ..++.||..=..|..|+-.+.
T Consensus         2 C~~C~~Ey~~------p~~RR~~~~~isC~~CGPr~~   32 (35)
T PF07503_consen    2 CDDCLKEYFD------PSNRRFHYQFISCTNCGPRYS   32 (35)
T ss_dssp             -HHHHHHHCS------TTSTTTT-TT--BTTCC-SCC
T ss_pred             CHHHHHHHcC------CCCCcccCcCccCCCCCCCEE
Confidence            5566554433      458999999999999987664


No 40 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=58.24  E-value=4.4  Score=24.01  Aligned_cols=30  Identities=27%  Similarity=0.675  Sum_probs=21.8

Q ss_pred             ccccCCCCCCCCCceeeeCCccCCccccccc
Q psy4072         124 CCVVCGKQLVPGDEFALREDGLFCKDDHEGM  154 (191)
Q Consensus       124 ~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~  154 (191)
                      .|..|+..++.-..+-+.|| ..|..|+.++
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            37788888864334556677 6899999877


No 41 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=56.22  E-value=4.5  Score=24.73  Aligned_cols=27  Identities=22%  Similarity=0.661  Sum_probs=18.4

Q ss_pred             hhhhhcCCCccCCCeEEEecCccccccccccccCCCC
Q psy4072          95 TKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQ  131 (191)
Q Consensus        95 ~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~  131 (191)
                      +.|.+|+..|.+++..+.          |.|-.|+..
T Consensus        10 ~~CtSCg~~i~p~e~~v~----------F~CPnCGe~   36 (61)
T COG2888          10 PVCTSCGREIAPGETAVK----------FPCPNCGEV   36 (61)
T ss_pred             ceeccCCCEeccCCceeE----------eeCCCCCce
Confidence            589999998876665544          556666633


No 42 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=55.71  E-value=2.9  Score=27.87  Aligned_cols=16  Identities=44%  Similarity=0.918  Sum_probs=13.3

Q ss_pred             hhhhhhhhhhhcCCCc
Q psy4072          89 YVRLFGTKCEKCNLNF  104 (191)
Q Consensus        89 ~~~~~~~~C~~C~~~I  104 (191)
                      |...|...|..|++.+
T Consensus        49 Y~~lfs~pC~~C~klL   64 (90)
T PF11571_consen   49 YRNLFSTPCKKCGKLL   64 (90)
T ss_pred             HhhhccchhhHHHhHh
Confidence            5667778999999987


No 43 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=54.52  E-value=16  Score=22.13  Aligned_cols=24  Identities=17%  Similarity=0.432  Sum_probs=19.6

Q ss_pred             eecchhhhhhhhhhhhhhcCCCcc
Q psy4072          82 KTYCKRDYVRLFGTKCEKCNLNFK  105 (191)
Q Consensus        82 ~~~C~~c~~~~~~~~C~~C~~~I~  105 (191)
                      -.||.+|....+...|+.|+..+.
T Consensus        29 CTFC~~C~e~~l~~~CPNCgGelv   52 (57)
T PF06906_consen   29 CTFCADCAETMLNGVCPNCGGELV   52 (57)
T ss_pred             CcccHHHHHHHhcCcCcCCCCccc
Confidence            467899988888889999987665


No 44 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=53.99  E-value=7.4  Score=23.19  Aligned_cols=23  Identities=35%  Similarity=0.904  Sum_probs=10.1

Q ss_pred             ccccccccCCCceEEeeCCeeccc
Q psy4072          35 CAECHQFLDENCTCFVRDGKTYCK   58 (191)
Q Consensus        35 C~~C~~~l~~~~~~~~~~g~~yc~   58 (191)
                      |..|.-.++.. .-+..||+.||-
T Consensus        10 C~~C~C~V~~~-~Ai~~dGk~YCS   32 (52)
T PF02069_consen   10 CPSCSCVVSEE-EAIQKDGKYYCS   32 (52)
T ss_dssp             STT----B-TT-TSEESSS-EESS
T ss_pred             CCCCEeEECch-HhHHhCCEeeec
Confidence            56777777755 455656666663


No 45 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=53.93  E-value=13  Score=24.90  Aligned_cols=24  Identities=21%  Similarity=0.516  Sum_probs=16.7

Q ss_pred             CeecchhhhhhhhhhhhhhcCCCccC
Q psy4072          81 GKTYCKRDYVRLFGTKCEKCNLNFKR  106 (191)
Q Consensus        81 ~~~~C~~c~~~~~~~~C~~C~~~I~~  106 (191)
                      |.-||..|-.+.  ..|+-|++.|.+
T Consensus        58 g~~YCq~CAYkk--GiCamCGKki~d   81 (90)
T PF10235_consen   58 GAKYCQTCAYKK--GICAMCGKKILD   81 (90)
T ss_pred             CCccChhhhccc--CcccccCCeecc
Confidence            556788884333  389999988863


No 46 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=52.66  E-value=7.4  Score=30.01  Aligned_cols=31  Identities=19%  Similarity=0.357  Sum_probs=25.4

Q ss_pred             cccccCCCCCCCCCceeeeCCccCCccccccc
Q psy4072         123 FCCVVCGKQLVPGDEFALREDGLFCKDDHEGM  154 (191)
Q Consensus       123 f~C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~  154 (191)
                      -+|+.|+..+. .......+|++.|..|+.+.
T Consensus       173 v~C~kCGE~~~-e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFM-EPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccc-cchhhhcCCceecccccccc
Confidence            58999999987 45667779999999998754


No 47 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=50.77  E-value=6.5  Score=30.31  Aligned_cols=30  Identities=30%  Similarity=0.611  Sum_probs=21.1

Q ss_pred             ccccccccccCCCceEEeeCCeecccchhhc
Q psy4072          33 LRCAECHQFLDENCTCFVRDGKTYCKRDYVS   63 (191)
Q Consensus        33 f~C~~C~~~l~~~~~~~~~~g~~yc~~c~~~   63 (191)
                      -+|..|+..+... .....+|++.|..|+..
T Consensus       173 v~C~kCGE~~~e~-~~~~~ng~~vC~~C~~~  202 (206)
T COG2191         173 VRCSKCGELFMEP-RAVVLNGKPVCKPCAEK  202 (206)
T ss_pred             eeccccCcccccc-hhhhcCCceeccccccc
Confidence            5799999998877 45555666666666653


No 48 
>KOG1734|consensus
Probab=50.59  E-value=4  Score=32.87  Aligned_cols=43  Identities=26%  Similarity=0.576  Sum_probs=28.3

Q ss_pred             CCCcccccccccccce--------eEeecCCCcccccCc----------cccccccccCCC
Q psy4072           3 RLSLCVGCGGQIHDQY--------ILRVAPDLEWHAACL----------RCAECHQFLDEN   45 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~--------~~~~~~~~~~H~~Cf----------~C~~C~~~l~~~   45 (191)
                      ...+|+.|++.|....        ...+.-+..+|+.|.          .|..|++.++.+
T Consensus       223 ~d~vCaVCg~~~~~s~~eegvienty~LsCnHvFHEfCIrGWcivGKkqtCPYCKekVdl~  283 (328)
T KOG1734|consen  223 SDSVCAVCGQQIDVSVDEEGVIENTYKLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLK  283 (328)
T ss_pred             CcchhHhhcchheeecchhhhhhhheeeecccchHHHhhhhheeecCCCCCchHHHHhhHh
Confidence            3467999999987543        122356889999886          366666555544


No 49 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=48.76  E-value=52  Score=25.26  Aligned_cols=12  Identities=25%  Similarity=0.506  Sum_probs=7.7

Q ss_pred             cccccCCCCCCC
Q psy4072         123 FCCVVCGKQLVP  134 (191)
Q Consensus       123 f~C~~C~~~l~~  134 (191)
                      ..|-.|...+..
T Consensus        69 ~~CPvCR~~Is~   80 (193)
T PLN03208         69 PKCPVCKSDVSE   80 (193)
T ss_pred             CcCCCCCCcCCh
Confidence            466777777753


No 50 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=48.39  E-value=5  Score=25.94  Aligned_cols=30  Identities=27%  Similarity=0.728  Sum_probs=17.9

Q ss_pred             hhhhhcCCCccCCCeEEEe-----cC-----ccccccccc
Q psy4072          95 TKCEKCNLNFKREDFVMRA-----KN-----KIYHVQCFC  124 (191)
Q Consensus        95 ~~C~~C~~~I~~~~~~~~~-----~~-----~~~H~~Cf~  124 (191)
                      ..|..|++.|..++..+..     .+     ..||..||.
T Consensus         8 a~Ck~C~~~I~kg~lRiG~~~~~~~~~~~~~~W~H~~C~~   47 (82)
T PF00645_consen    8 AKCKGCKKKIAKGELRIGKIVPSPEGDGDIPKWYHWDCFF   47 (82)
T ss_dssp             EBETTTSCBE-TTSEEEEEEEEETTSSCEEEEEEEHHHHH
T ss_pred             ccCcccCCcCCCCCEEEEEEecccccCCCCCceECccccc
Confidence            3788999999876533321     11     345777765


No 51 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=47.63  E-value=13  Score=27.50  Aligned_cols=53  Identities=19%  Similarity=0.436  Sum_probs=35.7

Q ss_pred             CeecchhhhhhhhhhhhhhcCCCccCCCe---EEEecCccccccccccccCCCCCCCCC
Q psy4072          81 GKTYCKRDYVRLFGTKCEKCNLNFKREDF---VMRAKNKIYHVQCFCCVVCGKQLVPGD  136 (191)
Q Consensus        81 ~~~~C~~c~~~~~~~~C~~C~~~I~~~~~---~~~~~~~~~H~~Cf~C~~C~~~l~~~~  136 (191)
                      ..-||..|-.+.. ..|+.|+.+|.+...   ++. .+..|+.- --|..|+++..+..
T Consensus        27 ~~~fC~kCG~~tI-~~Cp~C~~~IrG~y~v~gv~~-~g~~~~~P-sYC~~CGkpyPWt~   82 (158)
T PF10083_consen   27 REKFCSKCGAKTI-TSCPNCSTPIRGDYHVEGVFG-LGGHYEAP-SYCHNCGKPYPWTE   82 (158)
T ss_pred             HHHHHHHhhHHHH-HHCcCCCCCCCCceecCCeee-eCCCCCCC-hhHHhCCCCCchHH
Confidence            3568888876655 689999999986421   222 34555533 34889999988643


No 52 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=46.97  E-value=13  Score=18.50  Aligned_cols=10  Identities=30%  Similarity=0.856  Sum_probs=4.8

Q ss_pred             ccccccccCC
Q psy4072          35 CAECHQFLDE   44 (191)
Q Consensus        35 C~~C~~~l~~   44 (191)
                      |..|++.+..
T Consensus         5 Cp~Cg~~~~~   14 (26)
T PF13248_consen    5 CPNCGAEIDP   14 (26)
T ss_pred             CcccCCcCCc
Confidence            4555554433


No 53 
>KOG3579|consensus
Probab=46.36  E-value=9.5  Score=31.00  Aligned_cols=13  Identities=38%  Similarity=0.948  Sum_probs=7.4

Q ss_pred             ccccccccccCCC
Q psy4072          33 LRCAECHQFLDEN   45 (191)
Q Consensus        33 f~C~~C~~~l~~~   45 (191)
                      ++|..|...|.+.
T Consensus       269 LcCTLC~ERLEDT  281 (352)
T KOG3579|consen  269 LCCTLCHERLEDT  281 (352)
T ss_pred             eeehhhhhhhccC
Confidence            5555566666554


No 54 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=44.35  E-value=17  Score=21.09  Aligned_cols=14  Identities=29%  Similarity=0.593  Sum_probs=9.1

Q ss_pred             CCCccccccccccc
Q psy4072           3 RLSLCVGCGGQIHD   16 (191)
Q Consensus         3 ~~~~C~~C~~~I~~   16 (191)
                      .+..|..|++.|.+
T Consensus        10 ~~~~C~~C~~~i~g   23 (53)
T PF00130_consen   10 KPTYCDVCGKFIWG   23 (53)
T ss_dssp             STEB-TTSSSBECS
T ss_pred             CCCCCcccCcccCC
Confidence            45678888888843


No 55 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=43.42  E-value=2.1  Score=23.19  Aligned_cols=10  Identities=30%  Similarity=0.929  Sum_probs=4.0

Q ss_pred             ccccccccCC
Q psy4072          35 CAECHQFLDE   44 (191)
Q Consensus        35 C~~C~~~l~~   44 (191)
                      |..|+.+|..
T Consensus         6 C~~CGe~I~~   15 (36)
T PF01258_consen    6 CEDCGEPIPE   15 (36)
T ss_dssp             -TTTSSBEEH
T ss_pred             ccccCChHHH
Confidence            4444444443


No 56 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=43.27  E-value=7.1  Score=20.06  Aligned_cols=11  Identities=27%  Similarity=0.682  Sum_probs=5.6

Q ss_pred             hhhhhcCCCcc
Q psy4072          95 TKCEKCNLNFK  105 (191)
Q Consensus        95 ~~C~~C~~~I~  105 (191)
                      .+|.+|+..|.
T Consensus         2 ~~C~rC~~~~~   12 (30)
T PF06827_consen    2 EKCPRCWNYIE   12 (30)
T ss_dssp             SB-TTT--BBE
T ss_pred             CcCccCCCcce
Confidence            36888888775


No 57 
>KOG2893|consensus
Probab=42.91  E-value=8.4  Score=30.52  Aligned_cols=39  Identities=26%  Similarity=0.457  Sum_probs=29.2

Q ss_pred             CCCcccccccccccceeEeecCCCcccccCccccccccccCCC
Q psy4072           3 RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDEN   45 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~   45 (191)
                      ..+-|..|++.+.+..+++ -   .--..+|+|..|.+.|-+.
T Consensus         9 ~kpwcwycnrefddekili-q---hqkakhfkchichkkl~sg   47 (341)
T KOG2893|consen    9 DKPWCWYCNREFDDEKILI-Q---HQKAKHFKCHICHKKLFSG   47 (341)
T ss_pred             CCceeeecccccchhhhhh-h---hhhhccceeeeehhhhccC
Confidence            4566999999999887763 2   2335679999999888655


No 58 
>KOG0320|consensus
Probab=42.45  E-value=14  Score=27.88  Aligned_cols=29  Identities=17%  Similarity=0.540  Sum_probs=20.7

Q ss_pred             eCCeecchhhhhhhhh--hhhhhcCCCccCC
Q psy4072          79 RDGKTYCKRDYVRLFG--TKCEKCNLNFKRE  107 (191)
Q Consensus        79 ~~~~~~C~~c~~~~~~--~~C~~C~~~I~~~  107 (191)
                      +=|.+||..|-.....  .+|+.|++.|...
T Consensus       150 kCGHvFC~~Cik~alk~~~~CP~C~kkIt~k  180 (187)
T KOG0320|consen  150 KCGHVFCSQCIKDALKNTNKCPTCRKKITHK  180 (187)
T ss_pred             ccchhHHHHHHHHHHHhCCCCCCcccccchh
Confidence            5577778777665443  5899999988743


No 59 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=42.40  E-value=15  Score=19.72  Aligned_cols=26  Identities=15%  Similarity=0.459  Sum_probs=14.1

Q ss_pred             ccccccccccceeEeecCCCcccccCc
Q psy4072           7 CVGCGGQIHDQYILRVAPDLEWHAACL   33 (191)
Q Consensus         7 C~~C~~~I~~~~~~~~~~~~~~H~~Cf   33 (191)
                      |..|...+.....+ ..-|..||..|+
T Consensus         2 C~iC~~~~~~~~~~-~~C~H~~c~~C~   27 (45)
T cd00162           2 CPICLEEFREPVVL-LPCGHVFCRSCI   27 (45)
T ss_pred             CCcCchhhhCceEe-cCCCChhcHHHH
Confidence            66677666332222 235666666665


No 60 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=42.16  E-value=17  Score=22.20  Aligned_cols=12  Identities=33%  Similarity=0.617  Sum_probs=9.6

Q ss_pred             cccccccccCCC
Q psy4072          34 RCAECHQFLDEN   45 (191)
Q Consensus        34 ~C~~C~~~l~~~   45 (191)
                      .|..|++.|...
T Consensus        18 ~C~~C~k~L~~~   29 (58)
T PF04570_consen   18 FCYLCKKKLDPG   29 (58)
T ss_pred             HHHccCCCCCCC
Confidence            578899999854


No 61 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=39.92  E-value=11  Score=25.33  Aligned_cols=31  Identities=19%  Similarity=0.301  Sum_probs=15.0

Q ss_pred             hhhhcCCCccCCCeEEEecCccccccccccc
Q psy4072          96 KCEKCNLNFKREDFVMRAKNKIYHVQCFCCV  126 (191)
Q Consensus        96 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~  126 (191)
                      +|..|+.+|..++..--....+.|-+||.=+
T Consensus         8 kC~VCg~~iieGqkFTF~~kGsVH~eCl~~s   38 (103)
T COG4847           8 KCYVCGGTIIEGQKFTFTKKGSVHYECLAES   38 (103)
T ss_pred             eEeeeCCEeeeccEEEEeeCCcchHHHHHHH
Confidence            4566666665544322223444555555443


No 62 
>PRK00420 hypothetical protein; Validated
Probab=38.88  E-value=16  Score=25.51  Aligned_cols=25  Identities=28%  Similarity=0.413  Sum_probs=15.9

Q ss_pred             ccccccccccCCCceEEeeCCeecccchhh
Q psy4072          33 LRCAECHQFLDENCTCFVRDGKTYCKRDYV   62 (191)
Q Consensus        33 f~C~~C~~~l~~~~~~~~~~g~~yc~~c~~   62 (191)
                      -.|..|+.+|...     .+|+.||+.|-.
T Consensus        24 ~~CP~Cg~pLf~l-----k~g~~~Cp~Cg~   48 (112)
T PRK00420         24 KHCPVCGLPLFEL-----KDGEVVCPVHGK   48 (112)
T ss_pred             CCCCCCCCcceec-----CCCceECCCCCC
Confidence            3577888777542     566666666654


No 63 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=38.22  E-value=42  Score=19.17  Aligned_cols=27  Identities=26%  Similarity=0.568  Sum_probs=18.7

Q ss_pred             eCCee-cchhhhhhhhh--hhhhhcCCCcc
Q psy4072          79 RDGKT-YCKRDYVRLFG--TKCEKCNLNFK  105 (191)
Q Consensus        79 ~~~~~-~C~~c~~~~~~--~~C~~C~~~I~  105 (191)
                      .=|.. +|..|..+...  ..|+.|+.+|.
T Consensus        19 pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~   48 (50)
T PF13920_consen   19 PCGHLCFCEECAERLLKRKKKCPICRQPIE   48 (50)
T ss_dssp             TTCEEEEEHHHHHHHHHTTSBBTTTTBB-S
T ss_pred             CCCChHHHHHHhHHhcccCCCCCcCChhhc
Confidence            34555 88888777643  58999998885


No 64 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=37.88  E-value=41  Score=19.28  Aligned_cols=35  Identities=17%  Similarity=0.239  Sum_probs=19.9

Q ss_pred             ccccCCCCCCCCCceeee-C-CccCCccccccccCCCC
Q psy4072         124 CCVVCGKQLVPGDEFALR-E-DGLFCKDDHEGMDKSSN  159 (191)
Q Consensus       124 ~C~~C~~~l~~~~~~~~~-~-~~~~C~~c~~~~~~~~~  159 (191)
                      .|..|+..+. ...+.-. . +..+|..||.+-..+..
T Consensus         2 ~C~~Cg~D~t-~vryh~~~~~~~dLC~~CF~~G~f~~~   38 (45)
T cd02336           2 HCFTCGNDCT-RVRYHNLKAKKYDLCPSCYQEGRFPSN   38 (45)
T ss_pred             cccCCCCccC-ceEEEecCCCccccChHHHhCcCCCCC
Confidence            4666777775 3334322 2 23689999865544443


No 65 
>KOG0978|consensus
Probab=37.73  E-value=12  Score=34.41  Aligned_cols=31  Identities=32%  Similarity=0.706  Sum_probs=25.1

Q ss_pred             eCCeecchhhhhhhhhh---hhhhcCCCccCCCe
Q psy4072          79 RDGKTYCKRDYVRLFGT---KCEKCNLNFKREDF  109 (191)
Q Consensus        79 ~~~~~~C~~c~~~~~~~---~C~~C~~~I~~~~~  109 (191)
                      +=+..||..|...++..   +|+.|+.+..+.|.
T Consensus       660 kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFganDv  693 (698)
T KOG0978|consen  660 KCGHVFCEECVQTRYETRQRKCPKCNAAFGANDV  693 (698)
T ss_pred             hcchHHHHHHHHHHHHHhcCCCCCCCCCCCcccc
Confidence            44678999999888875   79999998887763


No 66 
>PF12773 DZR:  Double zinc ribbon
Probab=36.93  E-value=22  Score=20.42  Aligned_cols=8  Identities=38%  Similarity=0.995  Sum_probs=3.6

Q ss_pred             cccCCCCC
Q psy4072         125 CVVCGKQL  132 (191)
Q Consensus       125 C~~C~~~l  132 (191)
                      |..|+..+
T Consensus        32 C~~Cg~~~   39 (50)
T PF12773_consen   32 CPNCGAEN   39 (50)
T ss_pred             CcCCcCCC
Confidence            44444443


No 67 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=36.73  E-value=35  Score=17.45  Aligned_cols=12  Identities=25%  Similarity=0.487  Sum_probs=8.1

Q ss_pred             cccccccccccc
Q psy4072           6 LCVGCGGQIHDQ   17 (191)
Q Consensus         6 ~C~~C~~~I~~~   17 (191)
                      .|..|++.+.+.
T Consensus         2 ~C~~C~~~~~~~   13 (30)
T PF03107_consen    2 WCDVCRRKIDGF   13 (30)
T ss_pred             CCCCCCCCcCCC
Confidence            466777777666


No 68 
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=34.53  E-value=12  Score=25.49  Aligned_cols=30  Identities=17%  Similarity=0.263  Sum_probs=17.7

Q ss_pred             cccccccCCCCCCCCCceeeeCCccCCccc
Q psy4072         121 QCFCCVVCGKQLVPGDEFALREDGLFCKDD  150 (191)
Q Consensus       121 ~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~c  150 (191)
                      .=|.|+.|-..--...-....+|.++|..|
T Consensus        69 DEFTCssCFLV~HRSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   69 DEFTCSSCFLVHHRSQLAREKDGQPICRDC   98 (99)
T ss_pred             CceeeeeeeeEechhhhccccCCCEecccc
Confidence            347788775443322223345678899887


No 69 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=34.24  E-value=16  Score=23.84  Aligned_cols=30  Identities=20%  Similarity=0.517  Sum_probs=17.7

Q ss_pred             ccccCCCCCCCCCcee-eeCCc---cCCcccccc
Q psy4072         124 CCVVCGKQLVPGDEFA-LREDG---LFCKDDHEG  153 (191)
Q Consensus       124 ~C~~C~~~l~~~~~~~-~~~~~---~~C~~c~~~  153 (191)
                      .|..|+.||.....+. ..+|.   -||.-||..
T Consensus         2 ~CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    2 FCQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             cCCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            3778888887433122 22333   588888753


No 70 
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=33.78  E-value=12  Score=32.87  Aligned_cols=105  Identities=17%  Similarity=0.269  Sum_probs=0.0

Q ss_pred             ecccchhhcccccceeccccceeeeCCeecchhhhhhhhhh-hhhhcCCCccCCCeEEEecCccccccccccccCCCCCC
Q psy4072          55 TYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRDYVRLFGT-KCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLV  133 (191)
Q Consensus        55 ~yc~~c~~~~~~~~~~~~~c~~~~~~~~~~C~~c~~~~~~~-~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~  133 (191)
                      .||+.|.                    ++-|..|.....-. -|+.|-..+...+  +.+.+..-..+||.|-.|..+|.
T Consensus         6 ~fC~~C~--------------------~irc~~c~~~Ei~~~yCp~CL~~~p~~e--~~~~~nrC~r~Cf~CP~C~~~L~   63 (483)
T PF05502_consen    6 YFCEHCH--------------------KIRCPRCVSEEIDSYYCPNCLFEVPSSE--ARSEKNRCSRNCFDCPICFSPLS   63 (483)
T ss_pred             eeccccc--------------------ccCChhhcccccceeECccccccCChhh--heeccceeccccccCCCCCCcce


Q ss_pred             CCCcee---------eeCCccCCccccccccCCCCCCCC-CCCCCCCCCCccCCCCCC
Q psy4072         134 PGDEFA---------LREDGLFCKDDHEGMDKSSNGENN-NNNTNINNNLHNLNNEGS  181 (191)
Q Consensus       134 ~~~~~~---------~~~~~~~C~~c~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~  181 (191)
                      ....-.         ...+.+|=..|..=++.++..... ..|+++..+.+.+.+...
T Consensus        64 ~~~~~~~~~~~~~~~~~~~~~~~l~C~~C~Wss~~igi~Fdkpt~l~~QL~kl~~~~~  121 (483)
T PF05502_consen   64 VRASDTPPSPPDPSSDSGGKPYYLSCSYCRWSSRDIGIKFDKPTGLRAQLSKLTNGGD  121 (483)
T ss_pred             eEecccccccccccccCCCCCEEEECCCceeeccccCccccCchhHHHHHHhhccccc


No 71 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=33.64  E-value=39  Score=20.00  Aligned_cols=23  Identities=17%  Similarity=0.430  Sum_probs=12.0

Q ss_pred             cccccccccCCC--ceEEeeCCeec
Q psy4072          34 RCAECHQFLDEN--CTCFVRDGKTY   56 (191)
Q Consensus        34 ~C~~C~~~l~~~--~~~~~~~g~~y   56 (191)
                      .|+.|+..|.+.  ..++..||++|
T Consensus         3 ~C~fcG~~I~pg~G~~~vr~Dgkv~   27 (52)
T PRK00807          3 TCSFCGKEIEPGTGKMYVKKDGTIL   27 (52)
T ss_pred             ccCCCCCeEcCCCCeEEEEeCCcEE
Confidence            366777776522  12334455554


No 72 
>PRK12495 hypothetical protein; Provisional
Probab=33.47  E-value=22  Score=27.83  Aligned_cols=25  Identities=24%  Similarity=0.515  Sum_probs=15.7

Q ss_pred             CccccccccccCCCceEEeeCCeecccchhh
Q psy4072          32 CLRCAECHQFLDENCTCFVRDGKTYCKRDYV   62 (191)
Q Consensus        32 Cf~C~~C~~~l~~~~~~~~~~g~~yc~~c~~   62 (191)
                      =+.|..|+.+|.      .+.|..+|..|-.
T Consensus        42 a~hC~~CG~PIp------a~pG~~~Cp~CQ~   66 (226)
T PRK12495         42 NAHCDECGDPIF------RHDGQEFCPTCQQ   66 (226)
T ss_pred             hhhcccccCccc------CCCCeeECCCCCC
Confidence            366788888886      2355555555543


No 73 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=33.14  E-value=14  Score=33.96  Aligned_cols=34  Identities=18%  Similarity=0.457  Sum_probs=23.1

Q ss_pred             CCCcccccccccccceeEeecCCCcccccCcccccccccc
Q psy4072           3 RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFL   42 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l   42 (191)
                      ...+|..|-++|.+.      .++.||=.=-.|+.|+-.+
T Consensus       100 D~a~C~~Cl~Ei~dp------~~rrY~YPF~~CT~CGPRf  133 (750)
T COG0068         100 DAATCEDCLEEIFDP------NSRRYLYPFINCTNCGPRF  133 (750)
T ss_pred             chhhhHHHHHHhcCC------CCcceeccccccCCCCcce
Confidence            456788888777653      3566666666788887654


No 74 
>PF03854 zf-P11:  P-11 zinc finger;  InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The RING-finger is a specialised type of Zn-finger of 40 to 60 residues that binds two atoms of zinc, and is probably involved in mediating protein-protein interactions [, , ]. There are two different variants, the C3HC4-type and a C3H2C3-type, which is clearly related despite the different cysteine/histidine pattern. The latter type is sometimes referred to as 'RING-H2 finger'. The RING domain is a protein interaction domain which has been implicated in a range of diverse biological processes. Several 3D-structures for RING-fingers are known [, ]. The 3D structure of the zinc ligation system is unique to the RING domain and is referred to as the 'cross-brace' motif. The spacing of the cysteines in such a domain is:  C-x(2)-C-x(9 to 39)-C-x(1 to 3)-H-x(2 to 3)-C-x(2)-C-x(4 to 48)-C-x(2)-C  Metal ligand pairs one and three co-ordinate to bind one zinc ion, whilst pairs two and four bind the second. This entry represents RING finger protein Z, a small polypeptide found in some negative-strand RNA viruses including Lassa fever virus, which plays a crucial role in virion assembly and budding. RING finger Z has been shown to interact with several host proteins, including promyelocytic leukemia protein and the eukaryotic translation initiation factor 4E [, ]. It is sufficient in the absence of any other viral proteins to release virus-like particles from the infected cell []. This protein is also responsible for arenavirus superinfection exclusion; expression of this protein in a host cell strongly and specifically inhibits areanavirus transcription and replication []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003723 RNA binding, 0008270 zinc ion binding; PDB: 2KO5_A.
Probab=32.82  E-value=8.6  Score=22.44  Aligned_cols=23  Identities=13%  Similarity=0.428  Sum_probs=10.5

Q ss_pred             ecchhhhhhhhh--hhhhhcCCCcc
Q psy4072          83 TYCKRDYVRLFG--TKCEKCNLNFK  105 (191)
Q Consensus        83 ~~C~~c~~~~~~--~~C~~C~~~I~  105 (191)
                      .+|..|...+.+  +.|..|++++.
T Consensus        22 YLCl~CLt~ml~~s~~C~iC~~~LP   46 (50)
T PF03854_consen   22 YLCLNCLTLMLSRSDRCPICGKPLP   46 (50)
T ss_dssp             EEEHHHHHHT-SSSSEETTTTEE--
T ss_pred             hHHHHHHHHHhccccCCCcccCcCc
Confidence            344444444433  46777766553


No 75 
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=32.69  E-value=24  Score=27.83  Aligned_cols=23  Identities=22%  Similarity=0.580  Sum_probs=13.9

Q ss_pred             ccccccccCCCceEEeeCCeecccchhhcc
Q psy4072          35 CAECHQFLDENCTCFVRDGKTYCKRDYVSS   64 (191)
Q Consensus        35 C~~C~~~l~~~~~~~~~~g~~yc~~c~~~~   64 (191)
                      |..||.+....     .+  -.|.+||...
T Consensus         1 C~~CG~~~~~~-----~~--~lC~~C~~~~   23 (236)
T PF04981_consen    1 CPRCGREIEPL-----ID--GLCPDCYLKR   23 (236)
T ss_pred             CCCCCCCCCCc-----cc--ccChHHhccc
Confidence            67788866554     11  2677777653


No 76 
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=31.85  E-value=18  Score=20.08  Aligned_cols=29  Identities=21%  Similarity=0.575  Sum_probs=16.8

Q ss_pred             hhhhcCCCccCCCeEEEe-cCccccccccc
Q psy4072          96 KCEKCNLNFKREDFVMRA-KNKIYHVQCFC  124 (191)
Q Consensus        96 ~C~~C~~~I~~~~~~~~~-~~~~~H~~Cf~  124 (191)
                      .|+.|...+.+++.++.. =+..||..|+.
T Consensus         2 ~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci~   31 (44)
T PF13639_consen    2 ECPICLEEFEDGEKVVKLPCGHVFHRSCIK   31 (44)
T ss_dssp             CETTTTCBHHTTSCEEEETTSEEEEHHHHH
T ss_pred             CCcCCChhhcCCCeEEEccCCCeeCHHHHH
Confidence            366677767544444332 36777777753


No 77 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=31.04  E-value=22  Score=32.49  Aligned_cols=25  Identities=16%  Similarity=0.505  Sum_probs=12.7

Q ss_pred             CeecchhhhhhhhhhhhhhcCCCcc
Q psy4072          81 GKTYCKRDYVRLFGTKCEKCNLNFK  105 (191)
Q Consensus        81 ~~~~C~~c~~~~~~~~C~~C~~~I~  105 (191)
                      +.-||..|-...-...|..|+..+.
T Consensus        14 ~akFC~~CG~~l~~~~Cp~CG~~~~   38 (645)
T PRK14559         14 NNRFCQKCGTSLTHKPCPQCGTEVP   38 (645)
T ss_pred             CCccccccCCCCCCCcCCCCCCCCC
Confidence            3345555543332245666666554


No 78 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=29.56  E-value=18  Score=18.54  Aligned_cols=11  Identities=36%  Similarity=0.854  Sum_probs=3.6

Q ss_pred             ccccccccccc
Q psy4072           6 LCVGCGGQIHD   16 (191)
Q Consensus         6 ~C~~C~~~I~~   16 (191)
                      .|..|++++.+
T Consensus         2 ~C~~C~~~~~~   12 (30)
T PF07649_consen    2 RCDACGKPIDG   12 (30)
T ss_dssp             --TTTS----S
T ss_pred             cCCcCCCcCCC
Confidence            46777777766


No 79 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=27.95  E-value=21  Score=19.26  Aligned_cols=17  Identities=35%  Similarity=0.825  Sum_probs=9.7

Q ss_pred             CCcccccccccccceeE
Q psy4072           4 LSLCVGCGGQIHDQYIL   20 (191)
Q Consensus         4 ~~~C~~C~~~I~~~~~~   20 (191)
                      .+.|..|++++.+.++.
T Consensus         3 ~~~C~eC~~~f~dSyL~   19 (34)
T PF01286_consen    3 YPKCDECGKPFMDSYLL   19 (34)
T ss_dssp             -EE-TTT--EES-SSCC
T ss_pred             CchHhHhCCHHHHHHHH
Confidence            56788999988888775


No 80 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=27.85  E-value=16  Score=20.43  Aligned_cols=10  Identities=30%  Similarity=1.099  Sum_probs=4.7

Q ss_pred             cccccCCCCC
Q psy4072         123 FCCVVCGKQL  132 (191)
Q Consensus       123 f~C~~C~~~l  132 (191)
                      |+|..|+..+
T Consensus         6 y~C~~Cg~~f   15 (42)
T PF09723_consen    6 YRCEECGHEF   15 (42)
T ss_pred             EEeCCCCCEE
Confidence            3455555444


No 81 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=26.91  E-value=18  Score=27.82  Aligned_cols=28  Identities=18%  Similarity=0.468  Sum_probs=19.3

Q ss_pred             eCCeecchhhhhhhhh--hhhhhcCCCccC
Q psy4072          79 RDGKTYCKRDYVRLFG--TKCEKCNLNFKR  106 (191)
Q Consensus        79 ~~~~~~C~~c~~~~~~--~~C~~C~~~I~~  106 (191)
                      .=|..+|..|+.+.+.  +.|..|++...+
T Consensus       213 ~CGH~FC~~Cai~~y~kg~~C~~Cgk~t~G  242 (259)
T COG5152         213 ECGHSFCSLCAIRKYQKGDECGVCGKATYG  242 (259)
T ss_pred             hcchhHHHHHHHHHhccCCcceecchhhcc
Confidence            3456677777776663  688888886663


No 82 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=26.84  E-value=43  Score=18.97  Aligned_cols=9  Identities=11%  Similarity=0.135  Sum_probs=5.6

Q ss_pred             cCCcccccc
Q psy4072         145 LFCKDDHEG  153 (191)
Q Consensus       145 ~~C~~c~~~  153 (191)
                      -+|..||..
T Consensus        24 dLC~~Cf~~   32 (46)
T cd02249          24 DLCSSCYAK   32 (46)
T ss_pred             cCHHHHHCc
Confidence            467777653


No 83 
>KOG4739|consensus
Probab=25.97  E-value=36  Score=26.90  Aligned_cols=27  Identities=11%  Similarity=0.282  Sum_probs=19.9

Q ss_pred             eCCeecchhhhhhhhhhhhhhcCCCcc
Q psy4072          79 RDGKTYCKRDYVRLFGTKCEKCNLNFK  105 (191)
Q Consensus        79 ~~~~~~C~~c~~~~~~~~C~~C~~~I~  105 (191)
                      .=..++|..|.....++.|.-|++.|.
T Consensus        22 aC~HvfC~~C~k~~~~~~C~lCkk~ir   48 (233)
T KOG4739|consen   22 ACRHVFCEPCLKASSPDVCPLCKKSIR   48 (233)
T ss_pred             echhhhhhhhcccCCccccccccceee
Confidence            335677888877666668999998875


No 84 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=25.92  E-value=6.9  Score=26.40  Aligned_cols=38  Identities=18%  Similarity=0.461  Sum_probs=27.7

Q ss_pred             ccccccccccceeEeecCCCcccccCccccccccccCCC
Q psy4072           7 CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDEN   45 (191)
Q Consensus         7 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~   45 (191)
                      |..|+.++..-..+. ..-..+++.+..|..|++.|+-.
T Consensus        38 Cy~CHdel~~Hpf~p-~~~~~~~~~~iiCGvC~~~LT~~   75 (105)
T COG4357          38 CYHCHDELEDHPFEP-WGLQEFNPKAIICGVCRKLLTRA   75 (105)
T ss_pred             HHHHHhHHhcCCCcc-CChhhcCCccEEhhhhhhhhhHH
Confidence            667777777655543 23467888999999999988765


No 85 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=25.12  E-value=60  Score=19.45  Aligned_cols=15  Identities=33%  Similarity=0.831  Sum_probs=8.9

Q ss_pred             cccccccccccceeE
Q psy4072           6 LCVGCGGQIHDQYIL   20 (191)
Q Consensus         6 ~C~~C~~~I~~~~~~   20 (191)
                      +|..|++||.....+
T Consensus         3 ~CvVCKqpi~~a~~v   17 (54)
T PF10886_consen    3 ICVVCKQPIDDALVV   17 (54)
T ss_pred             eeeeeCCccCcceEE
Confidence            466666666665443


No 86 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=24.24  E-value=45  Score=18.57  Aligned_cols=29  Identities=17%  Similarity=0.394  Sum_probs=13.7

Q ss_pred             ccccCCCCCCCCCceeeeC-CccCCccccc
Q psy4072         124 CCVVCGKQLVPGDEFALRE-DGLFCKDDHE  152 (191)
Q Consensus       124 ~C~~C~~~l~~~~~~~~~~-~~~~C~~c~~  152 (191)
                      +|+.|+++.........-. +...|..|..
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~   32 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDECVE   32 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHHHH
Confidence            4777777776433333323 4455776643


No 87 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=24.16  E-value=33  Score=22.89  Aligned_cols=40  Identities=18%  Similarity=0.292  Sum_probs=26.8

Q ss_pred             CCCcccccccccccceeEeecCCCcccccCccccccccccCCC
Q psy4072           3 RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDEN   45 (191)
Q Consensus         3 ~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~   45 (191)
                      ....|..|++++..-+.+-+.   .|=..=-+|..|+++|+..
T Consensus        32 ~rS~C~~C~~~L~~~~lIPi~---S~l~lrGrCr~C~~~I~~~   71 (92)
T PF06750_consen   32 PRSHCPHCGHPLSWWDLIPIL---SYLLLRGRCRYCGAPIPPR   71 (92)
T ss_pred             CCCcCcCCCCcCcccccchHH---HHHHhCCCCcccCCCCChH
Confidence            346799999999877765322   2322334788899888764


No 88 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=24.04  E-value=36  Score=19.37  Aligned_cols=12  Identities=25%  Similarity=0.498  Sum_probs=7.4

Q ss_pred             ccccccccccCC
Q psy4072          33 LRCAECHQFLDE   44 (191)
Q Consensus        33 f~C~~C~~~l~~   44 (191)
                      +.|..|+..+..
T Consensus         3 Y~C~~Cg~~~~~   14 (44)
T smart00659        3 YICGECGRENEI   14 (44)
T ss_pred             EECCCCCCEeec
Confidence            467777765543


No 89 
>PF10892 DUF2688:  Protein of unknown function (DUF2688);  InterPro: IPR024392 Members of this protein family are annotated as KleB, and may play a role in the regulation of transcription in plasmids.
Probab=23.98  E-value=16  Score=22.07  Aligned_cols=20  Identities=20%  Similarity=0.300  Sum_probs=13.7

Q ss_pred             ecchhhhhhhhhhhhhhcCC
Q psy4072          83 TYCKRDYVRLFGTKCEKCNL  102 (191)
Q Consensus        83 ~~C~~c~~~~~~~~C~~C~~  102 (191)
                      .|=.++....++..|..|-.
T Consensus        27 L~Gad~lr~klG~IC~~Cit   46 (60)
T PF10892_consen   27 LIGADDLRVKLGGICGDCIT   46 (60)
T ss_pred             hhChHHHHHHHcchhhccCC
Confidence            34455667788888888843


No 90 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=23.65  E-value=41  Score=18.97  Aligned_cols=11  Identities=45%  Similarity=1.120  Sum_probs=7.3

Q ss_pred             ccccccccccc
Q psy4072           6 LCVGCGGQIHD   16 (191)
Q Consensus         6 ~C~~C~~~I~~   16 (191)
                      .|.+|+++|.|
T Consensus         2 ~Cd~C~~~i~G   12 (43)
T cd02340           2 ICDGCQGPIVG   12 (43)
T ss_pred             CCCCCCCcCcC
Confidence            47777776655


No 91 
>TIGR00598 rad14 DNA repair protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.49  E-value=27  Score=26.26  Aligned_cols=12  Identities=33%  Similarity=0.628  Sum_probs=9.4

Q ss_pred             CCCCcceeeeeC
Q psy4072         180 GSNSGKIQLYLL  191 (191)
Q Consensus       180 ~~~~~~~~~~~~  191 (191)
                      .++.+.||+||.
T Consensus        68 ~~~~~~MkLYlr   79 (172)
T TIGR00598        68 NPRWGDMKLYLK   79 (172)
T ss_pred             CCCcccceeehH
Confidence            357799999983


No 92 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=23.17  E-value=16  Score=21.82  Aligned_cols=12  Identities=33%  Similarity=0.769  Sum_probs=6.5

Q ss_pred             cccccccccCCC
Q psy4072          34 RCAECHQFLDEN   45 (191)
Q Consensus        34 ~C~~C~~~l~~~   45 (191)
                      +|..|+..|+..
T Consensus        24 ~C~gC~~~l~~~   35 (56)
T PF02591_consen   24 TCSGCHMELPPQ   35 (56)
T ss_pred             ccCCCCEEcCHH
Confidence            455555555544


No 93 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=23.12  E-value=59  Score=18.73  Aligned_cols=31  Identities=19%  Similarity=0.444  Sum_probs=15.4

Q ss_pred             cccCCCCCCCCCceeeeCCccCCccccccccCCC
Q psy4072         125 CVVCGKQLVPGDEFALREDGLFCKDDHEGMDKSS  158 (191)
Q Consensus       125 C~~C~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~  158 (191)
                      |..|+++...   .....+...|..|-.++..+.
T Consensus         2 CiiC~~~~~~---GI~I~~~fIC~~CE~~iv~~~   32 (46)
T PF10764_consen    2 CIICGKEKEE---GIHIYGKFICSDCEKEIVNTE   32 (46)
T ss_pred             eEeCCCcCCC---CEEEECeEehHHHHHHhccCC
Confidence            4555555542   222245566666655554443


No 94 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=22.94  E-value=91  Score=17.44  Aligned_cols=9  Identities=11%  Similarity=0.264  Sum_probs=5.8

Q ss_pred             cCCcccccc
Q psy4072         145 LFCKDDHEG  153 (191)
Q Consensus       145 ~~C~~c~~~  153 (191)
                      -+|..||..
T Consensus        28 dlC~~Cf~~   36 (44)
T smart00291       28 DLCQSCFAK   36 (44)
T ss_pred             cchHHHHhC
Confidence            467777753


No 95 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=22.50  E-value=29  Score=19.35  Aligned_cols=21  Identities=29%  Similarity=0.792  Sum_probs=11.0

Q ss_pred             Ceecchhhhhhhh--hhhhhhcC
Q psy4072          81 GKTYCKRDYVRLF--GTKCEKCN  101 (191)
Q Consensus        81 ~~~~C~~c~~~~~--~~~C~~C~  101 (191)
                      |..+|..|..+..  ...|+.|+
T Consensus        21 gH~~C~~C~~~~~~~~~~CP~C~   43 (44)
T PF14634_consen   21 GHIFCEKCLKKLKGKSVKCPICR   43 (44)
T ss_pred             CCHHHHHHHHhhcCCCCCCcCCC
Confidence            4555666655544  23555554


No 96 
>KOG1829|consensus
Probab=22.45  E-value=23  Score=31.86  Aligned_cols=33  Identities=21%  Similarity=0.354  Sum_probs=24.8

Q ss_pred             cCccccccccccCCC----ceEEeeCCeecccchhhc
Q psy4072          31 ACLRCAECHQFLDEN----CTCFVRDGKTYCKRDYVS   63 (191)
Q Consensus        31 ~Cf~C~~C~~~l~~~----~~~~~~~g~~yc~~c~~~   63 (191)
                      .-|+|+.|+.+|...    ..+-.+.|+.||..|...
T Consensus       339 Q~~~CAgC~~~i~~~~~~~~R~C~y~G~y~C~~Ch~~  375 (580)
T KOG1829|consen  339 QNFRCAGCGHTIGPDLEQRPRLCRYLGKYFCDCCHQN  375 (580)
T ss_pred             cCceecccCCCcccccccchhHhhhhhhhhCchhccc
Confidence            458899999999843    233457899999999864


No 97 
>KOG1813|consensus
Probab=22.23  E-value=37  Score=27.84  Aligned_cols=28  Identities=18%  Similarity=0.484  Sum_probs=17.5

Q ss_pred             eCCeecchhhhhhhhh--hhhhhcCCCccC
Q psy4072          79 RDGKTYCKRDYVRLFG--TKCEKCNLNFKR  106 (191)
Q Consensus        79 ~~~~~~C~~c~~~~~~--~~C~~C~~~I~~  106 (191)
                      .-+..+|+.|..+.+.  ++|..|++.+.+
T Consensus       258 ~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g  287 (313)
T KOG1813|consen  258 KCGHYFCEVCALKPYQKGEKCYVCSQQTHG  287 (313)
T ss_pred             cCCceeehhhhccccccCCcceeccccccc
Confidence            3445566666555443  578888887763


No 98 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=21.87  E-value=32  Score=15.88  Aligned_cols=13  Identities=15%  Similarity=0.618  Sum_probs=8.1

Q ss_pred             ccccccccccCCC
Q psy4072          33 LRCAECHQFLDEN   45 (191)
Q Consensus        33 f~C~~C~~~l~~~   45 (191)
                      |+|..|++.....
T Consensus         1 y~C~~C~~~f~~~   13 (23)
T PF00096_consen    1 YKCPICGKSFSSK   13 (23)
T ss_dssp             EEETTTTEEESSH
T ss_pred             CCCCCCCCccCCH
Confidence            4677777666543


No 99 
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=21.27  E-value=36  Score=19.36  Aligned_cols=11  Identities=27%  Similarity=0.779  Sum_probs=6.1

Q ss_pred             ccccccccCCC
Q psy4072          35 CAECHQFLDEN   45 (191)
Q Consensus        35 C~~C~~~l~~~   45 (191)
                      |..|.+.+...
T Consensus         9 C~~Cdk~~~~~   19 (43)
T PF12855_consen    9 CIVCDKQIDPP   19 (43)
T ss_pred             HHHhhccccCC
Confidence            35566666543


No 100
>PF05181 XPA_C:  XPA protein C-terminus;  InterPro: IPR022656 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry describes the uncharacterised C-terminal in the XPA protein; PDB: 1D4U_A 1XPA_A.
Probab=20.70  E-value=61  Score=19.29  Aligned_cols=11  Identities=45%  Similarity=0.809  Sum_probs=6.6

Q ss_pred             CCCCcceeeee
Q psy4072         180 GSNSGKIQLYL  190 (191)
Q Consensus       180 ~~~~~~~~~~~  190 (191)
                      .++.|.||+||
T Consensus        38 ~~~w~~MkLyL   48 (52)
T PF05181_consen   38 NSTWGDMKLYL   48 (52)
T ss_dssp             SS-TTS-EEE-
T ss_pred             CCCccCeeEEE
Confidence            45789999997


No 101
>KOG3476|consensus
Probab=20.55  E-value=42  Score=22.19  Aligned_cols=27  Identities=19%  Similarity=0.476  Sum_probs=20.5

Q ss_pred             eCCeecchhhhhhhhhhhhhhcCCCccCC
Q psy4072          79 RDGKTYCKRDYVRLFGTKCEKCNLNFKRE  107 (191)
Q Consensus        79 ~~~~~~C~~c~~~~~~~~C~~C~~~I~~~  107 (191)
                      .+|..||..|-.+.  ..|+-|++.|...
T Consensus        66 Q~GshYC~tCAY~K--giCAMCGKki~nT   92 (100)
T KOG3476|consen   66 QPGSHYCQTCAYKK--GICAMCGKKILNT   92 (100)
T ss_pred             CCcchhHhHhhhhh--hHHHHhhhHhhcc
Confidence            56778999995443  3899999999843


No 102
>PRK11595 DNA utilization protein GntX; Provisional
Probab=20.54  E-value=59  Score=25.33  Aligned_cols=11  Identities=27%  Similarity=0.338  Sum_probs=6.6

Q ss_pred             cccccccccCC
Q psy4072          34 RCAECHQFLDE   44 (191)
Q Consensus        34 ~C~~C~~~l~~   44 (191)
                      .|..|++++..
T Consensus         7 ~C~~C~~~~~~   17 (227)
T PRK11595          7 LCWLCRMPLAL   17 (227)
T ss_pred             cCccCCCccCC
Confidence            35667776643


Done!