RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy4072
         (191 letters)



>gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX
          protein family.  The first LIM domain of Isl: Isl is a
          member of LHX protein family, which features two tandem
          N-terminal LIM domains and a C-terminal DNA binding
          homeodomain. Isl1 and Isl2 are the two conserved
          members of this family. Proteins in this group are
          found in the nucleus and act as transcription factors
          or cofactors. LHX proteins are critical for the
          development of specialized cells in multiple tissue
          types, including the nervous system, skeletal muscle,
          the heart, the kidneys, and endocrine organs, such as
          the pituitary gland and the pancreas. Isl-1 is one of
          the LHX proteins isolated originally by virtue of its
          ability to bind DNA sequences from the 5'-flanking
          region of the rat insulin gene in pancreatic
          insulin-producing cells. Mice deficient in Isl-1 fail
          to form the dorsal exocrine pancreas and islet cells
          fail to differentiate. On the other hand, Isl-1 takes
          part in the pituitary development by activating the
          gonadotropin-releasing hormone receptor gene together
          with LHX3 and steroidogenic factor 1. Mouse Is l2 is
          expressed in the retinal ganglion cells and the
          developing spinal cord where it plays a role in motor
          neuron development. Same as Isl1, Isl2 may also be able
          to bind to the insulin gene enhancer to promote gene
          activation. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 55

 Score =  109 bits (275), Expect = 4e-32
 Identities = 50/55 (90%), Positives = 53/55 (96%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          CVGCGG+IHDQYILRVAPDLEWHAACL+CAEC Q+LDE CTCFVRDGKTYCKRDY
Sbjct: 1  CVGCGGKIHDQYILRVAPDLEWHAACLKCAECGQYLDETCTCFVRDGKTYCKRDY 55


>gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX
           protein family.  The second LIM domain of Isl: Isl is a
           member of LHX protein family, which features two tandem
           N-terminal LIM domains and a C-terminal DNA binding
           homeodomain. Isl1 and Isl2 are the two conserved members
           of this family. Proteins in this group are found in the
           nucleus and act as transcription factors or cofactors.
           LHX proteins are critical for the development of
           specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs, such as the pituitary
           gland and the pancreas. Isl-1 is one of the LHX proteins
           isolated originally by virtue of its ability to bind DNA
           sequences from the 5'-flanking region of the rat insulin
           gene in pancreatic insulin-producing cells. Mice
           deficient in Isl-1 fail to form the dorsal exocrine
           pancreas and islet cells fail to differentiate. On the
           other hand, Isl-1 takes part in the pituitary
           development by activating the gonadotropin-releasing
           hormone receptor gene together with LHX3 and
           steroidogenic factor 1. Mouse Isl2 is expressed in the
           retinal ganglion cells and the developing spinal cord
           where it plays a role in motor neuron development. Same
           as Isl1, Isl2 may also be able to bind to the insulin
           gene enhancer to promote gene activation. All LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 55

 Score = 92.1 bits (229), Expect = 3e-25
 Identities = 36/55 (65%), Positives = 44/55 (80%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C KC  +F + DFVMRA+ KIYH++CF C  C +QL+PGDEFALR+DGLFCK DH
Sbjct: 1   CAKCQQSFSKNDFVMRARTKIYHIECFRCSACSRQLIPGDEFALRDDGLFCKADH 55


>gnl|CDD|188855 cd09471, LIM2_Isl2, The second LIM domain of Isl2.  The second LIM
           domain of Isl2: Isl is a member of LHX protein family,
           which features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. LHX proteins are
           critical for the development of specialized cells in
           multiple tissue types, including the nervous system,
           skeletal muscle, the heart, the kidneys, and endocrine
           organs, such as the pituitary gland and the pancreas.
           Isl proteins are found in the nucleus and act as
           transcription factors or cofactors. Isl1 and Isl2 are
           the two conserved members of this family. Mouse Isl2 is
           expressed in the retinal ganglion cells and the
           developing spinal cord where it plays a role in motor
           neuron development. Isl2 may be able to bind to the
           insulin gene enhancer to promote gene activation. All
           LIM domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 55

 Score = 70.0 bits (171), Expect = 1e-16
 Identities = 30/55 (54%), Positives = 39/55 (70%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C +C L F   D VMRA++ +YH++CF C VC +QL+PGDEF LRE  L C+ DH
Sbjct: 1   CAQCRLGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFCLREHELLCRADH 55


>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9
          family.  The first LIM domain of Lhx2 and Lhx9 family:
          Lhx2 and Lhx9 are highly homologous LHX regulatory
          proteins. They belong to the LHX protein family, which
          features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Although Lhx2 and Lhx9 are highly homologous, they
          seems to play regulatory roles in different organs.  In
          animals, Lhx2 plays important roles in eye, cerebral
          cortex, limb, the olfactory organs, and erythrocyte
          development. Lhx2 gene knockout mice exhibit impaired
          patterning of the cortical hem and the telencephalon of
          the developing brain, and a lack of development in
          olfactory structures. Lhx9 is expressed in several
          regions of the developing mouse brain , the spinal
          cord, the pancreas, in limb mesenchyme, and in the
          urogenital region. Lhx9 plays critical roles in gonad
          development.  Homozygous mice lacking functional Lhx9
          alleles exhibit numerous urogenital defects, such as
          gonadal agenesis, infertility, and undetectable levels
          of testosterone and estradiol coupled with high FSH
          levels. Lhx9 null mice are phenotypically female, even
          those that are genotypically male. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 54

 Score = 64.3 bits (157), Expect = 2e-14
 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GCG +I D++ L    D +WHA+CL+C EC   LD   +CF RDG  YCK DY
Sbjct: 1  CAGCGEKIQDRFYLLAV-DRQWHASCLKCCECRLPLDSELSCFSRDGNIYCKEDY 54


>gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH).  The
          first LIM domain of Arrowhead (AWH): Arrowhead belongs
          to the LHX protein family, which features two tandem
          N-terminal LIM domains and a C-terminal DNA binding
          homeodomain. Members of LHX family are found in the
          nucleus and act as transcription factors or cofactors.
          LHX proteins are critical for the development of
          specialized cells in multiple tissue types, including
          the nervous system, skeletal muscle, the heart, the
          kidneys, and endocrine organs, such as the pituitary
          gland and the pancreas. During embryogenesis of
          Drosophila, Arrowhead is expressed in each abdominal
          segment and in the labial segment. Late in embryonic
          development, expression of arrowhead is refined to the
          abdominal histoblasts and salivary gland imaginal ring
          cells themselves. The Arrowhead gene required for
          establishment of a subset of imaginal tissues: the
          abdominal histoblasts and the salivary gland imaginal
          rings. As in other LIM domains, this domain family is
          50-60 amino acids in size and shares two characteristic
          zinc finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 54

 Score = 62.4 bits (152), Expect = 1e-13
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GCG  I D+++L+V+    WH +CLRC  C   L+   +CF RD + YCK DY
Sbjct: 1  CTGCGEPITDRFLLKVS-GRSWHVSCLRCCVCQTPLERQPSCFTRDRQIYCKADY 54



 Score = 24.6 bits (54), Expect = 9.7
 Identities = 12/43 (27%), Positives = 21/43 (48%)

Query: 109 FVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           F+++   + +HV C  C VC   L        R+  ++CK D+
Sbjct: 12  FLLKVSGRSWHVSCLRCCVCQTPLERQPSCFTRDRQIYCKADY 54


>gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2.  The first LIM
          domain of Lhx2: Lhx2 belongs to the LHX protein family,
          which features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          In animals, Lhx2 plays important roles in eye, cerebral
          cortex, limb, the olfactory organs, and erythrocyte
          development. Lhx2 gene knockout mice exhibit impaired
          patterning of the cortical hem and the telencephalon of
          the developing brain, and a lack of development in
          olfactory structures. The Lhx2 protein has been shown
          to bind to the mouse M71 olfactory receptor promoter.
          Similar to other LIM domains, this domain family is
          50-60 amino acids in size and share two characteristic
          zinc finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 64

 Score = 62.3 bits (151), Expect = 1e-13
 Identities = 31/59 (52%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 3  RLSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          R +LC GCGG+I D+Y L +A D +WH  CL+C EC   L+   TCF +DG  YCK DY
Sbjct: 7  RAALCAGCGGKISDRYYL-LAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDY 64


>gnl|CDD|215907 pfam00412, LIM, LIM domain.  This family represents two copies of
          the LIM structural domain.
          Length = 58

 Score = 60.1 bits (146), Expect = 9e-13
 Identities = 25/55 (45%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GCG  I+D+ ++R A    WH  C RCA C + L      F +DGK YCK DY
Sbjct: 1  CAGCGKPIYDRELVRRALGKVWHPECFRCAVCGKPLGPG-DFFEKDGKLYCKHDY 54



 Score = 47.3 bits (113), Expect = 5e-08
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDHE 152
           C  C       + V RA  K++H +CF C VCGK L PGD F  ++  L+CK D+ 
Sbjct: 1   CAGCGKPIYDRELVRRALGKVWHPECFRCAVCGKPLGPGD-FFEKDGKLYCKHDYF 55


>gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9
           family.  The second LIM domain of Lhx2 and Lhx9 family:
           Lhx2 and Lhx9 are highly homologous LHX regulatory
           proteins. They belong to the LHX protein family, which
           features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas.  Although Lhx2 and
           Lhx9 are highly homologous, they seems to play
           regulatory roles in different organs.  In animals, Lhx2
           plays important roles in eye, cerebral cortex, limb, the
           olfactory organs, and erythrocyte development. Lhx2 gene
           knockout mice exhibit impaired patterning of the
           cortical hem and the telencephalon of the developing
           brain, and a lack of development in olfactory
           structures. Lhx9 is expressed in several regions of the
           developing mouse brain, the spinal cord, the pancreas,
           in limb mesenchyme, and in the urogenital region. Lhx9
           plays critical roles in gonad development.  Homozygous
           mice lacking functional Lhx9 alleles exhibit numerous
           urogenital defects, such as gonadal agenesis,
           infertility, and undetectable levels of testosterone and
           estradiol coupled with high FSH levels. Lhx9 null mice
           are phenotypically female, even those that are
           genotypically male. As in other LIM domains, this domain
           family is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 59

 Score = 59.6 bits (145), Expect = 1e-12
 Identities = 19/53 (35%), Positives = 33/53 (62%)

Query: 96  KCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           +C +C+L     + VMRA++ ++H+ CF C  C K L  GD F +R+  ++C+
Sbjct: 4   RCARCHLGISASELVMRARDLVFHLNCFTCATCNKPLTKGDHFGMRDGLVYCR 56



 Score = 30.3 bits (69), Expect = 0.088
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  C   I    ++  A DL +H  C  CA C++ L +     +RDG  YC+  Y
Sbjct: 5  CARCHLGISASELVMRARDLVFHLNCFTCATCNKPLTKGDHFGMRDGLVYCRLHY 59


>gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9.  The first LIM
          domain of Lhx9: Lhx9 belongs to the LHX protein family,
          which features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Lhx9 is highly homologous to Lhx2. It is expressed in
          several regions of the developing mouse brain, the
          spinal cord, the pancreas, in limb mesenchyme, and in
          the urogenital region. Lhx9 plays critical roles in
          gonad development.  Homozygous mice lacking functional
          Lhx9 alleles exhibit numerous urogenital defects, such
          as gonadal agenesis, infertility, and undetectable
          levels of testosterone and estradiol coupled with high
          FSH levels. Lhx9 null mice have reduced levels of the
          Sf1 nuclear receptor that is required for
          gonadogenesis, and recent studies have shown that Lhx9
          is able to activate the Sf1/FtzF1 gene. Lhx9 null mice
          are phenotypically female, even those that are
          genotypically male.  As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 54

 Score = 57.0 bits (137), Expect = 1e-11
 Identities = 29/55 (52%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GCGG+I D+Y L +A D +WH  CL+C EC   L+   TCF +DG  YCK DY
Sbjct: 1  CAGCGGKISDRYYL-LAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDY 54


>gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and
           Lmx1b.  The second LIM domain of Lmx1a and Lmx1b: Lmx1a
           and Lmx1b belong to the LHX protein family, which
           features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs such as the
           pituitary gland and the pancreas. Mouse Lmx1a is
           expressed in multiple tissues, including the roof plate
           of the neural tube, the developing brain, the otic
           vesicles, the notochord, and the pancreas. In mouse,
           mutations in Lmx1a result in failure of the roof plate
           to develop.  Lmx1a may act upstream of other roof plate
           markers such as MafB, Gdf7, Bmp6, and Bmp7. Further
           characterization of these mice reveals numerous defects
           including disorganized cerebellum, hippocampus, and
           cortex; altered pigmentation; female sterility, skeletal
           defects, and behavioral abnormalities.  In the mouse,
           Lmx1b functions in the developing limbs and eyes, the
           kidneys, the brain, and in cranial mesenchyme. The
           disruption of Lmx1b gene results kidney and limb
           defects. In the brain, Lmx1b is important for generation
           of mesencephalic dopamine neurons and the
           differentiation of serotonergic neurons. In the mouse
           eye, Lmx1b regulates anterior segment (cornea, iris,
           ciliary body, trabecular meshwork, and lens)
           development. As in other LIM domains, this domain family
           is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 55

 Score = 56.7 bits (137), Expect = 2e-11
 Identities = 26/55 (47%), Positives = 33/55 (60%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C  C       + VMRA   +YH++CFCC VC +QL  GDEF L+E  L CK D+
Sbjct: 1   CSGCLEKIAPSELVMRALENVYHLRCFCCCVCERQLQKGDEFVLKEGQLLCKSDY 55



 Score = 27.0 bits (60), Expect = 1.4
 Identities = 15/55 (27%), Positives = 26/55 (47%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GC  +I    ++  A +  +H  C  C  C + L +     +++G+  CK DY
Sbjct: 1  CSGCLEKIAPSELVMRALENVYHLRCFCCCVCERQLQKGDEFVLKEGQLLCKSDY 55


>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only
           protein 4).  The second LIM domain of LMO4 (LIM domain
           only protein 4): LMO4 is a nuclear protein that plays
           important roles in transcriptional regulation and
           development. LMO4 is involved in various functions in
           tumorigenesis and cellular differentiation. LMO4
           proteins regulate gene expression by interacting with a
           wide variety of transcription factors and cofactors to
           form large transcription complexes. It can interact with
           Smad proteins, and associate with the promoter of the
           PAI-1 (plasminogen activator inhibitor-1) gene in a
           TGFbeta (transforming growth factor beta)-dependent
           manner. LMO4 can also form a complex with transcription
           regulator CREB (cAMP response element-binding protein)
           and interact with CLIM1 and CLIM2. In breast tissue,
           LMO4 interacts with multiple proteins, including the
           cofactor CtIP [CtBP (C-terminal binding
           protein)-interacting protein], the breast and ovarian
           tumor suppressor BRCA1 (breast-cancer susceptibility
           gene 1) and the LIM-domain-binding protein LDB1.
           Functionally, LMO4 is shown to repress BRCA1-mediated
           transcription activation, thus invoking a potential role
           for LMO4 as a negative regulator of BRCA1 in sporadic
           breast cancer.  LMO4 also forms complex to both ERa
           (oestrogen receptor alpha), MTA1 (metastasis tumor
           antigen 1), and HDACs (histone deacetylases), implying
           that LMO4 is also a component of the MTA1 corepressor
           complex. Over-expressed LMO4 represses ERa
           transactivation functions in an HDAC-dependent manner,
           and contributes to the process of breast cancer
           progression by allowing the development of Era-negative
           phenotypes. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 55

 Score = 55.6 bits (134), Expect = 4e-11
 Identities = 23/55 (41%), Positives = 30/55 (54%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C  C  +    + VMRA+  +YH++CF C  C  QLVPGD F      LFC+ D 
Sbjct: 1   CSACGQSIPASELVMRAQGNVYHLKCFTCSTCHNQLVPGDRFHYVNGSLFCEHDR 55



 Score = 25.5 bits (56), Expect = 4.8
 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 7  CVGCGGQI-HDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRD 60
          C  CG  I   + ++R   ++ +H  C  C+ CH  L         +G  +C+ D
Sbjct: 1  CSACGQSIPASELVMRAQGNV-YHLKCFTCSTCHNQLVPGDRFHYVNGSLFCEHD 54


>gnl|CDD|188765 cd09379, LIM2_AWH, The second LIM domain of Arrowhead (AWH).  The
           second LIM domain of Arrowhead (AWH): Arrowhead belongs
           to the LHX protein family, which features two tandem
           N-terminal LIM domains and a C-terminal DNA binding
           homeodomain. Members of LHX family are found in the
           nucleus and act as transcription factors or cofactors.
           LHX proteins are critical for the development of
           specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs such as the pituitary
           gland and the pancreas. During embryogenesis of
           Drosophila, Arrowhead is expressed in each abdominal
           segment and in the labial segment. Late in embryonic
           development, expression of arrowhead is refined to the
           abdominal histoblasts and salivary gland imaginal ring
           cells themselves. The Arrowhead gene required for
           establishment of a subset of imaginal tissues: the
           abdominal histoblasts and the salivary gland imaginal
           rings. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 55

 Score = 55.1 bits (133), Expect = 7e-11
 Identities = 25/52 (48%), Positives = 34/52 (65%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           C KC+ N    D+V RA++ +YH+ CF C  C +QL  G+EFAL ED + CK
Sbjct: 1   CAKCSRNISASDWVRRARDHVYHLACFACDACKRQLSTGEEFALIEDRVLCK 52



 Score = 27.4 bits (61), Expect = 0.90
 Identities = 15/55 (27%), Positives = 21/55 (38%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  C   I     +R A D  +H AC  C  C + L       + + +  CK  Y
Sbjct: 1  CAKCSRNISASDWVRRARDHVYHLACFACDACKRQLSTGEEFALIEDRVLCKAHY 55


>gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family.
            The second LIM domain of Lhx3-Lhx4 family: Lhx3 and
           Lhx4 belong to the LHX protein family, which features
           two tandem N-terminal LIM domains and a C-terminal DNA
           binding homeodomain. Members of LHX family are found in
           the nucleus and act as transcription factors or
           cofactors. LHX proteins are critical for the development
           of specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs, such as the pituitary
           gland and the pancreas. The LHX3 and LHX4
           LIM-homeodomain transcription factors play essential
           roles in pituitary gland and nervous system development.
           Although LHX3 and LHX4 share marked sequence homology,
           the genes have different expression patterns. They play
           overlapping, but distinct functions during the
           establishment of the specialized cells of the mammalian
           pituitary gland and the nervous system. Lhx3 proteins
           have been demonstrated the ability to directly bind to
           the promoters/enhancers of several pituitary hormone
           gene promoters to cause increased transcription.Lhx3a
           and Lhx3b, whose mRNAs have distinct temporal expression
           profiles during development, are two isoforms of Lhx3.
           LHX4 plays essential roles in pituitary gland and
           nervous system development. In mice, the lhx4 gene is
           expressed in the developing hindbrain, cerebral cortex,
           pituitary gland, and spinal cord. LHX4 shows significant
           sequence similarity to LHX3, particularly to isoforms
           Lhx3a. In gene regulation experiments, the LHX4 protein
           exhibits regulation roles towards pituitary genes,
           acting on their promoters/enhancers. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 56

 Score = 54.7 bits (132), Expect = 8e-11
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDG-LFCKDDH 151
           C  C+        V RA++ +YH++CF C +C +QL  GDEF L ED  L CK D+
Sbjct: 1   CAGCDEGIPPTQVVRRAQDNVYHLECFACFMCKRQLETGDEFYLMEDDRLVCKKDY 56



 Score = 29.6 bits (67), Expect = 0.14
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCF-VRDGKTYCKRDY 61
          C GC   I    ++R A D  +H  C  C  C + L+     + + D +  CK+DY
Sbjct: 1  CAGCDEGIPPTQVVRRAQDNVYHLECFACFMCKRQLETGDEFYLMEDDRLVCKKDY 56


>gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known
           as Lim1) and Lhx5.  The second LIM domain of Lhx1 (also
           known as Lim1) and Lhx5. Lhx1 and Lhx5 are closely
           related members of LHX protein family, which features
           two tandem N-terminal LIM domains and a C-terminal DNA
           binding homeodomain. Members of LHX family are found in
           the nucleus and act as transcription factors or
           cofactors. LHX proteins are critical for the development
           of specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs, such as the pituitary
           gland and the pancreas. Lhx1 is required for regulating
           the vertebrate head organizer, the nervous system, and
           female reproductive tract development. During
           embryogenesis in the mouse, Lhx1 is expressed early in
           mesodermal tissue, then later during urogenital, kidney,
           liver, and nervous system development. In the adult,
           expression is restricted to the kidney and brain. A
           mouse embryos with Lhx1 gene knockout cannot grow normal
           anterior head structures, kidneys, and gonads, but with
           normally developed trunk and tail morphology. In the
           developing nervous system, Lhx1 is required to direct
           the trajectories of motor axons in the limb. Lhx1 null
           female mice lack the oviducts and uterus.  Lhx5 protein
           may play complementary or overlapping roles with Lhx1.
           The expression of Lhx5 in the anterior portion of the
           mouse neural tube suggests a role in patterning of the
           forebrain. All LIM domains are 50-60 amino acids in size
           and share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 56

 Score = 54.3 bits (131), Expect = 1e-10
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLF-CKDDH 151
           C  C+      D V RA++K++H+ CF C+VC KQL  G+E  + ++  F CK+D+
Sbjct: 1   CAGCDQGISPNDLVRRARDKVFHLNCFTCMVCRKQLSTGEELYILDENKFICKEDY 56



 Score = 28.5 bits (64), Expect = 0.37
 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 1/56 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTY-CKRDY 61
          C GC   I    ++R A D  +H  C  C  C + L      ++ D   + CK DY
Sbjct: 1  CAGCDQGISPNDLVRRARDKVFHLNCFTCMVCRKQLSTGEELYILDENKFICKEDY 56


>gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b.  The first
          LIM domain of Lmx1b: Lmx1b belongs to the LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          In mouse, Lmx1b functions in the developing limbs and
          eyes, the kidneys, the brain, and in cranial
          mesenchyme. The disruption of Lmx1b gene results kidney
          and limb defects. In the brain, Lmx1b is important for
          generation of mesencephalic dopamine neurons and the
          differentiation of serotonergic neurons. In the mouse
          eye, Lmx1b regulates anterior segment (cornea, iris,
          ciliary body, trabecular meshwork, and lens)
          development. As in other LIM domains, this domain
          family is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 53

 Score = 53.9 bits (130), Expect = 2e-10
 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GC   I D+Y+LRV  +  WH  CL+C+ C Q L    +C+ RD K YCK+DY
Sbjct: 1  CAGCQRPISDRYLLRVN-ERSWHEECLQCSVCQQPLTT--SCYFRDRKLYCKQDY 52


>gnl|CDD|188856 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3b.  The second
           LIM domain of Lhx3b. Lhx3b is a member of LHX protein
           family, which features two tandem N-terminal LIM domains
           and a C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas. Lhx3b is one of
           the two isoforms of Lhx3. The Lhx3 gene is expressed in
           the ventral spinal cord, the pons, the medulla
           oblongata, and the pineal gland of the developing
           nervous system during mouse embryogenesis, and
           transcripts are found in the emergent pituitary gland.
           Lhx3 functions in concert with other transcription
           factors to specify interneuron and motor neuron fates
           during development. Lhx3 proteins have been demonstrated
           to directly bind to the promoters of several pituitary
           hormone gene promoters. The Lhx3 gene encodes two
           isoforms, LHX3a and LHX3b that differ in their
           amino-terminal sequences, where Lhx3a has longer
           N-terminal.  They show differential activation of
           pituitary hormone genes and distinct DNA binding
           properties. In human, Lhx3a trans-activated the
           alpha-glycoprotein subunit promoter and genes containing
           a high-affinity Lhx3 binding site more effectively than
           the hLhx3b isoform. In addition, hLhx3a induce
           transcription of the TSHbeta-subunit gene by acting on
           pituitary POU domain factor, Pit-1, while hLhx3b does
           not.  As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 57

 Score = 53.5 bits (128), Expect = 2e-10
 Identities = 26/57 (45%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 96  KCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDG-LFCKDDH 151
           KC  C         V RA++ +YH+ CF C+VC +QL  GDEF L ED  L CK D+
Sbjct: 1   KCAACQQGIPPTQVVRRAQDFVYHLHCFACIVCKRQLATGDEFYLMEDSRLVCKADY 57


>gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9.  The second LIM
           domain of Lhx9: Lhx9 belongs to the LHX protein family,
           which features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas. Lhx9 is highly
           homologous to Lhx2. It is expressed in several regions
           of the developing mouse brain, the spinal cord, the
           pancreas, in limb mesenchyme, and in the urogenital
           region. Lhx9 plays critical roles in gonad development. 
           Homozygous mice lacking functional Lhx9 alleles exhibit
           numerous urogenital defects, such as gonadal agenesis,
           infertility, and undetectable levels of testosterone and
           estradiol coupled with high FSH levels. Lhx9 null mice
           have reduced levels of the Sf1 nuclear receptor that is
           required for gonadogenesis, and recent studies have
           shown that Lhx9 is able to activate the Sf1/FtzF1 gene.
           Lhx9 null mice are phenotypically female, even those
           that are genotypically male.  As in other LIM domains,
           this domain family is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 59

 Score = 52.4 bits (125), Expect = 7e-10
 Identities = 19/53 (35%), Positives = 33/53 (62%)

Query: 96  KCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           +C +C+L     + VMRA+  +YH+ CF C  C K L  GD F ++++ ++C+
Sbjct: 4   RCARCHLGISASEMVMRARESVYHLSCFTCTTCNKTLTTGDHFGMKDNLVYCR 56


>gnl|CDD|188756 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a.  The first
          LIM domain of Lmx1a: Lmx1a belongs to the LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Mouse Lmx1a is expressed in multiple tissues, including
          the roof plate of the neural tube, the developing
          brain, the otic vesicles, the notochord, and the
          pancreas. Human Lmx1a can be found in pancreas,
          skeletal muscle, adipose tissue, developing brain,
          mammary glands, and pituitary.  The functions of Lmx1a
          in the developing nervous system were revealed by
          studies of mutant mouse. In mouse, mutations in Lmx1a
          result in failure of the roof plate to develop.  Lmx1a
          may act upstream of other roof plate markers such as
          MafB, Gdf7, Bmp 6, and Bmp7. Further characterization
          of these mice reveals numerous defects including
          disorganized cerebellum, hippocampus, and cortex;
          altered pigmentation; female sterility; skeletal
          defects; and behavioral abnormalities. Within
          pancreatic cells, the Lmx1a protein interacts
          synergistically with the bHLH transcription factor E47
          to activate the insulin gene enhancer/promoter. As in
          other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 52

 Score = 50.9 bits (122), Expect = 2e-09
 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GC   I D+++LRV   L WH  CL+CA C + L+   TCF RD K YCK DY
Sbjct: 1  CEGCNRVIQDRFLLRVNDSL-WHERCLQCASCKEPLET--TCFYRDKKLYCKEDY 52


>gnl|CDD|188857 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4.  The second LIM
           domain of Lhx4. Lhx4 belongs to the LHX protein family,
           which features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas. LHX4 plays
           essential roles in pituitary gland and nervous system
           development. In mice, the lhx4 gene is expressed in the
           developing hindbrain, cerebral cortex, pituitary gland,
           and spinal cord. LHX4 shows significant sequence
           similarity to LHX3, particularly to isoforms Lhx3a. In
           gene regulation experiments, the LHX4 protein exhibits
           regulation roles towards pituitary genes, acting on
           their promoters/enhancers. As in other LIM domains, this
           domain family is 50-60 amino acids in size and shares
           two characteristic zinc finger motifs. The two zinc
           fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 56

 Score = 51.2 bits (122), Expect = 2e-09
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDG-LFCKDDH 151
           C  C         V +A++ +YH+ CF C++C +QL  GDEF L EDG L CK+D+
Sbjct: 1   CTACQQGIPPTQVVRKAQDFVYHLHCFACIICSRQLATGDEFYLMEDGRLVCKEDY 56



 Score = 28.8 bits (64), Expect = 0.28
 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 1/56 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFV-RDGKTYCKRDY 61
          C  C   I    ++R A D  +H  C  C  C + L      ++  DG+  CK DY
Sbjct: 1  CTACQQGIPPTQVVRKAQDFVYHLHCFACIICSRQLATGDEFYLMEDGRLVCKEDY 56


>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1,
           Mec-3.  Zinc-binding domain family. Some LIM domains
           bind protein partners via tyrosine-containing motifs.
           LIM domains are found in many key regulators of
           developmental pathways.
          Length = 54

 Score = 50.5 bits (121), Expect = 4e-09
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 96  KCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDD 150
           KC  C       + V+RA  K++H +CF C  CGK L  GD F  ++  L+CKD 
Sbjct: 1   KCAGCGKPIYGTERVLRALGKVWHPECFKCATCGKPLS-GDTFFEKDGKLYCKDC 54



 Score = 48.9 bits (117), Expect = 1e-08
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRD 60
          C GCG  I+    +  A    WH  C +CA C + L  + T F +DGK YCK  
Sbjct: 2  CAGCGKPIYGTERVLRALGKVWHPECFKCATCGKPLSGD-TFFEKDGKLYCKDC 54



 Score = 24.7 bits (54), Expect = 8.4
 Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 1/55 (1%)

Query: 34 RCAECHQFLDENCTCFVRDGKTYCKRDYVSSEKNQFLDENCTCFVRDGKTYCKRD 88
          +CA C + +          GK +    +  +   + L  + T F +DGK YCK  
Sbjct: 1  KCAGCGKPIYGTERVLRALGKVWHPECFKCATCGKPLSGD-TFFEKDGKLYCKDC 54


>gnl|CDD|188858 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2.  The second LIM
           domain of Lhx2: Lhx2 belongs to the LHX protein family,
           which features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas.  In animals, Lhx2
           plays important roles in eye, cerebral cortex, limb, the
           olfactory organs, and erythrocyte development. Lhx2 gene
           knockout mice exhibit impaired patterning of the
           cortical hem and the telencephalon of the developing
           brain, and a lack of development in olfactory
           structures. The Lhx2 protein has been shown to bind to
           the mouse M71 olfactory receptor promoter. Similar to
           other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 59

 Score = 50.5 bits (120), Expect = 4e-09
 Identities = 19/53 (35%), Positives = 34/53 (64%)

Query: 96  KCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           +C +C+L     + VMRA++ +YH+ CF C  C K L  GD F ++++ ++C+
Sbjct: 4   RCARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDNLVYCR 56



 Score = 25.4 bits (55), Expect = 5.7
 Identities = 14/52 (26%), Positives = 22/52 (42%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCK 58
          C  C   I    ++  A DL +H  C  C  C++ L       ++D   YC+
Sbjct: 5  CARCHLGISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDNLVYCR 56


>gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a.  The first
          LIM domain of Lhx3a: Lhx3a is a member of LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Lhx3a is one of the two isoforms of Lhx3. The Lhx3 gene
          is expressed in the ventral spinal cord, the pons, the
          medulla oblongata, and the pineal gland of the
          developing nervous system during mouse embryogenesis,
          and transcripts are found in the emergent pituitary
          gland. Lhx3 functions in concert with other
          transcription factors to specify interneuron and motor
          neuron fates during development. Lhx3 proteins have
          been demonstrated to directly bind to the promoters of
          several pituitary hormone gene promoters. The Lhx3 gene
          encodes two isoforms, LHX3a and LHX3b that differ in
          their amino-terminal sequences, where Lhx3a has longer
          N-terminal.  They show differential activation of
          pituitary hormone genes and distinct DNA binding
          properties. In human, Lhx3a trans-activated the
          alpha-glycoprotein subunit promoter and genes
          containing a high-affinity Lhx3 binding site more
          effectively than the hLhx3b isoform. In addition,
          hLhx3a induce transcription of the TSHbeta-subunit gene
          by acting on pituitary POU domain factor, Pit-1, while
          hLhx3b does not. As in other LIM domains, this domain
          family is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 56

 Score = 50.2 bits (120), Expect = 5e-09
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 4  LSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          +  C GC   I D++IL+V  D  WH+ CL+C +C   L +   CF R G+ YCK D+
Sbjct: 1  IPKCAGCDHPIFDRFILKVQ-DKPWHSKCLKCVDCQAQLTDK--CFSRGGQVYCKEDF 55



 Score = 30.9 bits (70), Expect = 0.052
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 109 FVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDD 150
           F+++ ++K +H +C  CV C  QL   D+   R   ++CK+D
Sbjct: 15  FILKVQDKPWHSKCLKCVDCQAQLT--DKCFSRGGQVYCKED 54


>gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4.  The first LIM
          domain of Lhx4. Lhx4 belongs to the LHX protein family,
          which features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          LHX4 plays essential roles in pituitary gland and
          nervous system development. In mice, the lhx4 gene is
          expressed in the developing hindbrain, cerebral cortex,
          pituitary gland, and spinal cord. LHX4 shows
          significant sequence similarity to LHX3, particularly
          to isoforms Lhx3a. In gene regulation experiments, the
          LHX4 protein exhibits regulation roles towards
          pituitary genes, acting on their promoters/enhancers.
          As in other LIM domains, this domain family is 50-60
          amino acids in size and shares two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 52

 Score = 50.0 bits (119), Expect = 6e-09
 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GC   I D++IL+V  D  WH++CL+CA+C   L E   CF R G  YCK D+
Sbjct: 1  CAGCNQHILDKFILKVL-DRHWHSSCLKCADCQMQLAER--CFSRAGNVYCKEDF 52


>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain,
          containing two zinc fingers.  LIM domains are
          identified in a diverse group of proteins with wide
          variety of biological functions, including gene
          expression regulation, cell fate determination,
          cytoskeleton organization, tumor formation and
          development. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes. They perform their functions through
          interactions with other protein partners. LIM domains
          are 50-60 amino acids in size and share two
          characteristic highly conserved zinc finger motifs. The
          two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. The consensus sequence of LIM
          domain has been defined as
          C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,
          21)-C-x(2,3)-[CHD] (where X denotes any amino acid).
          Length = 53

 Score = 49.2 bits (118), Expect = 8e-09
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GCG  I  + +LR A   +WH  C +C+ C + L  + + + +DGK YC++ Y
Sbjct: 1  CAGCGKPIEGRELLR-ALGKKWHPECFKCSVCGKPLGGD-SFYEKDGKPYCEKCY 53



 Score = 46.9 bits (112), Expect = 6e-08
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C  C         ++RA  K +H +CF C VCGK L  GD F  ++   +C+  +
Sbjct: 1   CAGCGKPI-EGRELLRALGKKWHPECFKCSVCGKPLG-GDSFYEKDGKPYCEKCY 53


>gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4
          family.  The first LIM domain of Lhx3-Lhx4 family: Lhx3
          and Lhx4 belong to the LHX protein family, which
          features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          The LHX3 and LHX4 LIM-homeodomain transcription factors
          play essential roles in pituitary gland and nervous
          system development. Although LHX3 and LHX4 share marked
          sequence homology, the genes have different expression
          patterns. They play overlapping, but distinct functions
          during the establishment of the specialized cells of
          the mammalian pituitary gland and the nervous system.
          Lhx3 proteins have been demonstrated the ability to
          directly bind to the promoters/enhancers of several
          pituitary hormone gene promoters to cause increased
          transcription. Lhx3a and Lhx3b, whose mRNAs have
          distinct temporal expression profiles during
          development, are two isoforms of Lhx3. LHX4 plays
          essential roles in pituitary gland and nervous system
          development. In mice, the lhx4 gene is expressed in the
          developing hindbrain, cerebral cortex, pituitary gland,
          and spinal cord. LHX4 shows significant sequence
          similarity to LHX3, particularly to isoforms Lhx3a. In
          gene regulation experiments, the LHX4 protein exhibits
          regulation roles towards pituitary genes, acting on
          their promoters/enhancers. As in other LIM domains,
          this domain family is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 52

 Score = 49.0 bits (117), Expect = 1e-08
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GC   I D++IL+V  D  WHA CL+C +C   L +   CF R+G  YCK D+
Sbjct: 1  CGGCQEHILDRFILKVL-DRTWHAKCLKCNDCGAQLTDK--CFARNGHVYCKDDF 52



 Score = 26.6 bits (59), Expect = 1.5
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 109 FVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDD 150
           F+++  ++ +H +C  C  CG QL   D+   R   ++CKDD
Sbjct: 12  FILKVLDRTWHAKCLKCNDCGAQLT--DKCFARNGHVYCKDD 51


>gnl|CDD|188769 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of Lhx7 and Lhx8.
           The second LIM domain of Lhx7 and Lhx8:  Lhx7 and Lhx8
           belong to the LHX protein family, which features two
           tandem N-terminal LIM domains and a C-terminal DNA
           binding homeodomain. Members of LHX family are found in
           the nucleus and act as transcription factors or
           cofactors. LHX proteins are critical for the development
           of specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs such as the pituitary
           gland and the pancreas.  Studies using mutant mice have
           revealed roles for Lhx7 and Lhx8 in the development of
           cholinergic neurons in the telencephalon and in basal
           forebrain development. Mice lacking alleles of the
           LIM-homeobox gene Lhx7 or Lhx8 display dramatically
           reduced number of forebrain cholinergic neurons. In
           addition, Lhx7 mutation affects male and female mice
           differently, with females appearing more affected than
           males. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 55

 Score = 48.9 bits (116), Expect = 1e-08
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           C +C  +    D+V RAK  +YH+ CF C  C +QL  G+EFAL E+ + C+
Sbjct: 1   CSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKVLCR 52



 Score = 25.8 bits (56), Expect = 3.8
 Identities = 16/55 (29%), Positives = 22/55 (40%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  CG  IH    +R A    +H AC  C  C + L       + + K  C+  Y
Sbjct: 1  CSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKVLCRVHY 55


>gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8.
          The first LIM domain of Lhx7 and Lhx8:  Lhx7 and Lhx8
          belong to the LHX protein family, which features two
          tandem N-terminal LIM domains and a C-terminal DNA
          binding homeodomain. Members of LHX family are found in
          the nucleus and act as transcription factors or
          cofactors. LHX proteins are critical for the
          development of specialized cells in multiple tissue
          types, including the nervous system, skeletal muscle,
          the heart, the kidneys, and endocrine organs such as
          the pituitary gland and the pancreas.  Studies using
          mutant mice have revealed roles for Lhx7 and Lhx8 in
          the development of cholinergic neurons in the
          telencephalon and in basal forebrain development. Mice
          lacking alleles of the LIM-homeobox gene Lhx7 or Lhx8
          display dramatically reduced number of forebrain
          cholinergic neurons. In addition, Lhx7 mutation affects
          male and female mice differently, with females
          appearing more affected than males. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 56

 Score = 48.4 bits (115), Expect = 2e-08
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 6  LCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          +C  CG +I D+Y+L+V  DL WH  CL C+ C   L  + +C+++D   +CK DY
Sbjct: 1  VCSSCGLEIVDKYLLKVN-DLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFCKLDY 55



 Score = 25.3 bits (55), Expect = 6.1
 Identities = 11/45 (24%), Positives = 24/45 (53%)

Query: 107 EDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           + ++++  +  +HV+C  C VC   L       +++  +FCK D+
Sbjct: 11  DKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFCKLDY 55


>gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known
          as Lim1) and Lhx5.  The first LIM domain of Lhx1 (also
          known as Lim1) and Lhx5. Lhx1 and Lhx5 are closely
          related members of LHX protein family, which features
          two tandem N-terminal LIM domains and a C-terminal DNA
          binding homeodomain. Members of LHX family are found in
          the nucleus and act as transcription factors or
          cofactors. LHX proteins are critical for the
          development of specialized cells in multiple tissue
          types, including the nervous system, skeletal muscle,
          the heart, the kidneys, and endocrine organs, such as
          the pituitary gland and the pancreas. Lhx1 is required
          for regulating the vertebrate head organizer, the
          nervous system, and female reproductive tract
          development. During embryogenesis in the mouse, Lhx1 is
          expressed early in mesodermal tissue, then later during
          urogenital, kidney, liver, and nervous system
          development. In the adult, expression is restricted to
          the kidney and brain. A mouse embryos with Lhx1 gene
          knockout cannot grow normal anterior head structures,
          kidneys, and gonads, but with normally developed trunk
          and tail morphology. In the developing nervous system,
          Lhx1 is required to direct the trajectories of motor
          axons in the limb. Lhx1 null female mice lack the
          oviducts and uterus.  Lhx5 protein may play
          complementary or overlapping roles with Lhx1. The
          expression of Lhx5 in the anterior portion of the mouse
          neural tube suggests a role in patterning of the
          forebrain. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 52

 Score = 47.8 bits (114), Expect = 3e-08
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GC   I D+++L V  D  WHA C++C +C   L E   CF R+GK YC+ D+
Sbjct: 1  CAGCDRPILDKFLLNVL-DRAWHAKCVQCCDCKCPLTEK--CFSREGKLYCRNDF 52


>gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only
          protein 4).  The first LIM domain of LMO4 (LIM domain
          only protein 4): LMO4 is a nuclear protein that plays
          important roles in transcriptional regulation and
          development. LMO4 is involved in various functions in
          tumorigenesis and cellular differentiation. LMO4
          proteins regulate gene expression by interacting with a
          wide variety of transcription factors and cofactors to
          form large transcription complexes. It can interact
          with Smad proteins, and associate with the promoter of
          the PAI-1 (plasminogen activator inhibitor-1) gene in a
          TGFbeta (transforming growth factor beta)-dependent
          manner. LMO4 can also form a complex with transcription
          regulator CREB (cAMP response element-binding protein)
          and interact with CLIM1 and CLIM2. In breast tissue,
          LMO4 interacts with multiple proteins, including the
          cofactor CtIP [CtBP (C-terminal binding
          protein)-interacting protein], the breast and ovarian
          tumor suppressor BRCA1 (breast-cancer susceptibility
          gene 1) and the LIM-domain-binding protein LDB1.
          Functionally, LMO4 is shown to repress BRCA1-mediated
          transcription activation, thus invoking a potential
          role for LMO4 as a negative regulator of BRCA1 in
          sporadic breast cancer.  LMO4 also forms complex to
          both ERa (oestrogen receptor alpha), MTA1 (metastasis
          tumor antigen 1), and HDACs (histone deacetylases),
          implying that LMO4 is also a component of the MTA1
          corepressor complex. Over-expressed LMO4 represses ERa
          transactivation functions in an HDAC-dependent manner,
          and contributes to the process of breast cancer
          progression by allowing the development of Era-negative
          phenotypes. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 55

 Score = 46.3 bits (110), Expect = 1e-07
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDE-NCTCFVRDGKTYCKRDY 61
          C GCGG+I D+++L  A D  WH  CL+C+ C   L E   +C+ + G   CK DY
Sbjct: 1  CAGCGGKIVDRFLL-HALDRYWHNGCLKCSCCQAQLGEIGSSCYTKGGMILCKNDY 55


>gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b.  The first
          LIM domain of Lhx3b. Lhx3b is a member of LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Lhx3b is one of the two isoforms of Lhx3. The Lhx3 gene
          is expressed in the ventral spinal cord, the pons, the
          medulla oblongata, and the pineal gland of the
          developing nervous system during mouse embryogenesis,
          and transcripts are found in the emergent pituitary
          gland. Lhx3 functions in concert with other
          transcription factors to specify interneuron and motor
          neuron fates during development. Lhx3 proteins have
          been demonstrated to directly bind to the promoters of
          several pituitary hormone gene promoters. The Lhx3 gene
          encodes two isoforms, LHX3a and LHX3b that differ in
          their amino-terminal sequences, where Lhx3a has longer
          N-terminal.  They show differential activation of
          pituitary hormone genes and distinct DNA binding
          properties. In human, Lhx3a trans-activated the
          alpha-glycoprotein subunit promoter and genes
          containing a high-affinity Lhx3 binding site more
          effectively than the hLhx3b isoform. In addition,
          hLhx3a induce transcription of the TSHbeta-subunit gene
          by acting on pituitary POU domain factor, Pit-1, while
          hLhx3b does not. As in other LIM domains, this domain
          family is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 55

 Score = 45.7 bits (108), Expect = 2e-07
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 4  LSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          + LC GC   I D++IL+V  D  WH+ CL+C++C   L E   CF R    YCK D+
Sbjct: 1  IPLCAGCNQHIVDRFILKVL-DRHWHSKCLKCSDCQTQLAEK--CFSRGDSVYCKDDF 55



 Score = 26.4 bits (58), Expect = 2.2
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDD 150
           C  CN +   + F+++  ++ +H +C  C  C  QL   ++   R D ++CKDD
Sbjct: 4   CAGCNQHIV-DRFILKVLDRHWHSKCLKCSDCQTQL--AEKCFSRGDSVYCKDD 54


>gnl|CDD|188766 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6.  The first LIM
          domain of Lhx6. Lhx6 is a member of LHX protein family,
          which features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs such as the pituitary gland and the pancreas.
          Lhx6 functions in the brain and nervous system.  It is
          expressed at high levels in several regions of the
          embryonic mouse CNS, including the telencephalon and
          hypothalamus, and the first branchial arch. Lhx6 is
          proposed to have a role in patterning of the mandible
          and maxilla, and in signaling during odontogenesis. In
          brain sections, knockdown of Lhx6 gene blocks the
          normal migration of neurons to the cortex. As in other
          LIM domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 54

 Score = 45.4 bits (107), Expect = 3e-07
 Identities = 21/55 (38%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  CG +I D+Y+L+V  +L WH  CL C+ C   L ++ +C++++ + +CK DY
Sbjct: 1  CSSCGLEILDRYLLKVN-NLIWHVRCLECSVCRTSLRQHNSCYIKNKEIFCKMDY 54



 Score = 26.9 bits (59), Expect = 1.3
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C  C L    + ++++  N I+HV+C  C VC   L   +   ++   +FCK D+
Sbjct: 1   CSSCGLEIL-DRYLLKVNNLIWHVRCLECSVCRTSLRQHNSCYIKNKEIFCKMDY 54


>gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6.  The second LIM
           domain of Lhx6. Lhx6 is a member of LHX protein family,
           which features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs such as the
           pituitary gland and the pancreas. Lhx6 functions in
           brain and nervous system.  It is expressed at high
           levels in several regions of the embryonic mouse CNS,
           including the telencephalon and hypothalamus, and the
           first branchial arch. Lhx6 is proposed to have a role in
           patterning of the mandible and maxilla, and in signaling
           during odontogenesis. In brain sections, knockdown of
           Lhx6 gene blocks the normal migration of neurons to the
           cortex. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 55

 Score = 45.1 bits (106), Expect = 4e-07
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           C +C       D+V RA+   YH+ CF C  C +QL  G+EF L E+ + C+
Sbjct: 1   CARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCR 52



 Score = 25.0 bits (54), Expect = 5.9
 Identities = 16/55 (29%), Positives = 23/55 (41%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  CG QI+    +R A    +H AC  C  C + L       + + K  C+  Y
Sbjct: 1  CARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHY 55


>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain
          Kinase ).  The first LIM domain of LIMK (LIM domain
          Kinase ): LIMK protein family is  comprised of two
          members LIMK1 and LIMK2. LIMK contains two LIM domains,
          a PDZ domain and a kinase domain. LIMK is involved in
          the regulation of actin polymerization and microtubule
          disassembly. LIMK influences architecture of the actin
          cytoskeleton by regulating the activity of the cofilin
          family proteins cofilin1, cofilin2, and destrin. The
          mechanism of the activation is to phosphorylates
          cofilin on serine 3 and inactivates its actin-severing
          activity, and altering the rate of actin
          depolymerisation. LIMKs can function in both cytoplasm
          and nucleus and are expressed in all tissues. Both
          LIMK1 and LIMK2 can act in the nucleus to suppress
          Rac/Cdc42-dependent cyclin D1 expression. However,
          LIMK1 and LIMk2 have different cellular locations.
          While LIMK1 localizes mainly at focal adhesions, LIMK2
          is found in cytoplasmic punctae, suggesting that they
          may have different cellular functions. The LIM domains
          of LIMK have been shown to play an important role in
          regulating kinase activity and likely also contribute
          to LIMK function by acting as sites of
          protein-to-protein interactions. All LIM domains are
          50-60 amino acids in size and share two characteristic
          zinc finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 53

 Score = 43.6 bits (103), Expect = 1e-06
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GC G+I D   ++ A + +WH  C RC+ C   L      F +DGK YC++DY
Sbjct: 1  CAGCRGKILDSQYVQ-ALNQDWHCDCFRCSVCSDSLSN--WYFEKDGKLYCRKDY 52



 Score = 24.8 bits (54), Expect = 8.9
 Identities = 12/45 (26%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 107 EDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           +   ++A N+ +H  CF C VC   L   + +  ++  L+C+ D+
Sbjct: 10  DSQYVQALNQDWHCDCFRCSVCSDSL--SNWYFEKDGKLYCRKDY 52


>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain
          Kinase 1).  The first LIM domain of LIMK1 (LIM domain
          Kinase 1): LIMK1 belongs to the LIMK protein family,
          which comprises LIMK1 and LIMK2. LIMK contains two LIM
          domains, a PDZ domain, and a kinase domain. LIMK is
          involved in the regulation of actin polymerization and
          microtubule disassembly. LIMK influences architecture
          of the actin cytoskeleton by regulating the activity of
          the cofilin family proteins cofilin1, cofilin2, and
          destrin. The mechanism of the activation is to
          phosphorylates cofilin on serine 3 and inactivates its
          actin-severing activity, and altering the rate of actin
          depolymerization. LIMKs can function in both cytoplasm
          and nucleus. Both LIMK1 and LIMK2 can act in the
          nucleus to suppress Rac/Cdc42-dependent cyclin D1
          expression. LIMK1 is expressed in all tissues and is
          localized to focal adhesions in the cell. LIMK1 can
          form homodimers upon binding of HSP90 and is activated
          by Rho effector Rho kinase and MAPKAPK2. LIMK1 is
          important for normal central nervous system
          development, and its deletion has been implicated in
          the development of the human genetic disorder Williams
          syndrome. Moreover, LIMK1 up-regulates the promoter
          activity of urokinase type plasminogen activator and
          induces its mRNA and protein expression in breast
          cancer cells. The LIM domains have been shown to play
          an important role in regulating kinase activity and
          likely also contribute to LIMK function by acting as
          sites of protein-to-protein interactions. All LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 74

 Score = 44.1 bits (104), Expect = 1e-06
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 4  LSLCVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          L +C  CG  I+D   L+ A + +WHA C RC EC   L      + +DG+ +CK+DY
Sbjct: 19 LPVCASCGQSIYDGQYLQ-ALNSDWHADCFRCCECGASLSHW--YYEKDGRLFCKKDY 73


>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain
          Kinase 2).  The first LIM domain of LIMK2 (LIM domain
          Kinase 2): LIMK2 is a member of the LIMK protein
          family, which comprises LIMK1 and LIMK2. LIMK contains
          two LIM domains, a PDZ domain, and a kinase domain.
          LIMK is involved in the regulation of actin
          polymerization and microtubule disassembly. LIMK
          influences architecture of the actin cytoskeleton by
          regulating the activity of the cofilin family proteins
          cofilin1, cofilin2, and destrin. The mechanism of the
          activation is to phosphorylates cofilin on serine 3 and
          inactivates its actin-severing activity, altering the
          rate of actin depolymerization. LIMK activity is
          activated by phosphorylation of a threonine residue
          within the activation loop of the kinase by
          p21-activated kinases 1 and 4 and by Rho kinase. LIMKs
          can function in both cytoplasm and nucleus. Both LIMK1
          and LIMK2 can act in the nucleus to suppress
          Rac/Cdc42-dependent cyclin D1 expression. LIMK2 is
          expressed in all tissues. While LIMK1 localizes mainly
          at focal adhesions, LIMK2 is found in cytoplasmic
          punctae, suggesting that they may have different
          cellular functions. The activity of LIM kinase 2 to
          regulate cofilin phosphorylation is inhibited by the
          direct binding of Par-3. LIMK2 activation promotes cell
          cycle progression. The phenotype of Limk2 knockout mice
          shows a defect in spermatogenesis. The LIM domains have
          been shown to play an important role in regulating
          kinase activity and likely also contribute to LIMK
          function by acting as sites of protein-to-protein
          interactions. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 53

 Score = 41.8 bits (98), Expect = 5e-06
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GCGG+I D +  RV  +  WH +C +C+ C   L      + +DGK YC + Y
Sbjct: 1  CTGCGGRIQDSFHYRVVQE-AWHNSCFQCSVCQDLLTN--WYYEKDGKLYCHKHY 52


>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM
          (abLIM) proteins.  The third LIM domain of actin
          binding LIM (abLIM) proteins: Three homologous members
          of the abLIM protein family have been identified;
          abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM
          consists of four tandem repeats of LIM domains and the
          C-terminal of acting binding LIM protein is a villin
          headpiece domain, which has strong actin binding
          activity. The abLIM-1, which is expressed in retina,
          brain, and muscle tissue, has been indicated to
          function as a tumor suppressor. AbLIM-2 and -3, mainly
          expressed in muscle and neuronal tissue, bind to
          F-actin strongly.  They may serve as a scaffold for
          signaling modules of the actin cytoskeleton and thereby
          modulate transcription. It has shown that LIM domains
          of abLIMs interact with STARS (striated muscle
          activator of Rho signaling), which directly binds actin
          and stimulates serum-response factor (SRF)-dependent
          transcription. All LIM domains are 50-60 amino acids in
          size and share two characteristic highly conserved zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 41.2 bits (97), Expect = 8e-06
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GCG +I +   L +A D +WH  C +C EC + L        +DGK YC+RDY
Sbjct: 1  CAGCGQEIKNGQAL-LALDKQWHVWCFKCKECGKVLTGEYMG--KDGKPYCERDY 52


>gnl|CDD|188775 cd09389, LIM2_LMO1_LMO3, The second LIM domain of LMO1 and LMO3
           (LIM domain only protein 1 and 3).  The second LIM
           domain of LMO1 and LMO3 (LIM domain only protein 1 and
           3): LMO1 and LMO3 are highly homologous and belong to
           the LMO protein family. LMO1 and LMO3 are nuclear
           protein that plays important roles in transcriptional
           regulation and development. As LIM domains lack
           intrinsic DNA-binding activity, nuclear LMOs are
           involved in transcriptional regulation by forming
           complexes with other transcription factors or cofactors.
           For example, LMO1 interacts with the the bHLH domain of 
           bHLH transcription factor, TAL1 (T-cell acute
           leukemia1)/SCL (stem cell leukemia) . LMO1 inhibits the
           expression of TAL1/SCL target genes.  LMO3 facilitates
           p53 binding to its response elements, which suggests
           that LMO3 acts as a co-repressor of p53, suppressing
           p53-dependent transcriptional regulation. In addition,
           LMO3 interacts with neuronal transcription factor, HEN2,
           and acts as an oncogene in neuroblastoma. Another
           binding partner of LMO3 is calcium- and integrin-binding
           protein CIB, which binds via the second LIM domain
           (LIM2) of LMO3. One role of the CIB/LMO3 complex is to
           inhibit cell proliferation. Although LMO1 and LMO3 are
           highly homologous proteins, they play different roles in
           the regulation of the pituitary glycoprotein hormone
           alpha-subunit (alpha GSU) gene. Alpha GSU promoter
           activity was markedly repressed by LMO1 but activated by
           LMO3. All LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 55

 Score = 40.8 bits (95), Expect = 1e-05
 Identities = 19/55 (34%), Positives = 33/55 (60%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C  C+      + VMRAK+ +YH+ CF C +C ++   GD+F L+ + + C+ D+
Sbjct: 1   CAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDY 55


>gnl|CDD|188776 cd09390, LIM2_dLMO, The second LIM domain of dLMO (Beaderx).  The
           second LIM domain of dLMO (Beaderx): dLMO is a nuclear
           protein that plays important roles in transcriptional
           regulation and development. In Drosophila dLMO modulates
           the activity of LIM-homeodomain protein Apterous (Ap),
           which regulates the formation of the dorsal-ventral axis
           of the Drosophila wing. Biochemical analysis shows that
           dLMO protein influences the activity of Apterous by
           binding of its cofactor Chip. Further studies shown that
           dLMO proteins might function in an evolutionarily
           conserved mechanism involved in patterning the
           appendages. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 55

 Score = 40.6 bits (95), Expect = 1e-05
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C  C+      + VMRA+  +YH++CF C  C  +   GD F L E+ + C+ D+
Sbjct: 1   CAACSKTIPAFEMVMRARTNVYHLECFACQRCNHRFCVGDRFYLCENKILCEYDY 55


>gnl|CDD|188771 cd09385, LIM2_LMO2, The second LIM domain of LMO2 (LIM domain only
           protein 2).  The second LIM domain of LMO2 (LIM domain
           only protein 2): LMO2 is a nuclear protein that  plays
           important roles in transcriptional regulation and
           development. The two tandem LIM domains of LMO2 support
           the assembly of a crucial cell-regulatory complex by
           interacting with both the TAL1-E47 and GATA1
           transcription factors to form a DNA-binding complex that
           is capable of transcriptional activation. LMOs have also
           been shown to be involved in oncogenesis. LMO1 and LMO2
           are activated in T-cell acute lymphoblastic leukemia by
           distinct chromosomal translocations. LMO2 was also shown
           to be involved in erythropoiesis and is required for the
           hematopoiesis in the adult animals. All LIM domains are
           50-60 amino acids in size and share two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 56

 Score = 40.8 bits (95), Expect = 2e-05
 Identities = 18/54 (33%), Positives = 28/54 (51%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDD 150
           C  C+   +  +  MR K+K+YH++CF C  C K    GD + L    + C+ D
Sbjct: 1   CASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQD 54


>gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin.
           The first LIM domain of protein LIMPETin: LIMPETin
          contains 6 LIM domains at the C-terminal and an
          N-terminal PET domain. Four of the six LIM domains are
          highly homologous to the four and half LIM domain
          protein family and two of them show sequence similarity
          to the LIM domains of the Testin family. Thus, LIMPETin
          may be the recombinant product of genes coding testin
          and FHL proteins.  In Schistosoma mansoni, where
          LIMPETin was first identified, LIMPETin is down
          regulated in sexually mature adult Schistosoma females
          compared to sexually immature adult females and adult
          male. Its differential expression indicates that it is
          a transcription regulator. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 58

 Score = 38.5 bits (90), Expect = 9e-05
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 5/59 (8%)

Query: 7  CVGCGGQIHDQYILRVAP----DLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GC   +    +   AP     L WH AC RC+ C + L +   C V D + YC+R Y
Sbjct: 1  CGGCSEPLKYGELAVTAPKFGESLLWHPACFRCSTCEELLVDLTYC-VHDDQIYCERHY 58


>gnl|CDD|188774 cd09388, LIM1_LMO1_LMO3, The first LIM domain of LMO1 and LMO3
          (LIM domain only protein 1 and 3).  The first LIM
          domain of LMO1 and LMO3 (LIM domain only protein 1 and
          3): LMO1 and LMO3 are highly homologous and belong to
          the LMO protein family. LMO1 and LMO3 are nuclear
          protein that plays important roles in transcriptional
          regulation and development. As LIM domains lack
          intrinsic DNA-binding activity, nuclear LMOs are
          involved in transcriptional regulation by forming
          complexes with other transcription factors or
          cofactors. For example, LMO1 interacts with the the
          bHLH domain of  bHLH transcription factor, TAL1 (T-cell
          acute leukemia1)/SCL (stem cell leukemia) . LMO1
          inhibits the expression of TAL1/SCL target genes.  LMO3
          facilitates p53 binding to its response elements, which
          suggests that LMO3 acts as a co-repressor of p53,
          suppressing p53-dependent transcriptional regulation.
          In addition, LMO3 interacts with neuronal transcription
          factor, HEN2, and acts as an oncogene in neuroblastoma.
          Another binding partner of LMO3 is calcium- and
          integrin-binding protein CIB, which binds via the
          second LIM domain (LIM2) of LMO3. One role of the
          CIB/LMO3 complex is to inhibit cell proliferation.
          Although LMO1 and LMO3 are highly homologous proteins,
          they play different roles in the regulation of the
          pituitary glycoprotein hormone alpha-subunit (alpha
          GSU) gene. Alpha GSU promoter activity was markedly
          repressed by LMO1 but activated by LMO3. All LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 55

 Score = 37.9 bits (88), Expect = 2e-04
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDE-NCTCFVRDGKTYCKRDY 61
          C GC  +I D+Y+L+ A D  WH  CL+CA C   L E   T + +     C+RDY
Sbjct: 1  CAGCNRKIKDRYLLK-ALDQYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDY 55


>gnl|CDD|188770 cd09384, LIM1_LMO2, The first LIM domain of LMO2 (LIM domain only
          protein 2).  The first LIM domain of LMO2 (LIM domain
          only protein 2): LMO2 is a nuclear protein that  plays
          important roles in transcriptional regulation and
          development. The two tandem LIM domains of LMO2 support
          the assembly of a crucial cell-regulatory complex by
          interacting with both the TAL1-E47 and GATA1
          transcription factors to form a DNA-binding complex
          that is capable of transcriptional activation. LMOs
          have also been shown to be involved in oncogenesis.
          LMO1 and LMO2 are activated in T-cell acute
          lymphoblastic leukemia by distinct chromosomal
          translocations. LMO2 was also shown to be involved in
          erythropoiesis and is required for the hematopoiesis in
          the adult animals. All LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 56

 Score = 37.5 bits (87), Expect = 2e-04
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDE-NCTCFVRDGKTYCKRDYV 62
          C GC   I D+Y L+ A D  WH  CL C  C   L E     + + G+  C+RDY+
Sbjct: 1  CGGCQQNIGDRYFLK-AIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYL 56


>gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred
           partner (LPP).  The second LIM domain of lipoma
           preferred partner (LPP): LPP is a member of the zyxin
           LIM protein family and contains three LIM zinc-binding
           domains at the C-terminal and proline-rich region at the
           N-terminal.  LPP initially identified as the most
           frequent translocation partner of HMGA2 (High Mobility
           Group A2) in a subgroup of benign tumors of adipose
           tissue (lipomas). It was also shown to be rearranged in
           a number of other soft tissues, as well as in a case of
           acute monoblastic leukemia. In addition to its
           involvement in tumors, LPP was inedited as a smooth
           muscle restricted LIM protein that plays an important
           role in SMC migration. LPP is localized at sites of cell
           adhesion, cell-cell contacts and transiently in the
           nucleus. In nucleus, it acts as a coactivator for the
           ETS domain transcription factor PEA3. In addition to
           PEA3, it interacts with alpha-actinin,vasodilator
           stimulated phosphoprotein (VASP),Palladin, and Scrib.
           The  LIM domains are the main focal adhesion targeting
           elements and that the proline- rich region, which
           harbors binding sites for alpha-actinin and vasodilator-
           stimulated phosphoprotein (VASP), has a weak targeting
           capacity. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 60

 Score = 37.5 bits (87), Expect = 2e-04
 Identities = 16/25 (64%), Positives = 18/25 (72%)

Query: 108 DFVMRAKNKIYHVQCFCCVVCGKQL 132
           D ++RA  K YH QCF CVVCGK L
Sbjct: 10  DRILRATGKPYHPQCFTCVVCGKSL 34


>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM
           (abLIM) proteins.  The first LIM domain of actin binding
           LIM (abLIM) proteins:  Three homologous members of the
           abLIM protein family have been identified; abLIM-1,
           abLIM-2 and abLIM-3. The N-terminal of abLIM consists of
           four tandem repeats of LIM domains and the C-terminal of
           acting binding LIM protein is a villin headpiece domain,
           which has strong actin binding activity. The abLIM-1,
           which is expressed in retina, brain, and muscle tissue,
           has been indicated to function as a tumor suppressor.
           AbLIM-2 and -3, mainly expressed in muscle and neuronal
           tissue, bind to F-actin strongly.  They may serve as a
           scaffold for signaling modules of the actin cytoskeleton
           and thereby modulate transcription. It has shown that
           LIM domains of abLIMs interact with STARS (striated
           muscle activator of Rho signaling), which directly binds
           actin and stimulates serum-response factor
           (SRF)-dependent transcription. All LIM domains are 50-60
           amino acids in size and share two characteristic highly
           conserved zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 36.9 bits (86), Expect = 3e-04
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDD 150
           C KC    K E  V+R ++K +H++CF C VCG  L  G  F  +E   +C DD
Sbjct: 1   CYKCGKKCKGE--VLRVQDKYFHIKCFTCKVCGCDLAQGGFFV-KEGEYYCTDD 51


>gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like
          family.  The first LIM domain of Testin_like family:
          This family includes testin, prickle, dyxin and
          LIMPETin. Structurally, testin and prickle proteins
          contain three LIM domains at C-terminal; LIMPETin has
          six LIM domains; and dyxin presents only two LIM
          domains. However, all members of the family contain a
          PET protein-protein interaction domain.  Testin is a
          cytoskeleton associated focal adhesion protein that
          localizes along actin stress fibers, at
          cell-cell-contact areas, and at focal adhesion plaques.
          Testin interacts with a variety of cytoskeletal
          proteins, including zyxin, mena, VASP, talin, and actin
          and it is involved in cell motility and adhesion
          events. Prickles have been implicated in roles of
          regulating tissue polarity or planar cell polarity
          (PCP).  Dyxin involves in lung and heart development by
          interaction with GATA6 and blocking GATA6 activated
          target genes. LIMPETin might be the recombinant product
          of genes coding testin and four and half LIM proteins
          and its function is not well understood. As in other
          LIM domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 58

 Score = 37.2 bits (87), Expect = 3e-04
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 5/59 (8%)

Query: 7  CVGCGGQIH-DQYIL---RVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  C   I+  +  +   R   D  WH  C  C  C++ L +    F  DGK YC R Y
Sbjct: 1  CEKCKEPINPGEVAVFAERAGEDACWHPGCFVCETCNELLVDL-IYFYHDGKIYCGRHY 58



 Score = 30.3 bits (69), Expect = 0.081
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 4/41 (9%)

Query: 97  CEKCNLNFKRED---FVMRA-KNKIYHVQCFCCVVCGKQLV 133
           CEKC       +   F  RA ++  +H  CF C  C + LV
Sbjct: 1   CEKCKEPINPGEVAVFAERAGEDACWHPGCFVCETCNELLV 41


>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin.  The first LIM
           domain of Zyxin: Zyxin exhibits three copies of the LIM
           domain, an extensive proline-rich domain and a nuclear
           export signal.  Localized at sites of cell substratum
           adhesion in fibroblasts, Zyxin interacts with
           alpha-actinin, members of the cysteine-rich protein
           (CRP) family, proteins that display Src homology 3 (SH3)
           domains and Ena/VASP family members. Zyxin and its
           partners have been implicated in the spatial control of
           actin filament assembly as well as in pathways important
           for cell differentiation. In addition to its functions
           at focal adhesion plaques, recent work has shown that
           zyxin moves from the sites of cell contacts to the
           nucleus, where it directly participates in the
           regulation of gene expression. As in other LIM domains,
           this domain family is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 87

 Score = 37.5 bits (87), Expect = 4e-04
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKD 149
           C  C     R    +RA   ++HV CF C  C +QL  G +F   E   +C++
Sbjct: 34  CGICGQPLSRTQPAVRALGHLFHVTCFTCHQCEQQL-QGQQFYSLEGKPYCEE 85


>gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM
           (abLIM) proteins.  The second LIM domain of actin
           binding LIM (abLIM) proteins:  Three homologous members
           of the abLIM protein family have been identified;
           abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM
           consists of four tandem repeats of LIM domains and the
           C-terminal of acting binding LIM protein is a villin
           headpiece domain, which has strong actin binding
           activity. The abLIM-1, which is expressed in retina,
           brain, and muscle tissue, has been indicated to function
           as a tumor suppressor. AbLIM-2 and -3, mainly expressed
           in muscle and neuronal tissue, bind to F-actin strongly.
            They may serve as a scaffold for signaling modules of
           the actin cytoskeleton and thereby modulate
           transcription. It has shown that LIM domains of abLIMs
           interact with STARS (striated muscle activator of Rho
           signaling), which directly binds actin and stimulates
           serum-response factor (SRF)-dependent transcription. All
           LIM domains are 50-60 amino acids in size and share two
           characteristic highly conserved zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 56

 Score = 35.8 bits (83), Expect = 0.001
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 94  GTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGD 136
           GTKC+ C    + E  V+ A  K YH +CF C VC +   PGD
Sbjct: 1   GTKCDSCQDFVEGE--VVSALGKTYHPKCFVCSVCRQPFPPGD 41


>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin
          like protein family.  The first LIM domain of the
          paxillin like protein family: This family consists of
          paxillin, leupaxin, Hic-5 (ARA55), and other related
          proteins. There are four LIM domains in the C-terminal
          of the proteins and leucine-rich LD-motifs in the
          N-terminal region.  Members of this family are adaptor
          proteins to recruit key components of
          signal-transduction machinery to specific sub-cellular
          locations. Paxillin is found at the interface between
          the plasma membrane and the actin cytoskeleton.
          Paxillin serves as a platform for the recruitment of
          numerous regulatory and structural proteins that
          together control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression that
          are necessary for cell migration and survival. Leupaxin
          is a cytoskeleton adaptor protein, which is
          preferentially expressed in hematopoietic cells. It
          associates with focal adhesion kinases PYK2 and
          pp125FAK and identified to be a component of the
          osteoclast pososomal signaling complex. Hic-5 controls
          cell proliferation, migration and senescence by
          functioning as coactivator for steroid receptors such
          as androgen receptor, glucocorticoid receptor and
          progesterone receptor. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 53

 Score = 34.6 bits (80), Expect = 0.002
 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  C   I  Q +   A    WH     CAEC   L      F RDG+ YC++DY
Sbjct: 1  CAACKKPIVGQVV--TALGKTWHPEHFVCAECKTELGTK-NFFERDGQPYCEKDY 52


>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule
           interacting with CasL) like family.  The LIM domain of
           Mical (molecule interacting with CasL) like family:
           Known members of this family includes  LIM domain
           containing proteins; Mical (molecule interacting with
           CasL), pollen specific protein SF3, Eplin, xin
           actin-binding repeat-containing protein 2 (XIRP2) and
           Ltd-1. The members of this family function mainly at the
           cytoskeleton and focal adhesions. They interact with
           transcription factors or other signaling molecules to
           play roles in muscle development, neuronal
           differentiation, cell growth and mobility.  Eplin has
           also found to be tumor suppressor. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs.. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 34.6 bits (80), Expect = 0.003
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 111 MRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           + A  K++H  CF C  C K L  G  +A  E  L+CK
Sbjct: 14  LVADGKLFHKSCFRCSHCNKTLRLG-NYASLEGKLYCK 50


>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin
          like protein family.  The third LIM domain of the
          paxillin like protein family: This family consists of
          paxillin, leupaxin, Hic-5 (ARA55), and other related
          proteins. There are four LIM domains in the C-terminal
          of the proteins and leucine-rich LD-motifs in the
          N-terminal region.  Members of this family are adaptor
          proteins to recruit key components of
          signal-transduction machinery to specific sub-cellular
          locations. Paxillin is found at the interface between
          the plasma membrane and the actin cytoskeleton.
          Paxillin serves as a platform for the recruitment of
          numerous regulatory and structural proteins that
          together control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression that
          are necessary for cell migration and survival. Leupaxin
          is a cytoskeleton adaptor protein, which is
          preferentially expressed in hematopoietic cells. It
          associates with focal adhesion kinases PYK2 and
          pp125FAK and identified to be a component of the
          osteoclast pososomal signaling complex. Hic-5 controls
          cell proliferation, migration and senescence by
          functioning as coactivator for steroid receptors such
          as androgen receptor, glucocorticoid receptor and
          progesterone receptor. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 53

 Score = 34.2 bits (79), Expect = 0.003
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GC   I + YI   A + +WH  C  C ECH+    N + F  +G  YC+  Y
Sbjct: 1  CGGCNKPILENYI--SALNTQWHPECFVCRECHKPF-INGSFFEHEGLPYCETHY 52


>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding
           LIM protein-1 (FBLP-1).  The second LIM domain of the
           filamin-binding LIM protein-1 (FBLP-1): Fblp-1 contains
           a proline-rich domain near its N terminus and two LIM
           domains at its C terminus. FBLP-1 mRNA was detected in a
           variety of tissues and cells including platelets and
           endothelial cells. FBLP-1 binds to Filamins. The
           association between filamin B and FBLP-1 may play an
           unknown role in cytoskeletal function, cell adhesion,
           and cell motility. As in other LIM domains, this domain
           family is 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 53

 Score = 33.9 bits (78), Expect = 0.003
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDE-FALREDG-LFCKDD 150
           C KC       + ++RA  K YH  CF CV CG+++  GDE FA+ E   ++C DD
Sbjct: 1   CAKCQGVIT--EHIIRALGKGYHPPCFTCVTCGRRI--GDESFAVDEQNEVYCLDD 52


>gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin.  The
          second LIM domain of paxillin: Paxillin is an adaptor
          protein, which recruits key components of the
          signal-transduction machinery to specific sub-cellular
          locations to respond to environmental changes rapidly.
          The C-terminal region of paxillin contains four LIM
          domains which target paxillin to focal adhesions,
          presumably through a direct association with the
          cytoplasmic tail of beta-integrin. The N-terminal of
          paxillin is leucine-rich LD-motifs. Paxillin is found
          at the interface between the plasma membrane and the
          actin cytoskeleton. The binding partners of paxillin
          are diverse and include protein tyrosine kinases, such
          as Src and FAK, structural proteins, such as vinculin
          and actopaxin, and regulators of actin organization.
          Paxillin recruits these proteins to their function
          sites to control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 52

 Score = 33.4 bits (76), Expect = 0.006
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  C G I D+ +   A D  WH     CA+C  F         +DGK YC++DY
Sbjct: 1  CYYCNGPILDKVV--TALDRTWHPEHFFCAQCGAFFGPE-GFHEKDGKAYCRKDY 52


>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like
          family.  The second LIM domain of Enigma-like family:
          The Enigma LIM domain family is comprised of three
          members: Enigma, ENH, and Cypher (mouse)/ZASP (human).
          These subfamily members contain a single PDZ domain at
          the N-terminus and three LIM domains at the C-terminus.
          Enigma was initially characterized in humans and is
          expressed in multiple tissues, such as skeletal muscle,
          heart, bone and brain. The third LIM domain
          specifically interacts with the insulin receptor and
          the second LIM domain interacts with the receptor
          tyrosine kinase Ret and the adaptor protein APS.  Thus
          Enigma is implicated in signal transduction processes,
          such as mitogenic activity, insulin related actin
          organization, and glucose metabolism. The second
          member, ENH protein, was first identified in rat brain.
           It has been shown that ENH interacts with protein
          kinase D1 (PKD1) via its LIM domains and forms a
          complex with PKD1 and the alpha1C subunit of cardiac
          L-type voltage-gated calcium channel in rat neonatal
          cardiomyocytes. The N-terminal PDZ domain interacts
          with alpha-actinin at the Z-line. ZASP/Cypher is
          required for maintenance of Z-line structure during
          muscle contraction, but not required for Z-line
          assembly. In heart, Cypher/ZASP plays a structural role
          through its interaction with cytoskeletal Z-line
          proteins. In addition, there is increasing evidence
          that Cypher/ZASP also performs signaling functions.
          Studies reveal that Cypher/ZASP interacts with and
          directs PKC to the Z-line, where PKC phosphorylates
          downstream signaling targets. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 33.2 bits (76), Expect = 0.006
 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 28 WHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          WH +C  CA C Q +  N    + DG+ YC++DY
Sbjct: 20 WHVSCFVCAACKQPI-GNSLFHMEDGEPYCEKDY 52



 Score = 27.4 bits (61), Expect = 0.93
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C +C+     E  VM A  + +HV CF C  C KQ +    F + +   +C+ D+
Sbjct: 1   CARCHKKILGE--VMHALKQTWHVSCFVCAAC-KQPIGNSLFHMEDGEPYCEKDY 52


>gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner
           (LPP).  The first LIM domain of lipoma preferred partner
           (LPP): LPP is a member of the zyxin LIM protein family
           and contains three LIM zinc-binding domains at the
           C-terminal and proline-rich region at the N-terminal.
           LPP initially identified as the most frequent
           translocation partner of HMGA2 (High Mobility Group A2)
           in a subgroup of benign tumors of adipose tissue
           (lipomas). It was also shown to be rearranged in a
           number of other soft tissues, as well as in a case of
           acute monoblastic leukemia. In addition to its
           involvement in tumors, LPP was inedited as a smooth
           muscle restricted LIM protein that plays an important
           role in SMC migration. LPP is localized at sites of cell
           adhesion, cell-cell contacts and transiently in the
           nucleus. In nucleus, it acts as a coactivator for the
           ETS domain transcription factor PEA3. In addition to
           PEA3, it interacts with alpha-actinin,vasodilator
           stimulated phosphoprotein (VASP),Palladin, and Scrib.
           The  LIM domains are the main focal adhesion targeting
           elements and that the proline- rich region, which
           harbors binding sites for alpha-actinin and vasodilator-
           stimulated phosphoprotein (VASP), has a weak targeting
           capacity. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 54

 Score = 33.6 bits (77), Expect = 0.007
 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C KC      E     A +++YH+ CF C  C   L  G  F   +   +C++D+
Sbjct: 1   CVKCGEKVLGEGSGCTAMDQVYHISCFTCHQCQINL-QGKPFYALDGKPYCEEDY 54



 Score = 27.0 bits (60), Expect = 1.3
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          CV CG ++  +     A D  +H +C  C +C   L +    +  DGK YC+ DY
Sbjct: 1  CVKCGEKVLGEGSGCTAMDQVYHISCFTCHQCQINL-QGKPFYALDGKPYCEEDY 54


>gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and
           RhoGap domain containing protein.  The first LIM domain
           of Lrg1p, a LIM and RhoGap domain containing protein:
           The members of this family contain three tandem repeats
           of LIM domains and a Rho-type GTPase activating protein
           (RhoGap) domain. Lrg1p is a Rho1 GTPase-activating
           protein required for efficient cell fusion in yeast.
           Lrg1p-GAP domain strongly and specifically stimulates
           the GTPase activity of Rho1p, a regulator of beta
           (1-3)-glucan synthase in vitro. The LIM domain is 50-60
           amino acids in size and shares two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 57

 Score = 33.4 bits (77), Expect = 0.007
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVP 134
           C KC      + FV RA   +YH+ CF C  CGK +  
Sbjct: 1   CAKCGKPITGQ-FV-RALGDVYHLDCFTCHDCGKPVAS 36


>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH.  The
           first LIM domain of paxillin: Paxillin is an adaptor
           protein, which recruits key components of the
           signal-transduction machinery to specific sub-cellular
           locations to respond to environmental changes rapidly.
           The C-terminal region of paxillin contains four LIM
           domains which target paxillin to focal adhesions,
           presumably through a direct association with the
           cytoplasmic tail of beta-integrin. The N-terminal of
           paxillin is leucine-rich LD-motifs. Paxillin is found at
           the interface between the plasma membrane and the actin
           cytoskeleton. The binding partners of paxillin are
           diverse and include protein tyrosine kinases, such as
           Src and FAK, structural proteins, such as vinculin and
           actopaxin, and regulators of actin organization.
           Paxillin recruits these proteins to their function sites
           to control the dynamic changes in cell adhesion,
           cytoskeletal reorganization and gene expression. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 59

 Score = 33.5 bits (77), Expect = 0.007
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDD 150
           CE+C   F+ ++ ++ +  ++YH QCF C  C +   P   F   E   +C+ D
Sbjct: 1   CERCREGFEPDEKIVNSNGELYHEQCFVCAQCFQPF-PDGLFYEFEGRKYCEHD 53



 Score = 27.7 bits (62), Expect = 0.90
 Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 28 WHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          +H  C  CA+C Q   +    +  +G+ YC+ D+
Sbjct: 22 YHEQCFVCAQCFQPFPDG-LFYEFEGRKYCEHDF 54


>gnl|CDD|188799 cd09415, LIM1_Prickle, The first LIM domain of Prickle.  The
          first LIM domain of Prickle: Prickle contains three
          C-terminal LIM domains and a N-terminal PET domain.
          Prickles have been implicated in roles of regulating
          tissue polarity or planar cell polarity (PCP).  PCP
          establishment requires the conserved
          Frizzled/Dishevelled PCP pathway. Prickle interacts
          with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in fetal brain, adult
          cartilage, pancreatic islet, and some types of timorous
          cells.  Mutations in prickle 1 have been linked to
          progressive myoclonus epilepsy. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 33.4 bits (77), Expect = 0.007
 Identities = 22/57 (38%), Positives = 26/57 (45%), Gaps = 5/57 (8%)

Query: 7  CVGCGGQIHDQYIL----RVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKR 59
          C  CG QI    I     R  P   WH AC  C+ C + L  +   F +DGK YC R
Sbjct: 1  CEQCGEQISGGDIAVFASRAGPGACWHPACFVCSTCKELL-VDLIYFYQDGKVYCGR 56


>gnl|CDD|188783 cd09397, LIM1_UF1, LIM domain in proteins of unknown function.
          The first Lim domain of a LIM domain containing
          protein: The functions of the proteins are unknown. The
          members of this family contain two copies of LIM
          domain. The LIM domain is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 58

 Score = 33.0 bits (76), Expect = 0.009
 Identities = 12/34 (35%), Positives = 16/34 (47%)

Query: 28 WHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          WH  C  C  C      +  C+V D K YC++ Y
Sbjct: 24 WHRECFVCTTCGCPFQFSVPCYVLDDKPYCQQHY 57


>gnl|CDD|188867 cd09483, LIM1_Prickle_1, The first LIM domain of Prickle 1.  The
          first LIM domain of Prickle 1. Prickle contains three
          C-terminal LIM domains and a N-terminal PET domain
          Prickles have been implicated in roles of regulating
          tissue polarity or planar cell polarity (PCP).  PCP
          establishment requires the conserved
          Frizzled/Dishevelled PCP pathway. Prickle interacts
          with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in mainly expressed in
          fetal brain, adult cartilage, pancreatic islet, and
          some types of timorous cells. In addition, Prickle 1
          regulates cell movements during gastrulation and
          neuronal migration through interaction with the
          noncanonical Wnt11/Wnt5 pathway in zebrafish. Mutations
          in prickle 1 have been linked to progressive myoclonus
          epilepsy.  LIM domains are 50-60 amino acids in size
          and share two characteristic zinc finger motifs. The
          two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 59

 Score = 32.6 bits (74), Expect = 0.015
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query: 7  CVGCGGQIHDQ----YILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  CG +I+      +  R  P + WH +C  C  C++ L  +   F +DGK +C R +
Sbjct: 1  CEQCGIKINGGEVAVFASRAGPGVCWHPSCFVCFTCNELL-VDLIYFYQDGKIHCGRHH 58


>gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM
          and RhoGap domain containing protein.  The second LIM
          domain of Lrg1p, a LIM and RhoGap domain containing
          protein: The members of this family contain three
          tandem repeats of LIM domains and a Rho-type GTPase
          activating protein (RhoGap) domain. Lrg1p is a Rho1
          GTPase-activating protein required for efficient cell
          fusion in yeast. Lrg1p-GAP domain strongly and
          specifically stimulates the GTPase activity of Rho1p, a
          regulator of beta (1-3)-glucan synthase in vitro. The
          LIM domain is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 53

 Score = 31.9 bits (73), Expect = 0.019
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  CGG +   YI   A   ++H     C+ C      N + +  +GK YC   Y
Sbjct: 1  CFKCGGALRGSYI--TALGRKYHVEHFTCSVCPTVFGPNDSYYEHEGKIYCHYHY 53



 Score = 30.8 bits (70), Expect = 0.062
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C KC     R  ++     K YHV+ F C VC     P D +   E  ++C   +
Sbjct: 1   CFKCG-GALRGSYITALGRK-YHVEHFTCSVCPTVFGPNDSYYEHEGKIYCHYHY 53


>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin.  The
          first LIM domain of Leupaxin: Leupaxin is a
          cytoskeleton adaptor protein, which is preferentially
          expressed in hematopoietic cells.  Leupaxin belongs to
          the paxillin focal adhesion protein family. Same as
          other members of the family, it has four leucine-rich
          LD-motifs in the N-terminus and four LIM domains in the
          C-terminus. It may function in cell type-specific
          signaling by associating with interaction partners
          PYK2, FAK, PEP and p95PKL.  When expressed in human
          leukocytic cells, leupaxin significantly suppressed
          integrin-mediated cell adhesion to fibronectin and the
          tyrosine phosphorylation of paxillin. These findings
          indicate that leupaxin may negatively regulate the
          functions of paxillin during integrin signaling. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 55

 Score = 32.1 bits (73), Expect = 0.020
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  C   I  Q +   A    WH     C +C + L  +   F R+G+ YC+ DY
Sbjct: 3  CASCQKPIAGQVV--TALGQTWHPEHFVCCQCGKELG-SRPFFERNGQAYCEEDY 54


>gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein LIMPETin. 
           The fourth LIM domain of protein LIMPETin: LIMPETin
           contains 6 LIM domains at the C-terminal and an
           N-terminal PET domain. Four of the six LIM domains are
           highly homologous to the four and half LIM domain
           protein family and two of them show sequence similarity
           to the LIM domains of the Testin family. Thus, LIMPETin
           may be the recombinant product of genes coding testin
           and FHL proteins.  In Schistosoma mansoni, where
           LIMPETin was first identified, LIMPETin is down
           regulated in sexually mature adult Schistosoma females
           compared to sexually immature adult females and adult
           male. Its differential expression indicates that it is a
           transcription regulator. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 54

 Score = 32.0 bits (73), Expect = 0.021
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFC 147
           C+ C   F+     M  K + +H +CFCC  C KQ +    F  ++D ++C
Sbjct: 1   CDGCGEIFRAGMKKMEYKGQQWHEKCFCCCEC-KQPIGTKSFIPKDDDVYC 50


>gnl|CDD|188868 cd09484, LIM1_Prickle_2, The first LIM domain of Prickle 2.  The
          first LIM domain of Prickle 2: Prickle contains three
          C-terminal LIM domains and a N-terminal PET domain.
          Prickles have been implicated in roles of regulating
          tissue polarity or planar cell polarity (PCP).  PCP
          establishment requires the conserved
          Frizzled/Dishevelled PCP pathway. Prickle interacts
          with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in fetal brain, adult
          cartilage, pancreatic islet, and some types of timorous
          cells. Mutations in prickle 1 have been linked to
          progressive myoclonus epilepsy. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 31.8 bits (72), Expect = 0.030
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query: 7  CVGCGGQIHDQ----YILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  CGGQI+      +  R    + WH  C  C+ C++ L  +   F +DGK YC R +
Sbjct: 1  CEQCGGQINGGDIAVFASRAGHGVCWHPQCFVCSVCNELL-VDLIYFYQDGKIYCGRHH 58



 Score = 25.7 bits (56), Expect = 3.8
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 7/60 (11%)

Query: 97  CEKCNLNFKRED---FVMRAKNKI-YHVQCFCCVVCGKQLVPGDEFALREDG-LFCKDDH 151
           CE+C       D   F  RA + + +H QCF C VC + LV  D     +DG ++C   H
Sbjct: 1   CEQCGGQINGGDIAVFASRAGHGVCWHPQCFVCSVCNELLV--DLIYFYQDGKIYCGRHH 58


>gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein
          (CRP).  The second LIM domain of Cysteine Rich Protein
          (CRP): Cysteine-rich proteins (CRPs) are characterized
          by the presence of two LIM domains linked to a short
          glycine-rich repeats (GRRs). The CRP family members
          include CRP1, CRP2, CRP3/MLP. CRP1, CRP2 and CRP3 share
          a conserved nuclear targeting signal (K/R-K/R-Y-G-P-K),
          which supports the fact that these proteins function
          not only in the cytoplasm but also in the nucleus. CRPs
          control regulatory pathways during cellular
          differentiation, and involve in complex transcription
          control, and the organization as well as the
          arrangement of the myofibrillar/cytoskeletal network.
          It is evident that CRP1, CRP2, and CRP3/MLP are
          involved in promoting protein assembly along the
          actin-based cytoskeleton. Although members of the CRP
          family share common binding partners, they are also
          capable of recognizing different and specific targets.
          LIM domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residu es, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 54

 Score = 31.4 bits (71), Expect = 0.033
 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 28 WHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          WH  C RCA+C + L E+ T   +DG+ YCK  Y
Sbjct: 21 WHKNCFRCAKCGKSL-ESTTLADKDGEIYCKGCY 53


>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM
           domains protein (FHL).  The second LIM domain of Four
           and a half LIM domains protein (FHL): LIM-only protein
           family consists of five members, designated FHL1, FHL2,
           FHL3, FHL5 and LIMPETin. The first four members are
           composed of four complete LIM domains arranged in tandem
           and an N-terminal single zinc finger domain with a
           consensus sequence equivalent to the C-terminal half of
           a LIM domain. LIMPETin is an exception, containing six
           LIM domains. FHL1, 2 and 3 are predominantly expressed
           in muscle tissues, and FHL5 is highly expressed in male
           germ cells.  FHL proteins exert their roles as
           transcription co-activators or co-repressors through a
           wide array of interaction partners. For example, FHL1
           binds to Myosin-binding protein C, regulating myosin
           filament formation and sarcomere assembly. FHL2 has
           shown to interact with more than 50 different proteins,
           including receptors, structural proteins, transcription
           factors and cofactors, signal transducers, splicing
           factors, DNA replication and repair enzymes, and
           metabolic enzymes. FHL3 int eracts with many
           transcription factors, such as CREB, BKLF/KLF3, CtBP2,
           MyoD, and MZF_1. FHL5 is a tissue-specific coactivator
           of CREB/CREM family transcription factors. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 54

 Score = 31.5 bits (72), Expect = 0.033
 Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 1/53 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKD 149
           C+ C          M  K K +H +CF C  C K+ +    F  ++D ++C  
Sbjct: 1   CKACGKAIMPGSKKMEYKGKFWHEKCFTCSEC-KKPIGTKSFIPKDDKIYCVP 52


>gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein
          (CRP) family.  The LIM domains of Cysteine Rich Protein
          (CRP) family: Cysteine-rich proteins (CRPs) are
          characterized by the presence of two LIM domains linked
          to a short glycine-rich repeats (GRRs). The known CRP
          family members include CRP1, CRP2, and CRP3/MLP. CRP1,
          CRP2 and CRP3 share a conserved nuclear targeting
          signal (K/R-K/R-Y-G-P-K), which supports the fact that
          these proteins function not only in the cytoplasm but
          also in the nucleus. CRPs control regulatory pathways
          during cellular differentiation, and involve in complex
          transcription control, and the organization as well as
          the arrangement of the myofibrillar/cytoskeletal
          network. CRP1, CRP2, and CRP3/MLP are involved in
          promoting protein assembly along the actin-based
          cytoskeleton. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 53

 Score = 31.0 bits (71), Expect = 0.041
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 28 WHAACLRCAECHQFLDENCTCFVRDGKTYCK 58
          WH +C  CA C++ LD   T    DG+ YCK
Sbjct: 21 WHKSCFTCAVCNKRLDST-TLAEHDGEIYCK 50



 Score = 26.4 bits (59), Expect = 1.8
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 111 MRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           + A  K +H  CF C VC K+L      A  +  ++CK
Sbjct: 14  VIAAGKSWHKSCFTCAVCNKRLDSTT-LAEHDGEIYCK 50


>gnl|CDD|188872 cd09841, LIM1_Prickle_3, The first LIM domain of Prickle 3.  The
          first LIM domain of Prickle 3/LIM domain only 6 (LM06):
          Prickle contains three C-terminal LIM domains and a
          N-terminal PET domain.  Prickles have been implicated
          in roles of regulating tissue polarity or planar cell
          polarity (PCP).  PCP establishment requires the
          conserved Frizzled/Dishevelled PCP pathway. Prickle
          interacts with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in fetal brain, adult
          cartilage, pancreatic islet, and some types of timorous
          cells. Mutations in prickle 1 have been linked to
          progressive myoclonus epilepsy. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 31.0 bits (70), Expect = 0.047
 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 5/57 (8%)

Query: 7  CVGCGGQIHDQYIL----RVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKR 59
          C  CG QI    I     R      WH  C +CA C + L  +   F +DGK YC R
Sbjct: 1  CQQCGRQICGGDIAVFASRAGLGACWHPQCFQCASCQELL-VDLIYFYQDGKIYCGR 56


>gnl|CDD|188742 cd09356, LIM2_TRIP6, The second LIM domain of Thyroid
           receptor-interacting protein 6 (TRIP6).  The second LIM
           domain of Thyroid receptor-interacting protein 6
           (TRIP6): TRIP6 is a member of the zyxin LIM protein
           family and contains three LIM zinc-binding domains at
           the C-terminal. TRIP6 protein localizes to focal
           adhesion sites and along actin stress fibers.
           Recruitment of this protein to the plasma membrane
           occurs in a lysophosphatidic acid (LPA)-dependent
           manner. TRIP6 recruits a number of molecules involved in
           actin assembly, cell motility, survival and
           transcriptional control. The function of TRIP6 in cell
           motility is regulated by Src-dependent phosphorylation
           at a Tyr residue. The phosphorylation activates the
           coupling to the Crk SH2 domain, which is required for
           the function of TRIP6 in promoting lysophosphatidic acid
           (LPA)-induced cell migration. TRIP6 can shuttle to the
           nucleus to serve as a coactivator of AP-1 and NF-kappaB
           transcriptional factors. Moreover, TRIP6 can form a
           ternary complex with the NHERF2 PDZ protein and LPA2
           receptor to regulate LPA-induced activation of ERK and
           AKT, rendering cells resistant to chemotherapy. Recent
           evidence shows that TRIP6 antagonizes Fas-Induced
           apoptosis by enhancing the antiapoptotic effect of LPA
           in cells. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 53

 Score = 31.0 bits (70), Expect = 0.050
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 108 DFVMRAKNKIYHVQCFCCVVCGKQL 132
           + ++RA  K YH  CF CVVC + L
Sbjct: 10  ERILRATGKAYHPHCFTCVVCHRSL 34


>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the
          paxillin like protein family.  The second LIM domain of
          the paxillin like protein family: This family consists
          of paxillin, leupaxin, Hic-5 (ARA55), and other related
          proteins. There are four LIM domains in the C-terminal
          of the proteins and leucine-rich LD-motifs in the
          N-terminal region.  Members of this family are adaptor
          proteins to recruit key components of
          signal-transduction machinery to specific sub-cellular
          locations. Paxillin is found at the interface between
          the plasma membrane and the actin cytoskeleton.
          Paxillin serves as a platform for the recruitment of
          numerous regulatory and structural proteins that
          together control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression that
          are necessary for cell migration and survival. Leupaxin
          is a cytoskeleton adaptor protein, which is
          preferentially expressed in hematopoietic cells. It
          associates with focal adhesion kinases PYK2 and
          pp125FAK and identified to be a component of the
          osteoclast pososomal signaling complex. Hic-5 controls
          cell proliferation, migration and senescence by
          functioning as coactivator for steroid receptors such
          as androgen receptor, glucocorticoid receptor and
          progesterone receptor. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 30.8 bits (70), Expect = 0.054
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  C G I D+ +   A D  WH     CA+C +   +      +DGK YC+ DY
Sbjct: 1  CAYCNGPILDKCV--TALDKTWHPEHFFCAQCGKPFGDE-GFHEKDGKPYCREDY 52



 Score = 28.5 bits (64), Expect = 0.37
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDE-FALREDGLFCKDDH 151
           C  CN      D  + A +K +H + F C  CGK    GDE F  ++   +C++D+
Sbjct: 1   CAYCNGPIL--DKCVTALDKTWHPEHFFCAQCGKPF--GDEGFHEKDGKPYCREDY 52


>gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma.  The
          second LIM domain of Enigma: Enigma was initially
          characterized in humans as a protein containing three
          LIM domains at the C-terminus and a PDZ domain at
          N-terminus.  The third LIM domain specifically
          interacts with the insulin receptor and the second LIM
          domain interacts with the receptor tyrosine kinase Ret
          and the adaptor protein APS.  Thus Enigma is implicated
          in signal transduction processes, such as mitogenic
          activity, insulin related actin organization, and
          glucose metabolism. Enigma is expressed in multiple
          tissues, such as skeletal muscle, heart, bone and
          brain.  LIM domains are 50-60 amino acids in size and
          share two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes.
          Length = 52

 Score = 30.7 bits (69), Expect = 0.058
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 23 APDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          A  + WH  C  CA C   +  N   ++ +G  YC+RDY
Sbjct: 15 ALKMTWHVHCFTCAACKTPI-RNRAFYMEEGAPYCERDY 52



 Score = 28.0 bits (62), Expect = 0.51
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 3/55 (5%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C KC      E  +M A    +HV CF C  C K  +    F + E   +C+ D+
Sbjct: 1   CAKCKKKITGE--IMHALKMTWHVHCFTCAAC-KTPIRNRAFYMEEGAPYCERDY 52


>gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin.  The
          third LIM domain of paxillin: Paxillin is an adaptor
          protein, which recruits key components of the
          signal-transduction machinery to specific sub-cellular
          locations to respond to environmental changes rapidly.
          The C-terminal region of paxillin contains four LIM
          domains which target paxillin to focal adhesions,
          presumably through a direct association with the
          cytoplasmic tail of beta-integrin. The N-terminal of
          paxillin is leucine-rich LD-motifs. Paxillin is found
          at the interface between the plasma membrane and the
          actin cytoskeleton. The binding partners of paxillin
          are diverse and include protein tyrosine kinases, such
          as Src and FAK, structural proteins, such as vinculin
          and actopaxin, and regulators of actin organization.
          Paxillin recruits these proteins to their function
          sites to control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 30.2 bits (68), Expect = 0.079
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GC   I + YI   A +  WH  C  C EC      N + F  DG+ YC+  Y
Sbjct: 1  CGGCARAILENYI--SALNTLWHPECFVCRECFTPF-VNGSFFEHDGQPYCEAHY 52


>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich
          Protein 2 (CRP2).  The second LIM domain of Cysteine
          Rich Protein 2 (CRP2):  Cysteine-rich proteins (CRPs)
          are characterized by the presence of two LIM domains
          linked to short glycine-rich repeats (GRRs). The CRP
          family members include CRP1, CRP2, CRP3/MLP and
          TLPCRP1, CRP2 and CRP3 share a conserved nuclear
          targeting signal (K/R-K/R-Y-G-P-K), which supports the
          fact that these proteins function not only in the
          cytoplasm but also in the nucleus. CRPs control
          regulatory pathways during cellular differentiation,
          and involve in complex transcription circuits, and the
          organization as well as the arrangement of the
          myofibrillar/cytoskeletal network.CRP3 also called
          Muscle LIM Protein (MLP), which is a striated
          muscle-specific factor that enhances myogenic
          differentiation. The second LIM domain of CRP3/MLP
          interacts with cytoskeletal protein beta-spectrin.
          CRP3/MLP also interacts with the basic helix-loop-helix
          myogenic transcription factors MyoD, myogenin, and MRF4
          thereby increasing their affinity for specific DNA
          regulatory elements. LIM domains are 50-60 amino acids
          in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 30.1 bits (67), Expect = 0.12
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 28 WHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          WH  C RCA+C + L E+ T   ++G+ YCK  Y
Sbjct: 21 WHKNCFRCAKCGKSL-ESTTLTEKEGEIYCKGCY 53


>gnl|CDD|188785 cd09401, LIM_TLP_like, The  LIM domains of thymus LIM protein
          (TLP).  The LIM domain of thymus LIM protein (TLP) like
          proteins:  This family includes the LIM domains of TLP
          and CRIP (Cysteine-Rich Intestinal Protein). TLP is the
          distant member of the CRP family of proteins. TLP has
          two isomers (TLP-A and TLP-B) and sharing approximately
          30% with each of the three other CRPs.  Like CRP1, CRP2
          and CRP3/MLP, TLP has two LIM domains, connected by a
          flexible linker region. Unlike the CRPs, TLP lacks the
          nuclear targeting signal (K/R-K/R-Y-G-P-K) and is
          localized solely in the cytoplasm. TLP is specifically
          expressed in the thymus in a subset of cortical
          epithelial cells.  TLP has a role in development of
          normal thymus and in controlling the development and
          differentiation of thymic epithelial cells. CRIP is a
          short LIM protein with only one LIM domain. CRIP gene
          is developmentally regulated and can be induced by
          glucocorticoid hormones during the first three
          postnatal weeks. The domain shows close sequence
          homology to LIM domain of thymus LIM protein. However,
          unlike the TLP proteins which have two LIM domains, the
          members of this family have only one LIM domain. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 29.6 bits (67), Expect = 0.14
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 27 EWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          +WH  CLRC +C + L         +GK YC + Y
Sbjct: 20 DWHKPCLRCEKCKKTLTPGQHS-EHEGKPYCNKCY 53


>gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A.
          The LIM domain of Mlp84B and Mlp60A: Mlp84B and Mlp60A
          belong to the CRP LIM domain protein family. The Mlp84B
          protein contains five copies of the LIM domains, each
          followed by a Glycin Rich Region (GRR). However, only
          the first LIM domain of Mlp84B is in this family.
          Mlp60A exhibits only one LIM domain linked to a
          glycin-rich region. Mlp84B and Mlp60A are muscle
          specific proteins and have been implicated in muscle
          differentiation. While Mlp84B transcripts are enriched
          at the terminal ends of muscle fibers, Mlp60A
          transcripts are found throughout the muscle fibers. All
          LIM domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 54

 Score = 29.8 bits (67), Expect = 0.15
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 21 RVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCK 58
          R+A   +WH  C +C  C++ LD +  C   +G+ YCK
Sbjct: 15 RLAGGYKWHKMCFKCGMCNKLLD-STNCAEHEGELYCK 51


>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid
           receptor-interacting protein 6 (TRIP6).  The first LIM
           domain of Thyroid receptor-interacting protein 6
           (TRIP6): TRIP6 is a member of the zyxin LIM protein
           family and contains three LIM zinc-binding domains at
           the C-terminal. TRIP6 protein localizes to focal
           adhesion sites and along actin stress fibers.
           Recruitment of this protein to the plasma membrane
           occurs in a lysophosphatidic acid (LPA)-dependent
           manner. TRIP6 recruits a number of molecules involved in
           actin assembly, cell motility, survival and
           transcriptional control. The function of TRIP6 in cell
           motility is regulated by Src-dependent phosphorylation
           at a Tyr residue. The phosphorylation activates the
           coupling to the Crk SH2 domain, which is required for
           the function of TRIP6 in promoting lysophosphatidic acid
           (LPA)-induced cell migration. TRIP6 can shuttle to the
           nucleus to serve as a coactivator of AP-1 and NF-kappaB
           transcriptional factors. Moreover, TRIP6 can form a
           ternary complex with the NHERF2 PDZ protein and LPA2
           receptor to regulate LPA-induced activation of ERK and
           AKT, rendering cells resistant to chemotherapy. Recent
           evidence shows that TRIP6 antagonizes Fas-Induced
           apoptosis by enhancing the antiapoptotic effect of LPA
           in cells. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 54

 Score = 29.3 bits (66), Expect = 0.17
 Identities = 12/36 (33%), Positives = 19/36 (52%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQL 132
           C +C  N   E     A ++++HV CF C+ C  +L
Sbjct: 1   CGRCGENVVGEGTGCTAMDQVFHVDCFTCMTCNGKL 36


>gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich
          Protein 3 (CRP3/MLP).  The second LIM domain of
          Cysteine Rich Protein 3 (CRP3/MLP):  Cysteine-rich
          proteins (CRPs) are characterized by the presence of
          two LIM domains linked to short glycine-rich repeats
          (GRRs). The CRP family members include CRP1, CRP2,
          CRP3/MLP and TLPCRP1, CRP2 and CRP3 share a conserved
          nuclear targeting signal (K/R-K/R-Y-G-P-K), which
          supports the fact that these proteins function not only
          in the cytoplasm but also in the nucleus. CRPs control
          regulatory pathways during cellular differentiation,
          and involve in complex transcription circuits, and the
          organization as well as the arrangement of the
          myofibrillar/cytoskeletal network.CRP3 also called
          Muscle LIM Protein (MLP), which is a striated
          muscle-specific factor that enhances myogenic
          differentiation. The second LIM domain of CRP3/MLP
          interacts with cytoskeletal protein beta-spectrin.
          CRP3/MLP also interacts with the basic helix-loop-helix
          myogenic transcription factors MyoD, myogenin, and MRF4
          thereby increasing their affinity for specific DNA
          regulatory elements. LIM domains are 50-60 amino acids
          in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 29.2 bits (65), Expect = 0.21
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 28 WHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          WH  C RCA C + L E+ T   +DG+ YCK  Y
Sbjct: 21 WHKTCFRCAICGKSL-ESTTVTDKDGELYCKVCY 53


>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like
          family.  The third LIM domain of Enigma-like family:
          The Enigma LIM domain family is comprised of three
          members: Enigma, ENH, and Cypher (mouse)/ZASP (human).
          These subfamily members contain a single PDZ domain at
          the N-terminus and three LIM domains at the C-terminus.
          Enigma was initially characterized in humans and is
          expressed in multiple tissues, such as skeletal muscle,
          heart, bone, and brain. The third LIM domain
          specifically interacts with the insulin receptor and
          the second LIM domain interacts with the receptor
          tyrosine kinase Ret and the adaptor protein APS.  Thus
          Enigma is implicated in signal transduction processes,
          such as mitogenic activity, insulin related actin
          organization, and glucose metabolism. The second
          member, ENH protein, was first identified in rat brain.
           It has been shown that ENH interacts with protein
          kinase D1 (PKD1) via its LIM domains and forms a
          complex with PKD1 and the alpha1C subunit of cardiac
          L-type voltage-gated calcium channel in rat neonatal
          cardiomyocytes. The N-terminal PDZ domain interacts
          with alpha-actinin at the Z-line. ZASP/Cypher is
          required for maintenance of Z-line structure during
          muscle contraction, but not required for Z-line
          assembly. In heart, Cypher/ZASP plays a structural role
          through its interaction with cytoskeletal Z-line
          proteins. In addition, there is increasing evidence
          that Cypher/ZASP also performs signaling functions.
          Studies reveal that Cypher/ZASP interacts with and
          directs PKC to the Z-line, where PKC phosphorylates
          downstream signaling targets. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 28.9 bits (65), Expect = 0.22
 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 1/52 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCK 58
          C GC   I        A    WH  C  CA CH  L E  T + +  K  CK
Sbjct: 1  CHGCDFPIEAGDRFLEALGHTWHDTCFVCAVCHVNL-EGQTFYSKKDKPLCK 51



 Score = 27.8 bits (62), Expect = 0.59
 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 1/52 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           C  C+   +  D  + A    +H  CF C VC    + G  F  ++D   CK
Sbjct: 1   CHGCDFPIEAGDRFLEALGHTWHDTCFVCAVC-HVNLEGQTFYSKKDKPLCK 51


>gnl|CDD|188797 cd09413, LIM1_Testin, The first LIM domain of Testin.  The first
          LIM domain of Testin: Testin contains three C-terminal
          LIM domains and a PET protein-protein interaction
          domain at the N-terminal.   Testin is a cytoskeleton
          associated focal adhesion protein that localizes along
          actin stress fibers, at cell-cell-contact areas, and at
          focal adhesion plaques. Testin interacts with a variety
          of cytoskeletal proteins, including zyxin, mena, VASP,
          talin, and actin and it is involved in cell motility
          and adhesion events. Knockout mice experiments reveal
          that tumor repressor function of Testin. LIM domains
          are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 58

 Score = 29.3 bits (66), Expect = 0.22
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 18 YILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          Y  R   D  WH AC  C+ C + L  +   F ++GK YC R Y
Sbjct: 16 YAERAGYDKLWHPACFVCSTCGELL-VDMIYFWKNGKLYCGRHY 58



 Score = 26.7 bits (59), Expect = 2.0
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 4/41 (9%)

Query: 97  CEKCNLNFKREDFVMRAK----NKIYHVQCFCCVVCGKQLV 133
           C  C    K  D  + A+    +K++H  CF C  CG+ LV
Sbjct: 1   CYCCKQPMKEGDPAVYAERAGYDKLWHPACFVCSTCGELLV 41


>gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function.
           LIM domain in proteins of unknown function: LIM domains
           are identified in a diverse group of proteins with wide
           variety of biological functions, including gene
           expression regulation, cell fate determination,
           cytoskeleton organization, tumor formation, and
           development. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes. They perform their functions through
           interactions with other protein partners. The LIM
           domains are 50-60 amino acids in size and share two
           characteristic highly conserved zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. The consensus sequence of LIM domain
           has been defined as
           C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,
           21)-C-x(2,3)-[CHD] (where X denotes any amino acid).
          Length = 61

 Score = 28.9 bits (65), Expect = 0.27
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 96  KCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFC 147
            C  C L     + ++    K+YH  CF C  CG QL PG  +   E G +C
Sbjct: 4   PCASCGLPVFLAERLLIEG-KVYHRTCFKCARCGVQLTPGSFYET-EYGSYC 53


>gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog
          (ENH) family.  The second LIM domain of the Enigma
          Homolog (ENH) family: ENH was initially identified in
          rat brain. Same as enigma, it contains three LIM
          domains at the C-terminus and a PDZ domain at
          N-terminus. ENH is implicated in signal transduction
          processes involving protein kinases.  It has also been
          shown that ENH interacts with protein kinase D1 (PKD1)
          via its LIM domains and forms a complex with PKD1 and
          the alpha1C subunit of cardiac L-type voltage-gated
          calcium channel in rat neonatal cardiomyocytes. The
          N-terminal PDZ domain interacts with alpha-actinin at
          the Z-line. ENH is expressed in multiple tissues, such
          as skeletal muscle, heart, bone, and brain. LIM domains
          are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 52

 Score = 28.8 bits (64), Expect = 0.29
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 28 WHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          WH +C  C  CH  +  N    + DG+ YC+ DY
Sbjct: 20 WHVSCFVCVACHNPI-RNNVFHLEDGEPYCETDY 52



 Score = 27.7 bits (61), Expect = 0.76
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDDH 151
           C +C      E  V+ A  + +HV CF CV C    +  + F L +   +C+ D+
Sbjct: 1   CGRCQRKILGE--VINALKQTWHVSCFVCVACHNP-IRNNVFHLEDGEPYCETDY 52


>gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin.  The second
           LIM domain of Zyxin: Zyxin exhibits three copies of the
           LIM domain, an extensive proline-rich domain and a
           nuclear export signal.  Localized at sites of
           cellsubstratum adhesion in fibroblasts, Zyxin interacts
           with alpha-actinin, members of the cysteine-rich protein
           (CRP) family, proteins that display Src homology 3 (SH3)
           domains and Ena/VASP family members. Zyxin and its
           partners have been implicated in the spatial control of
           actin filament assembly as well as in pathways important
           for cell differentiation. In addition to its functions
           at focal adhesion plaques, recent work has shown that
           zyxin moves from the sites of cell contacts to the
           nucleus, where it directly participates in the
           regulation of gene expression. As in other LIM domains,
           this domain family is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors o r
           scaffolds to support the assembly of multimeric protein.
          Length = 60

 Score = 28.7 bits (64), Expect = 0.30
 Identities = 12/21 (57%), Positives = 15/21 (71%)

Query: 108 DFVMRAKNKIYHVQCFCCVVC 128
           D +++A  K YH QCF CVVC
Sbjct: 10  DRMLKATGKSYHPQCFTCVVC 30


>gnl|CDD|188848 cd09464, LIM2_LIMK1, The second LIM domain of LIMK1 (LIM domain
           Kinase 1).  The second LIM domain of LIMK1 (LIM domain
           Kinase 1): LIMK1 belongs to the LIMK protein family,
           which comprises LIMK1 and LIMK2. LIMK contains two LIM
           domains, a PDZ domain, and a kinase domain. LIMK is
           involved in the regulation of actin polymerization and
           microtubule disassembly. LIMK influences architecture of
           the actin cytoskeleton by regulating the activity of the
           cofilin family proteins cofilin1, cofilin2, and destrin.
           The mechanism of the activation is to phosphorylates
           cofilin on serine 3 and inactivates its actin-severing
           activity, and altering the rate of actin
           depolymerization. LIMKs can function in both cytoplasm
           and nucleus. Both LIMK1 and LIMK2 can act in the nucleus
           to suppress Rac/Cdc42-dependent cyclin D1 expression.
           LIMK1 is expressed in all tissues and is localized to
           focal adhesions in the cell. LIMK1 can form homodimers
           upon binding of HSP90 and is activated by Rho effector
           Rho kinase and MAPKAPK2. LIMK1 is important for normal
           central nervous system development, and its deletion has
           been implicated in the development of the human genetic
           disorder Williams syndrome. Moreover, LIMK1 up-regulates
           the promoter activity of urokinase type plasminogen
           activator and induces its mRNA and protein expression in
           breast cancer cells. The LIM domains have been shown to
           play an important role in regulating kinase activity and
           likely also contribute to LIMK function by acting as
           sites of protein-to-protein interactions. All LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 55

 Score = 28.7 bits (64), Expect = 0.32
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 109 FVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDG-LFC 147
            VM A  + YH +CF C+ CG  +  GD +AL E   L+C
Sbjct: 12  LVMVAGEQKYHPECFSCLRCGAFIGDGDTYALVEHSKLYC 51


>gnl|CDD|188741 cd09355, LIM2_Ajuba_like, The second LIM domain of Ajuba-like
          proteins.  The second LIM domain of Ajuba-like
          proteins: Ajuba like LIM protein family includes three
          highly homologous proteins Ajuba, Limd1, and WTIP.
          Members of the family contain three tandem C-terminal
          LIM domains and a proline-rich N-terminal region. This
          family of proteins functions as scaffolds,
          participating in the assembly of numerous protein
          complexes. In the cytoplasm, Ajuba binds Grb2 to
          modulate serum-stimulated ERK activation. Ajuba also
          recruits the TNF receptor-associated factor 6 (TRAF6)
          to p62 and activates PKCKappa activity. Ajuba interacts
          with alpha-catenin and F-actin to contribute to the
          formation or stabilization of adheren junctions by
          linking adhesive receptors to the actin cytoskeleton.
          Although Ajuba is a cytoplasmic protein, it can shuttle
          into the nucleus. In nucleus, Ajuba functions as a
          corepressor for the zinc finger-protein Snail. It binds
          to the SNAG repression domain of Snail through its LIM
          region.  Arginine methyltransferase-5 (Prmt5), a
          protein in the complex, is recruited to Snai l through
          an interaction with Ajuba. This ternary complex
          functions to repress E-cadherin, a Snail target gene.
          In addition, Ajuba contains functional nuclear-receptor
          interacting motifs and selectively interacts with
          retinoic acid receptors (RARs) and rexinoid receptor
          (RXRs) to negatively regulate retinoic acid signaling.
          Wtip, the Wt1-interacting protein, was originally
          identified as an interaction partner of the Wilms
          tumour protein 1 (WT1). Wtip is involved in kidney and
          neural crest development. Wtip interacts with the
          receptor tyrosine kinase Ror2 and inhibits canonical
          Wnt signaling. LIMD1 was reported to inhibit cell
          growth and metastases. The inhibition may be mediated
          through an interaction with the protein
          barrier-to-autointegration (BAF), a component of
          SWI/SNF chromatin-remodeling protein; or through the
          interaction with retinoblastoma protein (pRB),
          resulting in inhibition of E2F-mediated transcription,
          and expression of the majority of genes with E2F1-
          responsive elements. Recently, Limd1 was shown to
          interact with the p62/sequestosome protein and
          influence IL-1 and RANKL signaling by facilitating the
          assembly of a p62/TRAF6/a-PKC multi-protein complex.
          The Limd1-p62 interaction affects both NF-kappaB and
          AP-1 activity in epithelial cells and osteoclasts.
          Moreover, LIMD1 functions as tumor repressor to block
          lung tumor cell line in vitro and in vivo. Recent
          studies revealed that LIM proteins Wtip, LIMD1 and
          Ajuba interact with components of RNA induced silencing
          complexes (RISC) as well as eIF4E and the mRNA m7GTP
          cap-protein complex and are required for
          microRNA-mediated gene silencing.  As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 53

 Score = 28.5 bits (64), Expect = 0.35
 Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 2/55 (3%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C  CG  I +  +  +     +H  C RC  C++ LD        +   YC +DY
Sbjct: 1  CAVCGHLIMEMILQALGKS--YHPGCFRCCVCNECLDGVPFTVDVENNIYCVKDY 53



 Score = 24.6 bits (54), Expect = 9.4
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 108 DFVMRAKNKIYHVQCFCCVVCGKQL 132
           + +++A  K YH  CF C VC + L
Sbjct: 10  EMILQALGKSYHPGCFRCCVCNECL 34


>gnl|CDD|188820 cd09436, LIM3_TRIP6, The third LIM domain of Thyroid
          receptor-interacting protein 6 (TRIP6).  The third LIM
          domain of Thyroid receptor-interacting protein 6
          (TRIP6): TRIP6 is a member of the zyxin LIM protein
          family and contains three LIM zinc-binding domains at
          the C-terminal. TRIP6 protein localizes to focal
          adhesion sites and along actin stress fibers.
          Recruitment of this protein to the plasma membrane
          occurs in a lysophosphatidic acid (LPA)-dependent
          manner. TRIP6 recruits a number of molecules involved
          in actin assembly, cell motility, survival and
          transcriptional control. The function of TRIP6 in cell
          motility is regulated by Src-dependent phosphorylation
          at a Tyr residue. The phosphorylation activates the
          coupling to the Crk SH2 domain, which is required for
          the function of TRIP6 in promoting lysophosphatidic
          acid (LPA)-induced cell migration. TRIP6 can shuttle to
          the nucleus to serve as a coactivator of AP-1 and
          NF-kappaB transcriptional factors. Moreover, TRIP6 can
          form a ternary complex with the NHERF2 PDZ protein and
          LPA2 receptor to regulate LPA-induced activation of ERK
          and AKT, rendering cells resistant to chemotherapy.
          Recent evidence shows that TRIP6 antagonizes
          Fas-Induced apoptosis by enhancing the antiapoptotic
          effect of LPA in cells. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 66

 Score = 28.8 bits (64), Expect = 0.37
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 22 VAPDLEWHAACLRCAECHQFLDE--NCTCFVRDGKTYCK 58
          VA D ++H  C RC +C   L E  N  C+  DG   CK
Sbjct: 21 VALDRDFHVQCYRCEDCGSLLSEGDNQGCYPLDGHILCK 59


>gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin.
           The third LIM domain of protein LIMPETin: LIMPETin
           contains 6 LIM domains at the C-terminal and an
           N-terminal PET domain. Four of the six LIM domains are
           highly homologous to the four and half LIM domain
           protein family and two of them show sequence similarity
           to the LIM domains of the testin family. Thus, LIMPETin
           may be the recombinant product of genes coding testin
           and FHL proteins.  In Schistosoma mansoni, where
           LIMPETin was first identified, LIMPETin is down
           regulated in sexually mature adult Schistosoma females
           compared to sexually immature adult females and adult
           male. Its differential expression indicates that it is a
           transcription regulator. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 59

 Score = 28.7 bits (64), Expect = 0.39
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 1/55 (1%)

Query: 93  FGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFC 147
           F  +CE+C+     +   +  K+K +H  CF C  C   LV    F  + D ++C
Sbjct: 1   FANQCEECSKIIGIDSKDLSYKDKHWHEACFLCSKCKISLV-DKPFGSKADRIYC 54


>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1.  The Lim domain of DA1:
           DA1 contains one copy of LIM domain and a domain of
           unknown function. DA1 is predicted as an ubiquitin
           receptor, which sets final seed and organ size by
           restricting the period of cell proliferation. The LIM
           domain is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 53

 Score = 28.4 bits (64), Expect = 0.41
 Identities = 13/53 (24%), Positives = 22/53 (41%), Gaps = 2/53 (3%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKD 149
           C  C        F+  A   ++H +CF C  C K +    EF++  +  + K 
Sbjct: 1   CAGCKSEIGHGRFL-SALGAVWHPECFRCHACRKPI-AEHEFSVSGNDPYHKS 51


>gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain
           family which are found on Mical (molecule interacting
           with CasL) like proteins.  The LIM domain on proteins of
           unknown function: This domain belongs to the LIM domain
           family which are found on Mical (molecule interacting
           with CasL)-like proteins. Known members of the
           Mical-like family includes single LIM domain containing
           proteins, Mical (molecule interacting with CasL), pollen
           specific protein SF3, Eplin, xin actin-binding
           repeat-containing protein 2 (XIRP2), and Ltd-1. The
           members of this family function mainly at the
           cytoskeleton and focal adhesions. They interact with
           transcription factors or other signaling molecules to
           play roles in muscle development, neuronal
           differentiation, cell growth, and mobility.  As in other
           LIM domains, this domain family is 50-60 amino acids in
           size and shares two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 28.2 bits (63), Expect = 0.43
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 113 AKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           A+  IYH  CF C  C KQL   D +   E  L+CK
Sbjct: 16  AEKHIYHKNCFRCKDCNKQLKV-DNYQSHEGNLYCK 50


>gnl|CDD|188751 cd09365, LIM2_LIMK, The second LIM domain of LIMK (LIM domain
           Kinase ).  The second LIM domain of LIMK (LIM domain
           Kinase ): LIMK protein family is  comprised of two
           members LIMK1 and LIMK2. LIMK contains two LIM domains,
           a PDZ domain and a kinase domain. LIMK is involved in
           the regulation of actin polymerization and microtubule
           disassembly. LIMK influences architecture of the actin
           cytoskeleton by regulating the activity of the cofilin
           family proteins cofilin1, cofilin2, and destrin. The
           mechanism of the activation is to phosphorylates cofilin
           on serine 3 and inactivates its actin-severing activity,
           and altering the rate of actin depolymerization. LIMKs
           can function in both cytoplasm and nucleus and are
           expressed in all tissues. Both LIMK1 and LIMK2 can act
           in the nucleus to suppress Rac/Cdc42-dependent cyclin D1
           expression. However, LIMK1 and LIMk2 have different
           cellular locations. While LIMK1 localizes mainly at
           focal adhesions, LIMK2 is found in cytoplasmic punctae,
           suggesting that they may have different cellular
           functions. The LIM domains of LIMK have been shown to
           play an important role in regulating kinase activity and
           likely also contribute to LIMK function by acting as
           sites of protein-to-protein interactions. All LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 54

 Score = 28.1 bits (63), Expect = 0.45
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 110 VMRAKNKIYHVQCFCCVVCGKQLVPGDEFALRE 142
           VM A +  +H +CF C  C   +  GD +AL E
Sbjct: 12  VMVAGDHKFHPECFSCSSCKAFIGDGDSYALVE 44


>gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like
           proteins.  The first LIM domain of Ajuba-like proteins:
           Ajuba like LIM protein family includes three highly
           homologous proteins Ajuba, Limd1, and WTIP. Members of
           the family contain three tandem C-terminal LIM domains
           and a proline-rich N-terminal region. This family of
           proteins functions as scaffolds, participating in the
           assembly of numerous protein complexes. In the
           cytoplasm, Ajuba binds Grb2 to modulate serum-stimulated
           ERK activation. Ajuba also recruits the TNF
           receptor-associated factor 6 (TRAF6) to p62 and
           activates PKCKappa activity. Ajuba interacts with
           alpha-catenin and F-actin to contribute to the formation
           or stabilization of adheren junctions by linking
           adhesive receptors to the actin cytoskeleton. Although
           Ajuba is a cytoplasmic protein, it can shuttle into the
           nucleus. In nucleus, Ajuba functions as a corepressor
           for the zinc finger-protein Snail. It binds to the SNAG
           repression domain of Snail through its LIM region.
           Arginine methyltransferase-5 (Prmt5), a protein in the
           complex, is recruited to Snai l through an interaction
           with Ajuba. This ternary complex functions to repress
           E-cadherin, a Snail target gene. In addition, Ajuba
           contains functional nuclear-receptor interacting motifs
           and selectively interacts with retinoic acid receptors
           (RARs) and rexinoid receptor (RXRs) to negatively
           regulate retinoic acid signaling. Wtip, the
           Wt1-interacting protein, was originally identified as an
           interaction partner of the Wilms tumour protein 1 (WT1).
           Wtip is involved in kidney and neural crest development.
           Wtip interacts with the receptor tyrosine kinase Ror2
           and inhibits canonical Wnt signaling. LIMD1 was reported
           to inhibit cell growth and metastases. The inhibition
           may be mediated through an interaction with the protein
           barrier-to-autointegration (BAF), a component of SWI/SNF
           chromatin-remodeling protein; or through the interaction
           with retinoblastoma protein (pRB), resulting in
           inhibition of E2F-mediated transcription, and expression
           of the majority of genes with E2F1- responsive elements.
           Recently, Limd1 was shown to interact with the
           p62/sequestosome protein and influence IL-1 and RANKL
           signaling by facilitating the assembly of a
           p62/TRAF6/a-PKC multi-protein complex. The Limd1-p62
           interaction affects both NF-kappaB and AP-1 activity in
           epithelial cells and osteoclasts. Moreover, LIMD1
           functions as tumor repressor to block lung tumor cell
           line in vitro and in vivo. Recent studies revealed that
           LIM proteins Wtip, LIMD1 and Ajuba interact with
           components of RNA induced silencing complexes (RISC) as
           well as eIF4E and the mRNA m7GTP cap-protein complex and
           are required for microRNA-mediated gene silencing.  As
           in other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 54

 Score = 28.2 bits (63), Expect = 0.48
 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 1/54 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKDD 150
           C KC           +A   +YH  CF C  CG+ L  G  F      ++C++D
Sbjct: 1   CVKCGKGVYGASQACQAMGNLYHTNCFTCCSCGRTL-RGKAFYNVNGKVYCEED 53


>gnl|CDD|188849 cd09465, LIM2_LIMK2, The second LIM domain of LIMK2 (LIM domain
           Kinase 2).  The second LIM domain of LIMK2 (LIM domain
           Kinase 2): LIMK2 is a member of the LIMK protein family,
           which comprises LIMK1 and LIMK2. LIMK contains two LIM
           domains, a PDZ domain, and a kinase domain. LIMK is
           involved in the regulation of actin polymerization and
           microtubule disassembly. LIMK influences architecture of
           the actin cytoskeleton by regulating the activity of the
           cofilin family proteins cofilin1, cofilin2, and destrin.
           The mechanism of the activation is to phosphorylates
           cofilin on serine 3 and inactivates its actin-severing
           activity, altering the rate of actin depolymerisation.
           LIMK activity is activated by phosphorylation of a
           threonine residue within the activation loop of the
           kinase by p21-activated kinases 1 and 4 and by Rho
           kinase. LIMKs can function in both cytoplasm and
           nucleus. Both LIMK1 and LIMK2 can act in the nucleus to
           suppress Rac/Cdc42-dependent cyclin D1 expression. LIMK2
           is expressed in all tissues. While LIMK1 localizes
           mainly at focal adhesions, LIMK2 is found in cytoplasmic
           punctae, suggesting that they may have different
           cellular functions. The activity of LIM kinase 2 to
           regulate cofilin phosphorylation is inhibited by the
           direct binding of Par-3. LIMK2 activation promotes cell
           cycle progression. The phenotype of Limk2 knockout mice
           shows a defect in spermatogenesis. The LIM domains have
           been shown to play an important role in regulating
           kinase activity and likely also contribute to LIMK
           function by acting as sites of protein-to-protein
           interactions. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 59

 Score = 28.4 bits (63), Expect = 0.53
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 93  FGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDG-LFCKDDH 151
           FG  C  C+L        M A    YH +CF C+ C   +  GD +AL +   L+C   H
Sbjct: 2   FGELCHGCSLLMTGP--AMVAGEYKYHPECFACMSCKVIIEDGDTYALVQHTTLYCGKCH 59


>gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM
           domains protein (FHL).  The first LIM domain of Four and
           a half LIM domains protein (FHL): LIM-only protein
           family consists of five members, designated FHL1, FHL2,
           FHL3, FHL5 and LIMPETin. The first four members are
           composed of four complete LIM domains arranged in tandem
           and  an N-terminal single zinc finger domain with a
           consensus sequence equivalent to the C-terminal half of
           a LIM domain. LIMPETin is an exception, containing six
           LIM domains. FHL1, 2 and 3 are predominantly expressed
           in muscle tissues, and FHL5 is highly expressed in male
           germ cells.  FHL proteins exert their roles as
           transcription co-activators or co-repressors through a
           wide array of interaction partners. For example, FHL1
           binds to Myosin-binding protein C, regulating myosin
           filament formation and sarcomere assembly. FHL2 has
           shown to interact with more than 50 different proteins,
           including receptors, structural proteins, transcription
           factors and cofactors, signal transducers, splicing
           factors, DNA replication and repair enzymes, and
           metabolic enzymes. FHL3 int eracts with many
           transcription factors, such as CREB, BKLF/KLF3, CtBP2,
           MyoD, and MZF_1. FHL5 is a tissue-specific coactivator
           of CREB/CREM family transcription factors. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 59

 Score = 28.2 bits (63), Expect = 0.55
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 93  FGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKD 149
           F   CE+C      +   +  K++ +H  CF C  C + LV    FA +++ L C +
Sbjct: 1   FANTCEECKKKIGCDSKDLSYKDRHWHEGCFKCFKCQRSLVD-KPFAAKDEDLLCTE 56


>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1);
           Provisional.
          Length = 1466

 Score = 30.4 bits (68), Expect = 0.64
 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 3/34 (8%)

Query: 148 KDDHEGMDKSSNGENNNNNTNINNNLHNLNNEGS 181
           KD+ E  +K++  +NNNNN N NN    +NN GS
Sbjct: 672 KDNKENNNKNNKDDNNNNNNNNNN---KINNAGS 702


>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin.  The
          third LIM domain of Leupaxin: Leupaxin is a
          cytoskeleton adaptor protein, which is preferentially
          expressed in hematopoietic cells. Leupaxin belongs to
          the paxillin focal adhesion protein family. Same as
          other members of the family, it has four leucine-rich
          LD-motifs in the N-terminus and four LIM domains in the
          C-terminus. It may function in cell type-specific
          signaling by associating with interaction partners
          PYK2, FAK, PEP and p95PKL.  When expressed in human
          leukocytic cells, leupaxin significantly suppressed
          integrin-mediated cell adhesion to fibronectin and the
          tyrosine phosphorylation of paxillin. These findings
          indicate that leupaxin may negatively regulate the
          functions of paxillin during integrin signaling. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 27.9 bits (62), Expect = 0.67
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          C GCG  + + Y+   A +  WH  C  C++C +   +    F  DG+  C+  Y
Sbjct: 1  CSGCGRPVKENYL--SAANGVWHPECFVCSDCLKPFTDGSF-FELDGRPLCELHY 52


>gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM
           domains protein 1 (FHL1).  The third LIM domain of Four
           and a half LIM domains protein 1 (FHL1):  FHL1 is
           heavily expressed in skeletal and cardiac muscles. It
           plays important roles in muscle growth, differentiation,
           and sarcomere assembly by acting as a modulator of
           transcription factors. Defects in FHL1 gene are
           responsible for a number of Muscular dystrophy-like
           muscle disorders. It has been detected that FHL1 binds
           to Myosin-binding protein C, regulating myosin filament
           formation and sarcomere assembly. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 53

 Score = 27.5 bits (61), Expect = 0.73
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 118 YHVQCFCCVVCGKQLVPGDEFALREDGLFCKD 149
           +H +CF C  C K+L  G  F   ED  +C D
Sbjct: 20  WHSECFVCSSCSKKLA-GQRFTAVEDQYYCVD 50


>gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM
           domains protein (FHL).  The third LIM domain of Four and
           a half LIM domains protein (FHL): LIM-only protein
           family consists of five members, designated FHL1, FHL2,
           FHL3, FHL5 and LIMPETin. The first four members are
           composed of four complete LIM domains arranged in tandem
           and an N-terminal single zinc finger domain with a
           consensus sequence equivalent to the C-terminal half of
           a LIM domain. LIMPETin is an exception, containing six
           LIM domains. FHL1, 2 and 3 are predominantly expressed
           in muscle tissues, and FHL5 is highly expressed in male
           germ cells.  FHL proteins exert their roles as
           transcription co-activators or co-repressors through a
           wide array of interaction partners. For example, FHL1
           binds to Myosin-binding protein C, regulating myosin
           filament formation and sarcomere assembly. FHL2 has
           shown to interact with more than 50 different proteins,
           including receptors, structural proteins, transcription
           factors and cofactors, signal transducers, splicing
           factors, DNA replication and repair enzymes, and
           metabolic enzymes. FHL3 int eracts with many
           transcription factors, such as CREB, BKLF/KLF3, CtBP2,
           MyoD, and MZF_1. FHL5 is a tissue-specific coactivator
           of CREB/CREM family transcription factors. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 27.7 bits (62), Expect = 0.76
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 114 KNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKD 149
           +++ +H +CF C  C KQL  G  F  R++  +C D
Sbjct: 16  RDQPWHKECFVCTGCKKQLA-GQRFTSRDEYPYCVD 50


>gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH)
           family.  The third LIM domain of the Enigma Homolog
           (ENH) family: ENH was initially identified in rat brain.
           Same as enigma, it contains three LIM domains at the
           C-terminus and a PDZ domain at N-terminus. ENH is
           implicated in signal transduction processes involving
           protein kinases.  It has also been shown that ENH
           interacts with protein kinase D1 (PKD1) via its LIM
           domains and forms a complex with PKD1 and the alpha1C
           subunit of cardiac L-type voltage-gated calcium channel
           in rat neonatal cardiomyocytes. The N-terminal PDZ
           domain interacts with alpha-actinin at the Z-line. ENH
           is expressed in multiple tissues, such as skeletal
           muscle, heart, bone, and brain. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 55

 Score = 27.6 bits (61), Expect = 0.79
 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 1/52 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           C  C    +  D  + A    +H  CF C VC + L  G  F  ++D   CK
Sbjct: 1   CHGCEFPIEAGDRFLEALGHTWHDTCFVCSVCCESL-EGQTFFSKKDKPLCK 51


>gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin.
           The fifth LIM domain of protein LIMPETin: LIMPETin
           contains 6 LIM domains at the C-terminal and an
           N-terminal PET domain. Four of the six LIM domains are
           highly homologous to the four and half LIM domain
           protein family and two of them show sequence similarity
           to the LIM domains of the testin family. Thus, LIMPETin
           may be the recombinant product of genes coding testin
           and FHL proteins.  In Schistosoma mansoni, where
           LIMPETin was first identified, LIMPETin is down
           regulated in sexually mature adult Schistosoma females
           compared to sexually immature adult females and adult
           male. Its differential expression indicates that it is a
           transcription regulator. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 52

 Score = 27.4 bits (61), Expect = 0.94
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 114 KNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKD 149
           KN+ +H +CF C  C K L  G  F  R++  +C D
Sbjct: 16  KNEPWHRECFTCTNCSKSLA-GQRFTSRDEKPYCAD 50


>gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL.  The LIM domain of RIL:
           RIL contains an N-terminal PDZ domain, a LIM domain, and
           a short consensus C-terminal region. It is the smallest
           molecule in the ALP LIM domain containing protein
           family. RIL was identified in rat fibroblasts and in
           human lymphocytes. The LIM domain interacts with the
           AMPA glutamate receptor in dendritic spines. The
           consensus C-terminus interacts with PTP-BL, a
           submembranous protein tyrosine phosphatase and the PDZ
           domain is responsible to interact with alpha-actinin
           molecules. LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 53

 Score = 27.2 bits (60), Expect = 0.98
 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 110 VMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           +++A++K+YH +CF C  CG  L     F + ++ L+C+
Sbjct: 12  IVKARDKLYHPECFMCDDCGLNLKQRGYFFI-DEQLYCE 49


>gnl|CDD|226305 COG3782, COG3782, Uncharacterized protein conserved in bacteria
           [Function unknown].
          Length = 289

 Score = 29.5 bits (66), Expect = 1.0
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 108 DFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALR-EDGLFCKDDH 151
           DF+ R   K +H++  C    G Q  P D +    ED L  K  H
Sbjct: 113 DFLARLNGKPHHIELACKYYLGHQGGPEDWYGPDPEDRLLGKLAH 157


>gnl|CDD|188828 cd09444, LIM_Mical_like_1, This domain belongs to the LIM domain
           family which are found on Mical (molecule interacting
           with CasL) like proteins.  The LIM domain on proteins of
           unknown function: This domain belongs to the LIM domain
           family which are found on Mical (molecule interacting
           with CasL) like proteins. Known members of the
           Mical-like family includes single LIM domain containing
           proteins, Mical (molecule interacting with CasL), pollen
           specific protein SF3, Eplin, xin actin-binding
           repeat-containing protein 2 (XIRP2), and Ltd-1. The
           members of this family function mainly at the
           cytoskeleton and focal adhesions. They interact with
           transcription factors or other signaling molecules to
           play roles in muscle development, neuronal
           differentiation, cell growth, and mobility.  As in other
           LIM domains, this domain family is 50-60 amino acids in
           size and shares two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 55

 Score = 27.4 bits (61), Expect = 1.1
 Identities = 14/34 (41%), Positives = 16/34 (47%)

Query: 113 AKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLF 146
              K+YH  CF C  C   L+PG   A  E G F
Sbjct: 16  VDGKLYHRNCFRCKECSSTLLPGSYKAGPEPGTF 49


>gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin.  The
          second LIM domain of Leupaxin: Leupaxin is a
          cytoskeleton adaptor protein, which is preferentially
          expressed in hematopoietic cells. Leupaxin belongs to
          the paxillin focal adhesion protein family. Same as
          other members of the family, it has four leucine-rich
          LD-motifs in the N-terminus and four LIM domains in the
          C-terminus. It may function in cell type-specific
          signaling by associating with interaction partners
          PYK2, FAK, PEP and p95PKL.  When expressed in human
          leukocytic cells, leupaxin significantly suppressed
          integrin-mediated cell adhesion to fibronectin and the
          tyrosine phosphorylation of paxillin. These findings
          indicate that leupaxin may negatively regulate the
          functions of paxillin during integrin signaling. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 52

 Score = 27.1 bits (60), Expect = 1.1
 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 5/56 (8%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQ-FLDENCTCFVRDGKTYCKRDY 61
          C  C G I    +   A D  WH     C+ C + F DE      RDGK YC+RD+
Sbjct: 1  CAYCAGPILQNVL--TAMDQTWHPEHFFCSHCGELFGDEGF--LERDGKPYCRRDF 52


>gnl|CDD|187889 cd09759, Cas6_I-A, CRISPR/Cas system-associated RAMP superfamily
           protein Cas6.  CRISPR (Clustered Regularly Interspaced
           Short Palindromic Repeats) and associated Cas proteins
           comprise a system for heritable host defense by
           prokaryotic cells against phage and other foreign DNA;
           Cas6 is an endoribonuclease that generates crRNAs,
           predicted subunit of Cascade complex; RAMP superfamily
           protein; Possesses double RRM/ferredoxin fold.
          Length = 240

 Score = 28.9 bits (65), Expect = 1.3
 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 7/36 (19%)

Query: 89  YVRLFGTKCEKCN-----LNFKREDFVMRAKNKIYH 119
           YV  +G+K EK N     LNFK +    R K   YH
Sbjct: 170 YVEFYGSKPEKSNFEMEVLNFKPKRI--RIKPDTYH 203


>gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma
          subfamily with unknown function.  The third LIM domain
          of an Enigma subfamily with unknown function: The
          Enigma LIM domain family is comprised of three
          characterized members: Enigma, ENH, and Cypher
          (mouse)/ZASP (human). These subfamily members contain a
          single PDZ domain at the N-terminus and three LIM
          domains at the C-terminus. They serve as adaptor
          proteins, where the PDZ domain tethers the protein to
          the cytoskeleton and the LIM domains, recruit signaling
          proteins to implement corresponding functions. The
          members of the enigma family have been implicated in
          regulating or organizing cytoskeletal structure, as
          well as involving multiple signaling pathways. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 54

 Score = 26.7 bits (59), Expect = 1.4
 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYCK 58
          CV CG  I        A +  +H+ C  C  C+  L E  + + + G+ +CK
Sbjct: 1  CVSCGFPIEAGDRWVEALNNNYHSQCFNCTRCNVNL-EGQSFYAKGGRPFCK 51



 Score = 26.0 bits (57), Expect = 3.2
 Identities = 18/52 (34%), Positives = 21/52 (40%), Gaps = 1/52 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           C  C    +  D  + A N  YH QCF C  C   L  G  F  +    FCK
Sbjct: 1   CVSCGFPIEAGDRWVEALNNNYHSQCFNCTRCNVNL-EGQSFYAKGGRPFCK 51


>gnl|CDD|219500 pfam07655, Secretin_N_2, Secretin N-terminal domain.  This is a
           short domain found in bacterial type II/III secretory
           system proteins. The architecture of these proteins
           suggest that this family may be functionally analogous
           to pfam03958.
          Length = 95

 Score = 27.7 bits (62), Expect = 1.5
 Identities = 6/28 (21%), Positives = 18/28 (64%)

Query: 157 SSNGENNNNNTNINNNLHNLNNEGSNSG 184
           S +   +N++++ +N+ +  ++  S+SG
Sbjct: 25  SVSSSGSNSSSSSSNSSNGGSSSSSSSG 52


>gnl|CDD|188806 cd09422, LIM1_FHL2, The first LIM domain of Four and a half LIM
           domains protein 2 (FHL2).  The first LIM domain of Four
           and a half LIM domains protein 2 (FHL2):  FHL2 is one of
           the best studied FHL proteins. FHL2 expression is most
           abundant in the heart, and in brain, liver and lung at
           lesser extent. FHL2 participates in a wide range of
           cellular processes, such as transcriptional regulation,
           signal transduction, and cell survival by binding to
           various protein partners. FHL2 has shown to interact
           with more than 50 different proteins, including
           receptors, structural proteins, transcription factors
           and cofactors, signal transducers, splicing factors, DNA
           replication and repair enzymes, and metabolic enzymes.
           Although FHL2 is abundantly expressed in heart, the fhl2
           null mice are viable and had no detectable abnormal
           cardiac phenotype. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 62

 Score = 26.8 bits (59), Expect = 1.5
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 1/57 (1%)

Query: 93  FGTKCEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCKD 149
           +   CE+C      +   +  K++ +H  CF C  C   LV    FA +E+ L C +
Sbjct: 1   YSNTCEECKKPIGCDCKDLSYKDRHWHESCFHCFQCKNSLV-DKPFAAKEEHLLCTE 56


>gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase
          domains protein (Ltd-1).  The LIM domain of LIM and
          transglutaminase domains protein (Ltd-1): This family
          includes mouse Ky protein and Caenorhabditis elegans
          Ltd-1 protein. The members of this family consists a
          N-terminal  Lim domain and a C-terminal
          transglutaminase domain. The mouse Ky protein has
          putative function in muscle development. The mouse with
          ky mutant exhibits combined posterior and lateral
          curvature of the spine. The Ltd-1 gene in C. elegans is
          expressed in developing hypodermal cells from the
          twofold stage embryo through adulthood. These data
          define the ltd-1 gene as a novel marker for C. elegans
          epithelial cell development. As in other LIM domains,
          this domain family is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 55

 Score = 26.6 bits (59), Expect = 1.6
 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%)

Query: 28 WHAACLRCAECHQFLDENCTCFVR-DGKTYCKRD 60
          +H  C +C EC   L      FV+ DG+ YC R 
Sbjct: 21 YHKGCFKCRECGTRLSLKTFTFVQGDGEVYCARH 54


>gnl|CDD|188822 cd09438, LIM3_Ajuba_like, The third LIM domain of Ajuba-like
           proteins.  The third LIM domain of Ajuba-like proteins:
           Ajuba like LIM protein family includes three highly
           homologous proteins Ajuba, Limd1, and WTIP. Members of
           the family contain three tandem C-terminal LIM domains
           and a proline-rich N-terminal region. This family of
           proteins functions as scaffolds, participating in the
           assembly of numerous protein complexes. In the
           cytoplasm, Ajuba binds Grb2 to modulate serum-stimulated
           ERK activation. Ajuba also recruits the TNF
           receptor-associated factor 6 (TRAF6) to p62 and
           activates PKCKappa activity. Ajuba interacts with
           alpha-catenin and F-actin to contribute to the formation
           or stabilization of adheren junctions by linking
           adhesive receptors to the actin cytoskeleton. Although
           Ajuba is a cytoplasmic protein, it can shuttle into the
           nucleus. In nucleus, Ajuba functions as a corepressor
           for the zinc finger-protein Snail. It binds to the SNAG
           repression domain of Snail through its LIM region.
           Arginine methyltransferase-5 (Prmt5), a protein in the
           complex, is recruited to Snai l through an interaction
           with Ajuba. This ternary complex functions to repress
           E-cadherin, a Snail target gene. In addition, Ajuba
           contains functional nuclear-receptor interacting motifs
           and selectively interacts with retinoic acid receptors
           (RARs) and rexinoid receptor (RXRs) to negatively
           regulate retinoic acid signaling. Wtip, the
           Wt1-interacting protein, was originally identified as an
           interaction partner of the Wilms tumour protein 1 (WT1).
           Wtip is involved in kidney and neural crest development.
           Wtip interacts with the receptor tyrosine kinase Ror2
           and inhibits canonical Wnt signaling. LIMD1 was reported
           to inhibit cell growth and metastases. The inhibition
           may be mediated through an interaction with the protein
           barrier-to-autointegration (BAF), a component of SWI/SNF
           chromatin-remodeling protein; or through the interaction
           with retinoblastoma protein (pRB), resulting in
           inhibition of E2F-mediated transcription, and expression
           of the majority of genes with E2F1- responsive elements.
           Recently, Limd1 was shown to interact with the
           p62/sequestosome protein and influence IL-1 and RANKL
           signaling by facilitating the assembly of a
           p62/TRAF6/a-PKC multi-protein complex. The Limd1-p62
           interaction affects both NF-kappaB and AP-1 activity in
           epithelial cells and osteoclasts. Moreover, LIMD1
           functions as tumor repressor to block lung tumor cell
           line in vitro and in vivo. Recent studies revealed that
           LIM proteins Wtip, LIMD1 and Ajuba interact with
           components of RNA induced silencing complexes (RISC) as
           well as eIF4E and the mRNA m7GTP cap-protein complex and
           are required for microRNA-mediated gene silencing.  As
           in other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 62

 Score = 26.6 bits (59), Expect = 2.0
 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 2/39 (5%)

Query: 115 NKIYHVQCFCCVVCGKQLV--PGDEFALREDGLFCKDDH 151
           +K YHV+C+ C  CG QL    G      +  L C   H
Sbjct: 24  DKDYHVECYHCEDCGLQLNDEEGHRCYPLDGHLLCHSCH 62


>gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin.  The
          first LIM domain of paxillin: Paxillin is an adaptor
          protein, which recruits key components of the
          signal-transduction machinery to specific sub-cellular
          locations to respond to environmental changes rapidly.
          The C-terminal region of paxillin contains four LIM
          domains which target paxillin to focal adhesions,
          presumably through a direct association with the
          cytoplasmic tail of beta-integrin. The N-terminal of
          paxillin is leucine-rich LD-motifs. Paxillin is found
          at the interface between the plasma membrane and the
          actin cytoskeleton. The binding partners of paxillin
          are diverse and include protein tyrosine kinases, such
          as Src and FAK, structural proteins, such as vinculin
          and actopaxin, and regulators of actin organization.
          Paxillin recruits these proteins to their function
          sites to control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight cons erved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 54

 Score = 26.5 bits (58), Expect = 2.0
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%)

Query: 28 WHAACLRCAECHQFLDENCTCFVRDGKTYCKRDY 61
          WH     C  C + +      F RDG+ YC++DY
Sbjct: 21 WHPEHFVCTHCQEEIGSR-NFFERDGQPYCEKDY 53


>gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH.  The
           second LIM domain of protein PINCH: PINCH plays a
           pivotal role in the assembly of focal adhesions (FAs),
           regulating diverse functions in cell adhesion, growth,
           and differentiation through LIM-mediated protein-protein
           interactions. PINCH comprises an array of five LIM
           domains that interact with integrin-linked kinase (ILK),
           Nck2 (also called Nckbeta or Grb4) and other interaction
           partners.  These interactions are essential for
           triggering the FA assembly and for relaying diverse
           mechanical and biochemical signals between
           Cell-extracellular matrix and the actin cytoskeleton.
           LIM domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 26.1 bits (58), Expect = 2.7
 Identities = 10/23 (43%), Positives = 15/23 (65%)

Query: 110 VMRAKNKIYHVQCFCCVVCGKQL 132
           V++A N  +H  CF C +C K+L
Sbjct: 12  VIKAMNNNWHPDCFRCEICNKEL 34


>gnl|CDD|188870 cd09486, LIM_Eplin_like_1, a LIM domain subfamily on a group of
           proteins with unknown function.  This model represents a
           LIM domain subfamily of Eplin-like family.  This family
           shows highest homology to the LIM domains on Eplin and
           XIRP2 protein families. Epithelial Protein Lost in
           Neoplasm is a cytoskeleton-associated tumor suppressor
           whose expression inversely correlates with cell growth,
           motility, invasion and cancer mortality. Xirp2 is
           expressed in muscles and is an important effector of the
           Ang II signaling pathway in the heart. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 26.1 bits (57), Expect = 2.9
 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%)

Query: 113 AKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           A   ++H  CFCC  C  +L  G  +A      +CK
Sbjct: 16  ADKLVFHNSCFCCKHCNAKLSLG-SYAALHGEFYCK 50


>gnl|CDD|188728 cd09342, LIM3_Testin_like, The third LIM domain of Testin-like
           family.  The third LIM domain of Testin_like family:
           This family includes testin, prickle, dyxin and
           LIMPETin. Structurally, testin and prickle proteins
           contain three LIM domains at C-terminal; LIMPETin has
           six LIM domains; and dyxin presents only two LIM
           domains. However, all members of the family contain a
           PET protein-protein interaction domain. Testin is a
           cytoskeleton associated focal adhesion protein that
           localizes along actin stress fibers, at
           cell-cell-contact areas, and at focal adhesion plaques.
           Testin interacts with a variety of cytoskeletal
           proteins, including zyxin, mena, VASP, talin, and actin
           and it is involved in cell motility and adhesion events.
           Prickles have been implicated in roles of regulating
           tissue polarity or planar cell polarity (PCP).  Dyxin
           involves in lung and heart development by interaction
           with GATA6 and blocking GATA6 activated target genes.
           LIMPETin might be the recombinant product of genes
           coding testin and four and half LIM proteins and its
           function is not well understood. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 57

 Score = 25.8 bits (57), Expect = 3.1
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%)

Query: 121 QCFCCVVCGKQLVPGDEFALREDGLFC 147
           +CFCC  C K L+ G  F  +   +FC
Sbjct: 27  ECFCCSNCKKSLL-GQPFLPKNGQIFC 52


>gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher
           family.  The third LIM domain of ZASP/Cypher family:
           ZASP was identified in human heart and skeletal muscle
           and Cypher is a mice ortholog of ZASP. ZASP/Cyppher
           contains three LIM domains at the C-terminus and a PDZ
           domain at N-terminus.  ZASP/Cypher is required for
           maintenance of Z-line structure during muscle
           contraction, but not required for Z-line assembly. In
           heart, Cypher/ZASP plays a structural role through its
           interaction with cytoskeletal Z-line proteins. In
           addition, there is increasing evidence that Cypher/ZASP
           also performs signaling functions. Studies reveal that
           Cypher/ZASP interacts with and directs PKC to the
           Z-line, where PKC phosphorylates downstream signaling
           targets. LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 55

 Score = 26.2 bits (57), Expect = 3.2
 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 1/52 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           C  C+   +  D  + A    +H  CF C VC   L  G  F  ++D   CK
Sbjct: 1   CHGCDFPVEAGDKFIEALGHTWHDTCFICAVCHVNL-EGQPFYSKKDKPLCK 51


>gnl|CDD|188780 cd09394, LIM1_Rga, The first LIM domain of  Rga GTPase-Activating
          Proteins.  The first LIM domain of  Rga
          GTPase-Activating Proteins: The members of this family
          contain two tandem repeats of LIM domains and a
          Rho-type GTPase activating protein (RhoGap) domain. Rga
          activates GTPases during polarized morphogenesis. In
          yeast, a known regulating target of Rga is  CDC42p, a
          small GTPase. The LIM domain is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 55

 Score = 25.8 bits (57), Expect = 3.5
 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECHQFLD 43
          CVGC   I + +   +  D  WH  C +C +C + L 
Sbjct: 1  CVGCKESITEGHAYELGGDR-WHIHCFKCYKCDKKLS 36


>gnl|CDD|193533 cd05657, M42_glucanase_like, M42 Peptidase, Endoglucanase-like
           subfamily.  Peptidase M42 family, glucanase (endo-1
           4-beta-glucanase or endoglucanase)-like subfamily.
           Proteins in this subfamily are co-catalytic
           metallopeptidases, found in archaea and bacteria. They
           show similarity to cellulase and endo-1,4-beta-glucanase
           (endoglucanase) which typically bind two zinc or cobalt
           atoms. Some of the enzymes exhibit typical
           aminopeptidase specificity, whereas others are also
           capable of N-terminal deblocking activity, i.e.
           hydrolyzing acylated N-terminal residues. Many of these
           enzymes are assembled either as tetrahedral dodecamers
           or as octahedral tetracosameric structures, with the
           active site located on the inside such that substrate
           sizes are limited, indicating function as possible
           peptide scavengers.
          Length = 336

 Score = 27.9 bits (63), Expect = 3.8
 Identities = 9/13 (69%), Positives = 9/13 (69%)

Query: 44  ENCTCFVRDGKTY 56
           ENCT   RDGK Y
Sbjct: 96  ENCTIHTRDGKVY 108



 Score = 27.9 bits (63), Expect = 3.8
 Identities = 9/13 (69%), Positives = 9/13 (69%)

Query: 72  ENCTCFVRDGKTY 84
           ENCT   RDGK Y
Sbjct: 96  ENCTIHTRDGKVY 108


>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK;
           Provisional.
          Length = 1019

 Score = 28.0 bits (63), Expect = 3.8
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 16/64 (25%)

Query: 30  AACLRCAECHQFLDENCTCFVRDGKTY--------CKRDYVSSEKNQFLDENCTCFVR-D 80
           A C  C  C QF      C   +GK Y         + D+ +S    FL E+    VR +
Sbjct: 926 AMCNECGNCAQF------C-PWNGKPYKDKITLFSLEEDFENSTNPGFLVEDGRVRVRLN 978

Query: 81  GKTY 84
           G+++
Sbjct: 979 GQSW 982


>gnl|CDD|176412 cd01817, RGS12_RBD, Ubiquitin domain of RGS12 and RGS14.  RGS12
           (regulator of G signalling 12), and RGS14, are members
           of a family of GTPase-activating proteins (GAP's)
           specific for the G-alpha subunit, which act as key
           inhibitors of G-protein-mediated cell responses in
           eukaryotes.  Their domain architecture includes tandem
           RBD domains as well as  PDZ , PTB, and RGS, and GoLoco
           domains.
          Length = 73

 Score = 26.2 bits (58), Expect = 4.0
 Identities = 8/37 (21%), Positives = 17/37 (45%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLV 133
           CEK  +N+   D  +   +K   +     V+ G+++ 
Sbjct: 30  CEKRGINYAAVDLFLVGGDKPLVLDQDSSVLAGQEVR 66


>gnl|CDD|240427 PTZ00470, PTZ00470, glycoside hydrolase family 47 protein;
           Provisional.
          Length = 522

 Score = 27.8 bits (62), Expect = 4.1
 Identities = 8/30 (26%), Positives = 16/30 (53%)

Query: 155 DKSSNGENNNNNTNINNNLHNLNNEGSNSG 184
             ++  +N NNN N NN +++ N   + + 
Sbjct: 10  VHNNADDNYNNNNNNNNQINSNNPNNNGNN 39



 Score = 27.0 bits (60), Expect = 6.5
 Identities = 12/34 (35%), Positives = 17/34 (50%)

Query: 149 DDHEGMDKSSNGENNNNNTNINNNLHNLNNEGSN 182
             H   D + N  NNNNN   +NN +N  N  ++
Sbjct: 9   SVHNNADDNYNNNNNNNNQINSNNPNNNGNNQAS 42


>gnl|CDD|218851 pfam06007, PhnJ, Phosphonate metabolism protein PhnJ.  This family
           consists of several bacterial phosphonate metabolism
           (PhnJ) sequences. The exact role that PhnJ plays in
           phosphonate utilisation is unknown.
          Length = 279

 Score = 27.6 bits (62), Expect = 4.2
 Identities = 6/17 (35%), Positives = 7/17 (41%)

Query: 28  WHAACLRCAECHQFLDE 44
           +   C  C     FLDE
Sbjct: 235 FDDPCALCGSTDSFLDE 251


>gnl|CDD|232844 TIGR00143, hypF, [NiFe] hydrogenase maturation protein HypF.  A
           previously described regulatory effect of HypF
           mutatation is attributable to loss of activity of a
           regulatory hydrogenase. A zinc finger-like region
           CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported
           the regulatory hypothesis. However, more recent work
           (PUBMED:11375153) shows the direct effect is on the
           activity of expressed hydrogenases with nickel/iron
           centers, rather than on expression [Protein fate,
           Protein modification and repair].
          Length = 711

 Score = 27.8 bits (62), Expect = 4.2
 Identities = 17/75 (22%), Positives = 24/75 (32%), Gaps = 24/75 (32%)

Query: 95  TKCEKCN--------LNFKREDFVMRA--------------KNKIYHVQCFCCVVCGKQL 132
             C  C         L + RE+  M                 ++ +H Q   C  CG QL
Sbjct: 91  ISCTHCGPRFTIIEALPYDRENTSMADFPLCPDCAKEYKDPLDRRFHAQPIACPRCGPQL 150

Query: 133 --VPGDEFALREDGL 145
             V     A ++D L
Sbjct: 151 NFVSRGGHAEQDDAL 165


>gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial Protein
           Lost in Neoplasm (Eplin).  The Lim domain of Epithelial
           Protein Lost in Neoplasm (Eplin): Epithelial Protein
           Lost in Neoplasm is a cytoskeleton-associated tumor
           suppressor whose expression inversely correlates with
           cell growth, motility, invasion and cancer mortality.
           Eplin interacts and stabilizes F-actin filaments and
           stress fibers, which correlates with its ability to
           suppress anchorage independent growth. In epithelial
           cells, Eplin is required for formation of the F-actin
           adhesion belt by binding to the E-cadherin-catenin
           complex through alpha-catenin. Eplin is expressed in two
           isoforms, a longer Eplin-beta and a shorter Eplin-alpha.
           Eplin-alpha mRNA is detected in various tissues and cell
           lines, but is absent or down regulated in cancer cells.
           As in other LIM domains, this domain family is 50-60
           amino acids in size and shares two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 53

 Score = 25.6 bits (56), Expect = 4.6
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 113 AKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           A  +IYH  CF C  C  +L  G  +A     ++CK
Sbjct: 16  ANQQIYHNSCFRCSYCNTKLSLGT-YASLHGNIYCK 50


>gnl|CDD|188781 cd09395, LIM2_Rga, The second LIM domain of  Rga
          GTPase-Activating Proteins.  The second LIM domain of
          Rga GTPase-Activating Proteins: The members of this
          family contain two tandem repeats of LIM domains and a
          Rho-type GTPase activating protein (RhoGap) domain. Rga
          activates GTPases during polarized morphogenesis. In
          yeast, a known regulating target of Rga is CDC42p, a
          small GTPase. The LIM domain is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 53

 Score = 25.5 bits (56), Expect = 4.8
 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%)

Query: 7  CVGCGGQIHDQYILRVAPDLEWHAACLRCAECH 39
          C  CG +I D  IL  + D  + + C RC  C 
Sbjct: 1  CKNCGKKIDDTAILL-SSDEAYCSDCFRCRRCS 32


>gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein
          (TLP).  The second LIM domain of thymus LIM protein
          (TLP):  TLP is the distant member of the CRP family of
          proteins. TLP has two isomers (TLP-A and TLP-B) and
          sharing approximately 30% with each of the three other
          CRPs.  Like CRP1, CRP2 and CRP3/MLP, TLP has two LIM
          domains, connected by a flexible linker region. Unlike
          the CRPs, TLP lacks the nuclear targeting signal
          (K/R-K/R-Y-G-P-K) and is localized solely in the
          cytoplasm. TLP is specifically expressed in the thymus
          in a subset of cortical epithelial cells. TLP has a
          role in development of normal thymus and in controlling
          the development and differentiation of thymic
          epithelial cells. LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 54

 Score = 25.4 bits (55), Expect = 5.4
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 4/52 (7%)

Query: 7  CVGCGGQIH-DQYILRVAPDLEWHAACLRCAECHQFLDENCTCFVRDGKTYC 57
          C GCG  ++  + ++ +  +  WH  CLRC  C + L         DG  YC
Sbjct: 1  CPGCGKPVYFAEKVMSLGRN--WHRPCLRCQRCKKTLTAGGHA-EHDGSPYC 49


>gnl|CDD|177395 PHA02565, 49, recombination endonuclease VII; Provisional.
          Length = 157

 Score = 26.6 bits (59), Expect = 5.5
 Identities = 6/22 (27%), Positives = 11/22 (50%)

Query: 113 AKNKIYHVQCFCCVVCGKQLVP 134
            K K++  Q   C +C ++L  
Sbjct: 11  EKQKLFEAQNGICPLCKRELDG 32


>gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM
          and RhoGap domain containing protein.  The third LIM
          domain of Lrg1p, a LIM and RhoGap domain containing
          protein: The members of this family contain three
          tandem repeats of LIM domains and a Rho-type GTPase
          activating protein (RhoGap) domain. Lrg1p is a Rho1
          GTPase-activating protein required for efficient cell
          fusion in yeast. Lrg1p-GAP domain strongly and
          specifically stimulates the GTPase activity of Rho1p, a
          regulator of beta (1-3)-glucan synthase in vitro. The
          LIM domain is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 56

 Score = 25.4 bits (56), Expect = 5.6
 Identities = 8/35 (22%), Positives = 14/35 (40%), Gaps = 3/35 (8%)

Query: 28 WHAACLRCAECHQFLD---ENCTCFVRDGKTYCKR 59
          WH  C  C+ CH+ +     +     +D +  C  
Sbjct: 20 WHLKCFTCSRCHREISSELSDAAFNNKDQRILCSN 54


>gnl|CDD|218272 pfam04797, Herpes_ORF11, Herpesvirus dUTPase protein.  This family
           of proteins are found in Herpesvirus proteins. This
           family includes proteins called ORF10 and ORF11 amongst
           others. However, these proteins seem to be related to
           other dUTPases pfam00692 suggesting that these proteins
           are also dUTPases (Bateman A pers. obs.).
          Length = 374

 Score = 26.9 bits (60), Expect = 6.9
 Identities = 15/66 (22%), Positives = 20/66 (30%), Gaps = 5/66 (7%)

Query: 43  DENCTCFVRDGKTYC--KRDYVSSEKNQFLDENCTC-FVRDGKTYCKRDYVRLFGTKCEK 99
            E  T +    KT    KR +     +    E C    VR GK Y +         K E 
Sbjct: 165 PETYTPYFLAQKTKPFLKRGFARL--HAEEGEVCPVNAVRLGKNYVRVSVTLPSEAKSET 222

Query: 100 CNLNFK 105
             +   
Sbjct: 223 VLVKVP 228


>gnl|CDD|236304 PRK08581, PRK08581, N-acetylmuramoyl-L-alanine amidase; Validated.
          Length = 619

 Score = 27.1 bits (60), Expect = 7.4
 Identities = 7/38 (18%), Positives = 17/38 (44%)

Query: 149 DDHEGMDKSSNGENNNNNTNINNNLHNLNNEGSNSGKI 186
            D+E    S    N++N  + ++  ++ + + S   K 
Sbjct: 134 SDYEQPRNSEKSTNDSNKNSDSSIKNDTDTQSSKQDKA 171


>gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein Lost
           in Neoplasm (Eplin) like proteins.  The Lim domain of
           Epithelial Protein Lost in Neoplasm (Eplin) like
           proteins: This family contains Epithelial Protein Lost
           in Neoplasm in Neoplasm (Eplin), xin actin-binding
           repeat-containing protein 2 (XIRP2) and a group of
           protein with unknown function.  The members of this
           family all contain a single LIM domain. Epithelial
           Protein Lost in Neoplasm is a cytoskeleton-associated
           tumor suppressor whose expression inversely correlates
           with cell growth, motility, invasion and cancer
           mortality.  Eplin interacts and stabilizes F-actin
           filaments and stress fibers, which correlates with its
           ability to suppress anchorage independent growth. In
           epithelial cells, Eplin is required for formation of the
           F-actin adhesion belt by binding to the
           E-cadherin-catenin complex through alpha-catenin. Eplin
           is expressed in two isoforms, a longer Eplin-beta and a
           shorter Eplin-alpha. Eplin-alpha mRNA is detected in
           various tissues and cell lines, but is absent or down
           regulated in cancer cells. Xirp2 contains a LIM domain
           and Xin re peats for binding to and stabilising F-actin.
           Xirp2 is expressed in muscles and is significantly
           induced in the heart in response to systemic
           administration of angiotensin II. Xirp2 is an important
           effector of the Ang II signaling pathway in the heart.
           The expression of Xirp2 is activated by myocyte enhancer
           factor (MEF)2A, whose  transcriptional activity is
           stimulated by angiotersin II. Thus, Xirp2 plays
           important pathological roles in the angiotensin II
           induced hypertension. As in other LIM domains, this
           domain family is 50-60 amino acids in size and shares
           two characteristic zinc finger motifs. The two zinc
           fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 24.7 bits (54), Expect = 7.4
 Identities = 9/28 (32%), Positives = 14/28 (50%)

Query: 113 AKNKIYHVQCFCCVVCGKQLVPGDEFAL 140
           A  + +H  CF C  C  +L  G+  +L
Sbjct: 16  ADKQNFHKSCFRCEHCNSKLSLGNYASL 43


>gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM
           domains protein (FHL).  The fourth LIM domain of Four
           and a half LIM domains protein (FHL): LIM-only protein
           family consists of five members, designated FHL1, FHL2,
           FHL3, FHL5 and LIMPETin. The first four members are
           composed of four complete LIM domains arranged in tandem
           and an N-terminal single zinc finger domain with a
           consensus sequence equivalent to the C-terminal half of
           a LIM domain. LIMPETin is an exception, containing six
           LIM domains. FHL1, 2 and 3 are predominantly expressed
           in muscle tissues, and FHL5 is highly expressed in male
           germ cells.  FHL proteins exert their roles as
           transcription co-activators or co-repressors through a
           wide array of interaction partners. For example, FHL1
           binds to Myosin-binding protein C, regulating myosin
           filament formation and sarcomere assembly. FHL2 has
           shown to interact with more than 50 different proteins,
           including receptors, structural proteins, transcription
           factors and cofactors, signal transducers, splicing
           factors, DNA replication and repair enzymes, and
           metabolic enzymes. FHL3 interacts with many
           transcription factors, such as CREB, BKLF/KLF3, CtBP2,
           MyoD, and MZF_1. FHL5 is a tissue-specific coactivator
           of CREB/CREM family transcription factors. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 56

 Score = 25.0 bits (55), Expect = 7.7
 Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 1/32 (3%)

Query: 118 YHVQCFCCVVCGKQLVPGDEFALREDGLFCKD 149
           +H  CF C  C   LV G  F  + D + C +
Sbjct: 24  WHSDCFNCGKCSVSLV-GQGFLTQRDEILCPE 54


>gnl|CDD|188842 cd09458, LIM3_Enigma, The third LIM domain of Enigma.  The third
           LIM domain of Enigma: Enigma was initially characterized
           in humans as a protein containing three LIM domains at
           the C-terminus and a PDZ domain at N-terminus.  The
           third LIM domain specifically interacts with the insulin
           receptor and the second LIM domain interacts with the
           receptor tyrosine kinase Ret and the adaptor protein
           APS.  Thus Enigma is implicated in signal transduction
           processes such as mitogenic activity, insulin related
           actin organization, and glucose metabolism. Enigma is
           expressed in multiple tissues, such as skeletal muscle,
           heart, bone, and brain.  LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 55

 Score = 25.0 bits (54), Expect = 7.9
 Identities = 15/52 (28%), Positives = 21/52 (40%), Gaps = 1/52 (1%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFCK 148
           C  C+      D  + A    +H  CF C +C   L  G  F  ++D   CK
Sbjct: 1   CHGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINL-EGKTFYSKKDKPLCK 51


>gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal
          Protein (CRIP).  The LIM domain of Cysteine-Rich
          Intestinal Protein (CRIP): CRIP is a short protein with
          only one LIM domain. CRIP gene is developmentally
          regulated and can be induced by glucocorticoid hormones
          during the first three postnatal weeks. The domain
          shows close sequence homology to LIM domain of thymus
          LIM protein. However, unlike the TLP proteins which
          have two LIM domains, the members of this family have
          only one LIM domain. LIM domains are 50-60 amino acids
          in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 24.8 bits (54), Expect = 8.0
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%)

Query: 27 EWHAACLRCAECHQFLDENCTCFVRDGKTYC 57
          +WH  CL+C +C + L         DGK YC
Sbjct: 20 DWHRPCLKCEKCGKTLTPGSHA-EHDGKPYC 49


>gnl|CDD|237510 PRK13795, PRK13795, hypothetical protein; Provisional.
          Length = 636

 Score = 26.9 bits (60), Expect = 8.2
 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 12/46 (26%)

Query: 2   RRLSLCVGCG--------GQIH-DQYILRVAPDLEWHAACLRCAEC 38
           RR + CVGCG        G I  ++   +++ D E    C+ C +C
Sbjct: 578 RRAAECVGCGVCVGACPTGAIRIEEGKRKISVDEE---KCIHCGKC 620


>gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM
           domains protein 2 (FHL2).  The third LIM domain of Four
           and a half LIM domains protein 2 (FHL2):  FHL2 is one of
           the best studied FHL proteins. FHL2 expression is most
           abundant in the heart, and in brain, liver and lung to a
           lesser extent. FHL2 participates in a wide range of
           cellular processes, such as transcriptional regulation,
           signal transduction, and cell survival by binding to
           various protein partners. FHL2 has shown to interact
           with more than 50 different proteins, including
           receptors, structural proteins, transcription factors
           and cofactors, signal transducers, splicing factors, DNA
           replication and repair enzymes, and metabolic enzymes.
           Although FHL2 is abundantly expressed in heart, the fhl2
           null mice are viable and had no detectable abnormal
           cardiac phenotype. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to s upport the assembly of multimeric protein
           complexes.
          Length = 57

 Score = 25.0 bits (54), Expect = 8.8
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 114 KNKIYHVQCFCCVVCGKQLVPGDEFALREDGLFC 147
           +++ +H +CF C  C KQL  G  F  R+D  +C
Sbjct: 16  RDQPWHKECFVCTGCKKQL-SGQRFTSRDDFAYC 48


>gnl|CDD|223146 COG0068, HypF, Hydrogenase maturation factor [Posttranslational
           modification, protein turnover, chaperones].
          Length = 750

 Score = 26.6 bits (59), Expect = 9.9
 Identities = 10/36 (27%), Positives = 14/36 (38%), Gaps = 6/36 (16%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQL 132
           C  C+  +K         N+ +H Q   C  CG  L
Sbjct: 154 CPFCDKEYKD------PLNRRFHAQPIACPKCGPHL 183


>gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated
           LIM protein) family.  This family represents the LIM
           domain of ALP (actinin-associated LIM protein) family.
           Four proteins: ALP, CLP36, RIL, and Mystique have been
           classified into the ALP subfamily of LIM domain
           proteins. Each member of the subfamily contains an
           N-terminal PDZ domain and a C-terminal LIM domain.
           Functionally, these proteins bind to alpha-actinin
           through their PDZ domains and bind or other signaling
           molecules through their LIM domains. ALP proteins have
           been implicated in cardiac and skeletal muscle
           structure, function and disease, platelet, and
           epithelial cell motility. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 52

 Score = 24.3 bits (53), Expect = 10.0
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%)

Query: 97  CEKCNLNFKREDFVMRAKNKIYHVQCFCCVVCGKQL 132
           C+KC         V++A++K  H +CF C  CG  L
Sbjct: 1   CDKCGNGIV--GVVVKARDKNRHPECFVCADCGLNL 34


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.324    0.140    0.463 

Gapped
Lambda     K      H
   0.267   0.0729    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 9,230,358
Number of extensions: 799206
Number of successful extensions: 1628
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1532
Number of HSP's successfully gapped: 307
Length of query: 191
Length of database: 10,937,602
Length adjustment: 91
Effective length of query: 100
Effective length of database: 6,901,388
Effective search space: 690138800
Effective search space used: 690138800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 56 (25.3 bits)