Query         psy4075
Match_columns 67
No_of_seqs    82 out of 84
Neff          2.8 
Searched_HMMs 46136
Date          Sat Aug 17 00:41:58 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4075.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4075hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4109|consensus               99.5 5.1E-15 1.1E-19  100.7   2.4   38   30-67     52-89  (116)
  2 PF05186 Dpy-30:  Dpy-30 motif;  98.7 1.7E-08 3.7E-13   57.4   3.0   25   43-67      1-25  (42)
  3 KOG4109|consensus               67.8     1.7 3.7E-05   30.0  -0.0   27   41-67      4-30  (116)
  4 PF11414 Suppressor_APC:  Adeno  47.3      11 0.00024   24.1   1.1   14   54-67     17-30  (84)
  5 PF12460 MMS19_C:  RNAPII trans  23.8      66  0.0014   24.3   2.1   23   39-61    351-375 (415)
  6 PF11210 DUF2996:  Protein of u  22.4      95  0.0021   21.4   2.5   22   41-62      4-25  (119)
  7 PF09230 DFF40:  DNA fragmentat  22.2      67  0.0015   24.4   1.9   18   50-67    171-188 (230)
  8 PF02985 HEAT:  HEAT repeat;  I  21.9      60  0.0013   16.0   1.1   10   52-61      1-10  (31)
  9 PF10941 DUF2620:  Protein of u  19.7      61  0.0013   22.4   1.1   12   50-61    106-117 (117)
 10 PF03130 HEAT_PBS:  PBS lyase H  17.8 1.2E+02  0.0027   14.7   1.8   13   49-61     14-26  (27)

No 1  
>KOG4109|consensus
Probab=99.52  E-value=5.1e-15  Score=100.68  Aligned_cols=38  Identities=55%  Similarity=0.919  Sum_probs=35.7

Q ss_pred             CCCCCCCCCCCCchhHHHHhhhHHHHHHHHHHHHhhcC
Q psy4075          30 PGLKKPRLDLHALPTRQYLDQTVVPILLAALTQLTKER   67 (67)
Q Consensus        30 ~~~~~~~~~l~sLP~RqYLdqTVVPiLLqGL~~LaKER   67 (67)
                      +..++++.+++++|+|||||+||+||||+||.+|||+|
T Consensus        52 a~~~k~k~~v~~~ptRqYLdqtVaPiLL~Gm~~lA~~r   89 (116)
T KOG4109|consen   52 ANQQKPKEDVNSMPTRQYLDQTVAPILLQGMAALAKER   89 (116)
T ss_pred             hhhcCccccccCCchhhhcccchhHHHHHHHHHHHhhC
Confidence            44579999999999999999999999999999999998


No 2  
>PF05186 Dpy-30:  Dpy-30 motif;  InterPro: IPR007858 This motif is about 40 residues long and is probably formed of two alpha-helices. It is found in the Dpy-30 proteins, hence the motifs name. Dpy-30 from Caenorhabditis elegans is an essential component of dosage compensation machinery and loss of dpy-30 activity results in XX-specific lethality; in XO animals, Dpy-30 is required for developmental processes other than dosage compensation []. In yeast, the homologue of DPY-30, Saf19p, functions as part of the Set1 complex that is necessary for the methylation of histone H3 at lysine residue 4; Set1 is a key part of epigenetic developmental control []. There is also a human homologue of Dpy-30 []. This Dpy-30 region may be a dimerisation motif analogous that found in the cAMP-dependent protein kinase regulator, type II PKA, R subunit IPR003117 from INTERPRO.; PDB: 3G36_D.
Probab=98.68  E-value=1.7e-08  Score=57.37  Aligned_cols=25  Identities=56%  Similarity=0.913  Sum_probs=22.6

Q ss_pred             hhHHHHhhhHHHHHHHHHHHHhhcC
Q psy4075          43 PTRQYLDQTVVPILLAALTQLTKER   67 (67)
Q Consensus        43 P~RqYLdqTVVPiLLqGL~~LaKER   67 (67)
                      |.|+||+++|+|+|.+||.+++|+|
T Consensus         1 p~r~YL~~~v~p~L~~gL~~l~~~r   25 (42)
T PF05186_consen    1 PARQYLKETVGPVLTEGLAELAKER   25 (42)
T ss_dssp             -HHHHHHHHTHHHHHHHHHHHHHH-
T ss_pred             CHHHHHHHHhHHHHHHHHHHHHHHC
Confidence            7899999999999999999999997


No 3  
>KOG4109|consensus
Probab=67.81  E-value=1.7  Score=29.96  Aligned_cols=27  Identities=30%  Similarity=0.612  Sum_probs=23.8

Q ss_pred             CchhHHHHhhhHHHHHHHHHHHHhhcC
Q psy4075          41 ALPTRQYLDQTVVPILLAALTQLTKER   67 (67)
Q Consensus        41 sLP~RqYLdqTVVPiLLqGL~~LaKER   67 (67)
                      +-|-|+|++..+-|.|+.|++.+|+-|
T Consensus         4 ~~pa~~~~~~~et~~l~ng~s~~a~n~   30 (116)
T KOG4109|consen    4 SSPARQYLPEAETPVLLNGMSIAARNP   30 (116)
T ss_pred             cccccccCccccchhhhhhhhhhccCC
Confidence            457799999999999999999998754


No 4  
>PF11414 Suppressor_APC:  Adenomatous polyposis coli tumour suppressor protein; PDB: 1M5I_A.
Probab=47.26  E-value=11  Score=24.09  Aligned_cols=14  Identities=36%  Similarity=0.517  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHhhcC
Q psy4075          54 PILLAALTQLTKER   67 (67)
Q Consensus        54 PiLLqGL~~LaKER   67 (67)
                      -+||+||+.+.|+|
T Consensus        17 d~LLqgLe~~Er~r   30 (84)
T PF11414_consen   17 DVLLQGLEMEERER   30 (84)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHhHHHHHHHHH
Confidence            47999999999876


No 5  
>PF12460 MMS19_C:  RNAPII transcription regulator C-terminal;  InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins. MMS19 is required for both nucleotide excision repair (NER) and RNA polymerase II (RNAP II) transcription [].
Probab=23.80  E-value=66  Score=24.31  Aligned_cols=23  Identities=35%  Similarity=0.668  Sum_probs=17.2

Q ss_pred             CCCchhHHHHh--hhHHHHHHHHHH
Q psy4075          39 LHALPTRQYLD--QTVVPILLAALT   61 (67)
Q Consensus        39 l~sLP~RqYLd--qTVVPiLLqGL~   61 (67)
                      ++.+|..-|+.  .+++|+|+|+|.
T Consensus       351 l~~vP~~vl~~~l~~LlPLLlqsL~  375 (415)
T PF12460_consen  351 LKNVPKSVLLPELPTLLPLLLQSLS  375 (415)
T ss_pred             HhhCCHHHHHHHHHHHHHHHHHHhC
Confidence            45667666665  379999999985


No 6  
>PF11210 DUF2996:  Protein of unknown function (DUF2996);  InterPro: IPR021374  This family of proteins has no known function. 
Probab=22.39  E-value=95  Score=21.43  Aligned_cols=22  Identities=23%  Similarity=0.517  Sum_probs=19.3

Q ss_pred             CchhHHHHhhhHHHHHHHHHHH
Q psy4075          41 ALPTRQYLDQTVVPILLAALTQ   62 (67)
Q Consensus        41 sLP~RqYLdqTVVPiLLqGL~~   62 (67)
                      .=|..+|+++-++|-|-++|+.
T Consensus         4 dKPF~efi~ed~lPaL~~~l~~   25 (119)
T PF11210_consen    4 DKPFPEFIEEDFLPALKKALEK   25 (119)
T ss_pred             CCCHHHHHHHhhhHHHHHHHHH
Confidence            3488999999999999999875


No 7  
>PF09230 DFF40:  DNA fragmentation factor 40 kDa;  InterPro: IPR015311 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. DNA fragmentation factor (DFF) is a complex of the DNase DFF40 (CAD) and its chaperone/inhibitor DFF45 (ICAD-L). In its inactive form, DFF is a heterodimer composed of a 45kDa chaperone inhibitor subunit (DFF45 or ICAD), and a 40kDa latent endonuclease subunit (DFF40 or CAD). Upon caspase-3 cleavage of DFF45, DFF40 forms active endonuclease homo-oligomers. It is activated during apoptosis to induce DNA fragmentation. DNA binding by DFF is mediated by the nuclease subunit, which can also form stable DNA complexes after release from DFF [, ]. The nuclease subunit is inhibited in DNA cleavage but not in DNA binding []. DFF45 can also be cleaved and inactivated by caspase-7 but not by caspase-6 and caspase-8. The cleaved DFF45 fragments dissociate from DFF40, allowing DFF40 to oligomerise, forming a large complex that cleaves DNA by introducing double strand breaks. Histone H1 confers DNA binding ability to DFF and stimulates the nuclease activity of DFF40 [].; GO: 0016787 hydrolase activity, 0006309 DNA fragmentation involved in apoptotic nuclear change, 0005634 nucleus, 0005737 cytoplasm; PDB: 1V0D_A.
Probab=22.21  E-value=67  Score=24.38  Aligned_cols=18  Identities=28%  Similarity=0.586  Sum_probs=12.7

Q ss_pred             hhHHHHHHHHHHHHhhcC
Q psy4075          50 QTVVPILLAALTQLTKER   67 (67)
Q Consensus        50 qTVVPiLLqGL~~LaKER   67 (67)
                      .||+|-|+++++.+.+.|
T Consensus       171 RtIlP~l~~ai~~~~~~~  188 (230)
T PF09230_consen  171 RTILPTLVEAIKECQDGR  188 (230)
T ss_dssp             TTHHHHHHHHHHH---SS
T ss_pred             hhHHHHHHHHHHHhhccc
Confidence            589999999999876543


No 8  
>PF02985 HEAT:  HEAT repeat;  InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 []. Arrays of HEAT repeats consists of 3 to 36 units forming a rod-like helical structure and appear to function as protein-protein interaction surfaces. It has been noted that many HEAT repeat-containing proteins are involved in intracellular transport processes. In the crystal structure of PP2A PR65/A [], the HEAT repeats consist of pairs of antiparallel alpha helices [].; GO: 0005515 protein binding; PDB: 3FGA_A 2PF4_C 2IAE_A 2BKU_D 3EA5_B 3ND2_A 2BPT_A 2NYL_A 2NPP_D 2PKG_B ....
Probab=21.87  E-value=60  Score=16.00  Aligned_cols=10  Identities=50%  Similarity=0.876  Sum_probs=7.0

Q ss_pred             HHHHHHHHHH
Q psy4075          52 VVPILLAALT   61 (67)
Q Consensus        52 VVPiLLqGL~   61 (67)
                      ++|.|+++|+
T Consensus         1 llp~l~~~l~   10 (31)
T PF02985_consen    1 LLPILLQLLN   10 (31)
T ss_dssp             HHHHHHHHHT
T ss_pred             CHHHHHHHcC
Confidence            4788887764


No 9  
>PF10941 DUF2620:  Protein of unknown function DUF2620;  InterPro: IPR021238  This is a bacterial family of proteins with unknown function. 
Probab=19.74  E-value=61  Score=22.36  Aligned_cols=12  Identities=50%  Similarity=0.891  Sum_probs=9.8

Q ss_pred             hhHHHHHHHHHH
Q psy4075          50 QTVVPILLAALT   61 (67)
Q Consensus        50 qTVVPiLLqGL~   61 (67)
                      ++|||+|+++|.
T Consensus       106 e~vvP~l~~~l~  117 (117)
T PF10941_consen  106 EQVVPVLIKALK  117 (117)
T ss_pred             HHHHHHHHHHhC
Confidence            578999998873


No 10 
>PF03130 HEAT_PBS:  PBS lyase HEAT-like repeat;  InterPro: IPR004155 These proteins contain a short bi-helical repeat that is related to HEAT. Cyanobacteria and red algae harvest light energy using macromolecular complexes known as phycobilisomes (PBS), peripherally attached to the photosynthetic membrane. The major components of PBS are the phycobiliproteins. These heterodimeric proteins are covalently attached to phycobilins: open-chain tetrapyrrole chromophores, which function as the photosynthetic light-harvesting pigments. Phycobiliproteins differ in sequence and in the nature and number of attached phycobilins to each of their subunits. These proteins include the lyase enzymes that specifically attach particular phycobilins to apophycobiliprotein subunits. The most comprehensively studied of these is the CpcE/Flyase P31967 from SWISSPROT, P31968 from SWISSPROT, which attaches phycocyanobilin (PCB) to the alpha subunit of apophycocyanin []. Similarly, MpeU/V attaches phycoerythrobilin to phycoerythrin II, while CpeY/Z is thought to be involved in phycoerythrobilin (PEB) attachment to phycoerythrin (PE) I (PEs I and II differ in sequence and in the number of attached molecules of PEB: PE I has five, PE II has six) []. All the reactions of the above lyases involve an apoprotein cysteine SH addition to a terminal delta 3,3'-double bond. Such a reaction is not possible in the case of phycoviolobilin (PVB), the phycobilin of alpha-phycoerythrocyanin (alpha-PEC). It is thought that in this case, PCB, not PVB, is first added to apo-alpha-PEC, and is then isomerized to PVB. The addition reaction has been shown to occur in the presence of either of the components of alpha-PEC-PVB lyase PecE or PecF (or both). The isomerisation reaction occurs only when both PecE and PecF components are present, i.e. the PecE/F phycobiliprotein lyase is also a phycobilin isomerase []. Another member of this family is the NblB protein, whose similarity to the phycobiliprotein lyases was previously noted []. This constitutively expressed protein is not known to have any lyase activity. It is thought to be involved in the coordination of PBS degradation with environmental nutrient limitation. It has been suggested that the similarity of NblB to the phycobiliprotein lyases is due to the ability to bind tetrapyrrole phycobilins via the common repeated motif [].; PDB: 1TE4_A.
Probab=17.78  E-value=1.2e+02  Score=14.71  Aligned_cols=13  Identities=38%  Similarity=0.703  Sum_probs=10.0

Q ss_pred             hhhHHHHHHHHHH
Q psy4075          49 DQTVVPILLAALT   61 (67)
Q Consensus        49 dqTVVPiLLqGL~   61 (67)
                      |...+|.|+++|+
T Consensus        14 d~~ai~~L~~~L~   26 (27)
T PF03130_consen   14 DPRAIPALIEALE   26 (27)
T ss_dssp             SHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHhc
Confidence            4677888888875


Done!