Query         psy408
Match_columns 132
No_of_seqs    105 out of 922
Neff          6.6 
Searched_HMMs 46136
Date          Sat Aug 17 00:48:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy408.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/408hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1600|consensus              100.0 2.3E-54 4.9E-59  346.6   8.1  131    1-132   115-245 (321)
  2 PLN02220 delta-9 acyl-lipid de 100.0 5.4E-45 1.2E-49  293.8   3.6  123    1-132   104-226 (299)
  3 COG1398 OLE1 Fatty-acid desatu 100.0 1.3E-40 2.9E-45  262.9   3.8  125    1-132    94-219 (289)
  4 cd03505 Delta9-FADS-like The D 100.0 1.6E-32 3.5E-37  207.3   4.1   69    1-132    51-119 (178)
  5 PF00487 FA_desaturase:  Fatty   98.0 1.5E-05 3.2E-10   59.7   5.6   29    1-29     51-80  (257)
  6 cd01060 Membrane-FADS-like The  95.4  0.0049 1.1E-07   42.1   0.5   26    2-27     47-73  (122)
  7 cd03506 Delta6-FADS-like The D  95.4  0.0031 6.7E-08   47.9  -0.7   70    2-87     46-118 (204)
  8 cd03512 Alkane-hydroxylase Alk  93.5   0.045 9.7E-07   44.8   1.9   27    8-34    120-147 (314)
  9 cd03510 Rhizobitoxine-FADS-lik  87.5    0.17 3.7E-06   37.8   0.0   24    4-27     70-93  (175)
 10 cd03511 Rhizopine-oxygenase-li  86.1    0.24 5.3E-06   39.3   0.2   24    3-26     91-115 (285)
 11 cd03513 CrtW_beta-carotene-ket  84.3    0.34 7.4E-06   37.9   0.3   22    5-26     83-104 (225)
 12 cd03514 CrtR_beta-carotene-hyd  82.5    0.37 8.1E-06   36.9  -0.2   25    3-27     71-96  (207)
 13 PLN03199 delta6-acyl-lipid des  76.7    0.94   2E-05   39.1   0.4   18    3-20    209-226 (485)
 14 PLN03198 delta6-acyl-lipid des  68.4     1.8 3.9E-05   38.0   0.2   20    3-22    284-303 (526)
 15 cd03508 Delta4-sphingolipid-FA  68.3     2.3   5E-05   34.5   0.8   22    6-27     96-118 (289)
 16 cd03507 Delta12-FADS-like The   66.3     1.9 4.1E-05   33.3  -0.0   24    3-26     80-104 (222)
 17 COG3239 DesA Fatty acid desatu  62.8     3.1 6.7E-05   34.4   0.6   23    3-25    111-133 (343)
 18 PLN02505 omega-6 fatty acid de  61.8     2.7 5.9E-05   35.4   0.1   22    3-24    133-155 (381)
 19 PLN02498 omega-3 fatty acid de  60.8       3 6.4E-05   36.1   0.2   22    4-25    198-220 (450)
 20 cd03509 DesA_FADS-like Fatty a  60.1     3.2 6.8E-05   33.5   0.2   23    5-27     75-100 (288)
 21 PLN02598 omega-6 fatty acid de  52.1     5.2 0.00011   34.2   0.2   21    4-24    173-194 (421)
 22 PLN02579 sphingolipid delta-4   49.1     6.8 0.00015   32.3   0.5   23    5-27    124-147 (323)
 23 COG3080 FrdD Fumarate reductas  44.6     5.2 0.00011   28.3  -0.7   14    7-20     76-89  (118)
 24 PRK05470 fumarate reductase su  29.3      12 0.00027   26.6  -0.8   13    7-19     76-88  (118)
 25 KOG4232|consensus               27.5      78  0.0017   27.4   3.5   25    3-27    191-216 (430)
 26 PF08047 His_leader:  Histidine  23.2      41 0.00088   15.5   0.6    8   11-18      8-15  (16)
 27 PF08349 DUF1722:  Protein of u  22.2      24 0.00053   24.4  -0.4   12  116-127    50-61  (117)
 28 PF11859 DUF3379:  Protein of u  22.1      21 0.00045   28.3  -0.9   18   51-68     48-65  (232)

No 1  
>KOG1600|consensus
Probab=100.00  E-value=2.3e-54  Score=346.60  Aligned_cols=131  Identities=51%  Similarity=1.083  Sum_probs=127.8

Q ss_pred             CCCccccccchhcccCCCCCCCCCCCCcCChhhhhhhhcccccChhHHhhccccCcccCCCCceEEEehhhhHHHHHHHH
Q psy408            1 MNSVFNWVRDHRVHHKYSETDADPHNSKRGFFFAHVGWLMCRKHKDVIEKGRMVDMSDVMADPLVRFHEKHFFWFKLVLC   80 (132)
Q Consensus         1 Qgs~~~W~~~HR~HH~~sD~~~DPhsp~rGf~~sH~gWl~~~~~~~~~~~~~~~~~~Dl~~dp~~~~~~r~y~~~~~~~~   80 (132)
                      ||+|++||++||.||++||||+|||||+||||+|||||++++++|++++++++.|++||++||++|||+|+|.++.++++
T Consensus       115 Qg~~~~WvrdHR~HHk~tdTD~DPhn~~rGF~FsHvgWl~~~k~p~~k~~G~~~dvsDL~~dp~v~Fq~k~y~~l~~~~~  194 (321)
T KOG1600|consen  115 QGDIIDWVRDHRVHHKFTDTDADPHNPRRGFWFSHVGWLLDKKHPQVKECGGRLDVSDLEADPVVRFQRKTYLLLMLFFC  194 (321)
T ss_pred             cCChhHHHhhhhhhccccccCCCCCCcccchhhhhhhhHhccCChHHHhhcCcCChhHhhhCceeeehhhhHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhccccceeeeccchhhhHHHHHHHHHHHHhhhhhhhhhhhhhcCCCCCCC
Q psy408           81 FIIPTIVPYYYFGESLLVSVLTMNFFRYILTLNFTWAVNSAAHIWGNKPFDR  132 (132)
Q Consensus        81 ~~lp~~~~~~~~g~~~~~~~~~~g~~R~~~~~h~t~~VNS~~H~~G~r~y~~  132 (132)
                      ++||+++|+++||++...+++.+ ++|.++++|+||||||+||+||.|||++
T Consensus       195 f~lp~~~p~~~~~~~~~~~~~~~-~~r~~~~lh~TwlVNSaaH~~G~rp~d~  245 (321)
T KOG1600|consen  195 FLLPTLGPMYFWGEGMGLAFYVG-LFRYCIVLHATWLVNSAAHIWGSRPYDT  245 (321)
T ss_pred             HHHHHhCcceeeeecchhhhhHH-HHHHHHHHhhHHhhhhHHHHeecccCCC
Confidence            99999999999999998887777 9999999999999999999999999986


No 2  
>PLN02220 delta-9 acyl-lipid desaturase
Probab=100.00  E-value=5.4e-45  Score=293.80  Aligned_cols=123  Identities=27%  Similarity=0.523  Sum_probs=105.8

Q ss_pred             CCCccccccchhcccCCCCCCCCCCCCcCChhhhhhhhcccccChhHHhhccccCcccCCCCceEEEehhhhHHHHHHHH
Q psy408            1 MNSVFNWVRDHRVHHKYSETDADPHNSKRGFFFAHVGWLMCRKHKDVIEKGRMVDMSDVMADPLVRFHEKHFFWFKLVLC   80 (132)
Q Consensus         1 Qgs~~~W~~~HR~HH~~sD~~~DPhsp~rGf~~sH~gWl~~~~~~~~~~~~~~~~~~Dl~~dp~~~~~~r~y~~~~~~~~   80 (132)
                      ||||++||++||+||++||||+|||||+||||||||||++.++.+ .+++.++.+++||++||+++||+|+|.+.+++++
T Consensus       104 Qgs~~~Wv~~HR~HH~~sDt~~DPHsp~~Gfw~sH~gWl~~~~~~-~~~~~~~~~~~Dl~~d~~~~~~~~~~~~~~l~~~  182 (299)
T PLN02220        104 QGDPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVLWIFDTSYI-REKCGGRDNVMDLKQQWFYRFLRKTIGLHILMFW  182 (299)
T ss_pred             CCCHHHHHHHHHHHHHhcCCCCCccccccCcHHHHhHhhcCcchh-hhhcccccchHHHHhCcchHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999987543 2334556789999999999999999877655555


Q ss_pred             HHhccccceeeeccchhhhHHHHHHHHHHHHhhhhhhhhhhhhhcCCCCCCC
Q psy408           81 FIIPTIVPYYYFGESLLVSVLTMNFFRYILTLNFTWAVNSAAHIWGNKPFDR  132 (132)
Q Consensus        81 ~~lp~~~~~~~~g~~~~~~~~~~g~~R~~~~~h~t~~VNS~~H~~G~r~y~~  132 (132)
                      +++      +++|+.  ..++|++++|+++++|+||+|||+||+||+|||++
T Consensus       183 ~~~------~~~gg~--~~~~wg~~~r~~~~~h~tw~VNS~~H~~G~rpy~~  226 (299)
T PLN02220        183 TLL------YLWGGL--PYLTWGVGVGGAIGYHVTWLINSACHIWGSRTWKT  226 (299)
T ss_pred             HHH------HHHhHH--HHHHHHHHHHHHHHHhhhhccchhhhcccCCCCCC
Confidence            543      456653  34788999999999999999999999999999985


No 3  
>COG1398 OLE1 Fatty-acid desaturase [Lipid metabolism]
Probab=100.00  E-value=1.3e-40  Score=262.93  Aligned_cols=125  Identities=27%  Similarity=0.566  Sum_probs=109.2

Q ss_pred             CCCccccccchhcccCCCCCCCCC-CCCcCChhhhhhhhcccccChhHHhhccccCcccCCCCceEEEehhhhHHHHHHH
Q psy408            1 MNSVFNWVRDHRVHHKYSETDADP-HNSKRGFFFAHVGWLMCRKHKDVIEKGRMVDMSDVMADPLVRFHEKHFFWFKLVL   79 (132)
Q Consensus         1 Qgs~~~W~~~HR~HH~~sD~~~DP-hsp~rGf~~sH~gWl~~~~~~~~~~~~~~~~~~Dl~~dp~~~~~~r~y~~~~~~~   79 (132)
                      ||++++|+++||+||++|||++|| |+.+||||||||||++..+. +   +.+..+..|+.+|...+||+|++...+++.
T Consensus        94 ~G~~~~W~~~HR~HHr~tDTd~DPh~~~~kGfw~shigWm~~~~~-~---~~~r~~~~~~~kd~~~~~~~r~~~~~~~l~  169 (289)
T COG1398          94 QGPAIEWVGIHRKHHRKTDTDQDPHYDSFKGFWWSHIGWMLLYSA-E---AKDRETIQKLGKDIPLDWQHRNLYLIALLM  169 (289)
T ss_pred             CCCceeHHHHHHHhhcccCCCCCCCccccccchhhhcceeeecch-h---hcChhHHHHhCCCchhhHHHHHHHHHHHHH
Confidence            899999999999999999999999 55589999999999998754 2   223346779999999999999999999999


Q ss_pred             HHHhccccceeeeccchhhhHHHHHHHHHHHHhhhhhhhhhhhhhcCCCCCCC
Q psy408           80 CFIIPTIVPYYYFGESLLVSVLTMNFFRYILTLNFTWAVNSAAHIWGNKPFDR  132 (132)
Q Consensus        80 ~~~lp~~~~~~~~g~~~~~~~~~~g~~R~~~~~h~t~~VNS~~H~~G~r~y~~  132 (132)
                      .+++|. +.++++|+...  ++|+|+.|+++++|+||||||+||.+|+||||+
T Consensus       170 ~i~~~l-~~~~~~gg~~g--l~~~gv~r~~~~~hat~~VNsl~H~~Gyr~fd~  219 (289)
T COG1398         170 QIVLPL-FIGYALGGWLG--LIWGGVQRLVLVQHATWCVNSLGHYIGYRPFDC  219 (289)
T ss_pred             HHHHHH-HHHHHhcchhH--HHHHHHHHHHHHHHHHHHHhhhhhhhcccccCC
Confidence            999994 44567776433  899999999999999999999999999999984


No 4  
>cd03505 Delta9-FADS-like The Delta9 Fatty Acid Desaturase (Delta9-FADS)-like CD includes the delta-9 and delta-11 acyl CoA desaturases found in various eukaryotes including vertebrates, insects, higher plants, and fungi. The delta-9 acyl-lipid desaturases are found in a wide range of bacteria. These enzymes play essential roles in fatty acid metabolism and the regulation of cell membrane fluidity. Acyl-CoA desaturases are the enzymes involved in the CoA-bound desaturation of fatty acids. Mammalian stearoyl-CoA delta-9 desaturase is a key enzyme in the biosynthesis of monounsaturated fatty acids, and in yeast, the delta-9 acyl-CoA desaturase (OLE1) reaction accounts for all de nova unsaturated fatty acid production in Saccharomyces cerevisiae. These non-heme, iron-containing, ER membrane-bound enzymes are part of a three-component enzyme system involving cytochrome b5, cytochrome b5 reductase, and the delta-9 fatty acid desaturase. This complex catalyzes the NADH- and oxygen-dependent i
Probab=99.97  E-value=1.6e-32  Score=207.29  Aligned_cols=69  Identities=57%  Similarity=1.174  Sum_probs=67.1

Q ss_pred             CCCccccccchhcccCCCCCCCCCCCCcCChhhhhhhhcccccChhHHhhccccCcccCCCCceEEEehhhhHHHHHHHH
Q psy408            1 MNSVFNWVRDHRVHHKYSETDADPHNSKRGFFFAHVGWLMCRKHKDVIEKGRMVDMSDVMADPLVRFHEKHFFWFKLVLC   80 (132)
Q Consensus         1 Qgs~~~W~~~HR~HH~~sD~~~DPhsp~rGf~~sH~gWl~~~~~~~~~~~~~~~~~~Dl~~dp~~~~~~r~y~~~~~~~~   80 (132)
                      ||||++|+++||+||++||||+|||||+||||||||||+                                         
T Consensus        51 qgs~~~W~~~HR~HH~~sDt~~DPhs~~~gf~~~h~gW~-----------------------------------------   89 (178)
T cd03505          51 QGSPLWWVADHRLHHRYSDTDGDPHSPKRGFWFSHVGWL-----------------------------------------   89 (178)
T ss_pred             CcCHHHHHHHHHHhhcccCCCCCCCCcccCcHHHHHhhH-----------------------------------------
Confidence            899999999999999999999999999999999999999                                         


Q ss_pred             HHhccccceeeeccchhhhHHHHHHHHHHHHhhhhhhhhhhhhhcCCCCCCC
Q psy408           81 FIIPTIVPYYYFGESLLVSVLTMNFFRYILTLNFTWAVNSAAHIWGNKPFDR  132 (132)
Q Consensus        81 ~~lp~~~~~~~~g~~~~~~~~~~g~~R~~~~~h~t~~VNS~~H~~G~r~y~~  132 (132)
                                            ++++|+++++|+||+|||+||++|+|||++
T Consensus        90 ----------------------~~~~r~~~~~h~t~~VNs~~H~~G~r~~~~  119 (178)
T cd03505          90 ----------------------GGLLRIVLVLHATWLVNSLAHMWGYRPYDT  119 (178)
T ss_pred             ----------------------HHHHHHHHHHHHHHHHHHHHHhcCCCCCCC
Confidence                                  678999999999999999999999999975


No 5  
>PF00487 FA_desaturase:  Fatty acid desaturase This entry is only a subset of the Pfam family.;  InterPro: IPR005804  Fatty acid desaturases are enzymes that catalyse the insertion of a double bond at the delta position of fatty acids. There seem to be two distinct families of fatty acid desaturases which do not seem to be evolutionary related. Family 1 is composed of:  Stearoyl-CoA desaturase (SCD) (1.14.19.1 from EC) [].    Family 2 is composed of:  Bacterial fatty acid desaturases. Plant stearoyl-acyl-carrier-protein desaturase (1.14.19.1 from EC) [], this enzyme catalyzes the introduction of a double bond at the delta(9) position of steraoyl-ACP to produce oleoyl-ACP. This enzyme is responsible for the conversion of saturated fatty acids to unsaturated fatty acids in the synthesis of vegetable oils. Cyanobacterial DesA [], an enzyme that can introduce a second cis double bond at the delta(12) position of fatty acid bound to membranes glycerolipids. DesA is involved in chilling tolerance; the phase transition temperature of lipids of cellular membranes being dependent on the degree of unsaturation of fatty acids of the membrane lipids.  This entry contains fatty acid desaturases belonging to Family 1. ; GO: 0006629 lipid metabolic process
Probab=97.98  E-value=1.5e-05  Score=59.73  Aligned_cols=29  Identities=28%  Similarity=0.533  Sum_probs=25.4

Q ss_pred             CCCccccccchhcccCCCCCCC-CCCCCcC
Q psy408            1 MNSVFNWVRDHRVHHKYSETDA-DPHNSKR   29 (132)
Q Consensus         1 Qgs~~~W~~~HR~HH~~sD~~~-DPhsp~r   29 (132)
                      ++++..|...|+.||+++++++ ||.++..
T Consensus        51 ~~~~~~wr~~H~~HH~~~~~~~~Dpd~~~~   80 (257)
T PF00487_consen   51 GGPYSSWRISHNRHHHYTNNPDRDPDSWTR   80 (257)
T ss_pred             cCCHhHhheeeeccccccCCccccCccchh
Confidence            3577889999999999999987 9999865


No 6  
>cd01060 Membrane-FADS-like The membrane fatty acid desaturase (Membrane_FADS)-like CD includes membrane FADSs, alkane hydroxylases, beta carotene ketolases (CrtW-like), hydroxylases (CrtR-like), and other related proteins. They are present in all groups of organisms with the exception of archaea. Membrane FADSs are non-heme, iron-containing, oxygen-dependent enzymes involved in regioselective introduction of double bonds in fatty acyl aliphatic chains. They play an important role in the maintenance of the proper structure and functioning of biological membranes. Alkane hydroxylases are bacterial, integral-membrane di-iron enzymes that share a requirement for iron and oxygen for activity similar to that of membrane FADSs, and are involved in the initial oxidation of inactivated alkanes. Beta-carotene ketolase and beta-carotene hydroxylase are carotenoid biosynthetic enzymes for astaxanthin and zeaxanthin, respectively. This superfamily domain has extensive hydrophobic regions that would
Probab=95.43  E-value=0.0049  Score=42.13  Aligned_cols=26  Identities=42%  Similarity=0.767  Sum_probs=24.0

Q ss_pred             CCccccccchhcccCCCCCC-CCCCCC
Q psy408            2 NSVFNWVRDHRVHHKYSETD-ADPHNS   27 (132)
Q Consensus         2 gs~~~W~~~HR~HH~~sD~~-~DPhsp   27 (132)
                      .++..|...|..||++++++ +||.++
T Consensus        47 ~~~~~~~~~H~~HH~~~~~~~~D~~~~   73 (122)
T cd01060          47 GSYGWWRRSHRRHHRYTNTPGKDPDSA   73 (122)
T ss_pred             CCHHHHHHHHHHHhcCcCCCCCCCccc
Confidence            57788999999999999998 999999


No 7  
>cd03506 Delta6-FADS-like The Delta6 Fatty Acid Desaturase (Delta6-FADS)-like CD includes the integral-membrane enzymes: delta-4, delta-5, delta-6, delta-8, delta-8-sphingolipid, and delta-11 desaturases found in vertebrates, higher plants, fungi, and bacteria. These desaturases are required for the synthesis of highly unsaturated fatty acids (HUFAs), which are mainly esterified into phospholipids and contribute to maintaining membrane fluidity. While HUFAs may be required for cold tolerance in bacteria, plants and fish, the primary role of HUFAs in mammals is cell signaling. These enzymes are described as front-end desaturases because they introduce a double bond between the pre-exiting double bond and the carboxyl (front) end of the fatty acid. Various substrates are involved, with both acyl-coenzyme A (CoA) and acyl-lipid desaturases present in this CD. Acyl-lipid desaturases are localized in the membranes of cyanobacterial thylakoid, plant endoplasmic reticulum (ER), and plastid; an
Probab=95.40  E-value=0.0031  Score=47.94  Aligned_cols=70  Identities=23%  Similarity=0.354  Sum_probs=41.9

Q ss_pred             CCccccccchhcccCCCCC-CCCCCCCcCChhhhhhhhcccccChhHHhhccccCcccCCCCceEEEehhhhHHHHHHH-
Q psy408            2 NSVFNWVRDHRVHHKYSET-DADPHNSKRGFFFAHVGWLMCRKHKDVIEKGRMVDMSDVMADPLVRFHEKHFFWFKLVL-   79 (132)
Q Consensus         2 gs~~~W~~~HR~HH~~sD~-~~DPhsp~rGf~~sH~gWl~~~~~~~~~~~~~~~~~~Dl~~dp~~~~~~r~y~~~~~~~-   79 (132)
                      +|..+|...|..||+++++ +.||-......+..        .++..        ..|....+..++|..+++++..++ 
T Consensus        46 ~s~~~w~~~H~~HH~~tn~~~~Dpd~~~~~~~~~--------~~~~~--------~~~~~~~~~~~~q~~~~~~~~~~~~  109 (204)
T cd03506          46 ASAGWWKNKHNVHHAYTNILGHDPDIDTLPLLAR--------SEPAF--------GKDQKKRFLHRYQHFYFFPLLALLL  109 (204)
T ss_pred             CCHHHHHHHHhhhcCcCCCCCCCCCCCcCceEEe--------ccccc--------ccchHHHHHHHHHHHHHHHHHHHHH
Confidence            4677899999999999986 58998765443211        11100        123344556677777776654332 


Q ss_pred             -HHHhcccc
Q psy408           80 -CFIIPTIV   87 (132)
Q Consensus        80 -~~~lp~~~   87 (132)
                       .+++|.++
T Consensus       110 ~~~~~~~~~  118 (204)
T cd03506         110 LAFLVVQLA  118 (204)
T ss_pred             HHHHHHHHH
Confidence             44555443


No 8  
>cd03512 Alkane-hydroxylase Alkane hydroxylase is a bacterial, integral-membrane di-iron enzyme that shares a requirement for iron and oxygen for activity similar to that of the non-heme integral-membrane acyl coenzyme A (CoA) desaturases and acyl lipid desaturases. The alk genes in Pseudomonas oleovorans encode conversion of alkanes to acyl CoA. The alkane omega-hydroxylase (AlkB) system is responsible for the initial oxidation of inactivated alkanes. It is a three-component system comprising a soluble NADH-rubredoxin reductase (AlkT), a soluble rubredoxin (AlkG), and the integral membrane oxygenase (AlkB). AlkB utilizes the oxygen rebound mechanism to hydroxylate alkanes. This mechanism involves homolytic cleavage of the C-H bond by an electrophilic metal-oxo intermediate to generate a substrate-based radical. As with other members of this superfamily, this domain family has extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. The active
Probab=93.52  E-value=0.045  Score=44.76  Aligned_cols=27  Identities=37%  Similarity=0.757  Sum_probs=21.1

Q ss_pred             ccchhcccCCCCCCCCCCCCcCCh-hhh
Q psy408            8 VRDHRVHHKYSETDADPHNSKRGF-FFA   34 (132)
Q Consensus         8 ~~~HR~HH~~sD~~~DPhsp~rGf-~~s   34 (132)
                      .+.+|.||+++.|++||=++.+|= +|+
T Consensus       120 ~~H~~~HH~~v~tp~DP~tar~ge~~y~  147 (314)
T cd03512         120 IEHVRGHHRYVATPEDPATARRGESFYR  147 (314)
T ss_pred             eeecccCCCCCCCCCCccccccCccHHH
Confidence            445669999999999999997654 444


No 9  
>cd03510 Rhizobitoxine-FADS-like This CD includes the dihydrorhizobitoxine fatty acid desaturase (RtxC) characterized in Bradyrhizobium japonicum USDA110, and other related proteins. Dihydrorhizobitoxine desaturase is reported to be involved in the final step of rhizobitoxine biosynthesis. This domain family appears to be structurally related to the membrane fatty acid desaturases and the alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXX(X)HH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA desaturase and alkane hydroxylase.
Probab=87.45  E-value=0.17  Score=37.81  Aligned_cols=24  Identities=29%  Similarity=0.472  Sum_probs=20.7

Q ss_pred             ccccccchhcccCCCCCCCCCCCC
Q psy408            4 VFNWVRDHRVHHKYSETDADPHNS   27 (132)
Q Consensus         4 ~~~W~~~HR~HH~~sD~~~DPhsp   27 (132)
                      .-.|...|..||+++.+++||--.
T Consensus        70 ~~~~r~~H~~HH~~~~~~~Dpd~~   93 (175)
T cd03510          70 LAAYRRSHLKHHRHLGTEDDPDLA   93 (175)
T ss_pred             HHHHHHHHHHHhCccCCCCCCcHH
Confidence            346888999999999999999876


No 10 
>cd03511 Rhizopine-oxygenase-like This CD includes the putative hydrocarbon oxygenase, MocD, a bacterial rhizopine (3-O-methyl-scyllo-inosamine, 3-O-MSI) oxygenase, and other related proteins. It has been proposed that MocD, MocE (Rieske-like ferredoxin), and MocF (ferredoxin reductase) under the regulation of MocR, act in concert to form a ferredoxin oxygenase system that demethylates 3-O-MSI to form scyllo-inosamine.  This domain family appears to be structurally related to the membrane fatty acid desaturases and the alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA d
Probab=86.07  E-value=0.24  Score=39.33  Aligned_cols=24  Identities=25%  Similarity=0.416  Sum_probs=19.0

Q ss_pred             CccccccchhcccCCCC-CCCCCCC
Q psy408            3 SVFNWVRDHRVHHKYSE-TDADPHN   26 (132)
Q Consensus         3 s~~~W~~~HR~HH~~sD-~~~DPhs   26 (132)
                      |...|...|..||+++. +++||-.
T Consensus        91 ~~~~~~~~H~~HH~~~~~~~~Dpd~  115 (285)
T cd03511          91 PPDFFRWSHARHHRYTQIPGRDPEL  115 (285)
T ss_pred             ChHHHHHHHHHHhcCcCCCCCCCCC
Confidence            44578999999999995 5688754


No 11 
>cd03513 CrtW_beta-carotene-ketolase Beta-carotene ketolase/oxygenase (CrtW, also known as CrtO), the carotenoid astaxanthin biosynthetic enzyme, initially catalyzes the addition of two keto groups to carbons C4 and C4' of beta-carotene. Carotenoids are important natural pigments produced by many microorganisms and plants. Astaxanthin is reported to be an antioxidant, an anti-cancer agent, and an immune system stimulant. A number of bacteria and green algae can convert beta-carotene into astaxanthin by using several ketocarotenoids as intermediates and CrtW and a beta-carotene hydroxylase (CrtZ). CrtW initially converts beta-carotene to canthaxanthin via echinenone, and CrtZ initially mediates the conversion of beta-carotene to zeaxanthin via beta-cryptoxanthin. After a few more intermediates are formed, CrtW and CrtZ act in combination to produce astaxanthin. Sequences of this domain family appear to be structurally related to membrane fatty acid desaturases and alkane hydroxylases. Th
Probab=84.34  E-value=0.34  Score=37.92  Aligned_cols=22  Identities=32%  Similarity=0.516  Sum_probs=17.9

Q ss_pred             cccccchhcccCCCCCCCCCCC
Q psy408            5 FNWVRDHRVHHKYSETDADPHN   26 (132)
Q Consensus         5 ~~W~~~HR~HH~~sD~~~DPhs   26 (132)
                      ..|.+.|..||+++.+++||=-
T Consensus        83 ~~~~~~H~~HH~~~~~~~DpD~  104 (225)
T cd03513          83 DRLLRKHHLHHRHPGTAKDPDF  104 (225)
T ss_pred             HHHHHHHHHHcCCCCCCCCCCC
Confidence            4578899999999988777743


No 12 
>cd03514 CrtR_beta-carotene-hydroxylase Beta-carotene hydroxylase (CrtR), the carotenoid zeaxanthin biosynthetic enzyme catalyzes the addition of hydroxyl groups to the beta-ionone rings of beta-carotene to form zeaxanthin and is found in bacteria and red algae. Carotenoids are important natural pigments; zeaxanthin and lutein are the only dietary carotenoids that accumulate in the macular region of the retina and lens. It is proposed that these carotenoids protect ocular tissues against photooxidative damage. CrtR does not show overall amino acid sequence similarity to the beta-carotene hydroxylases similar to CrtZ, an astaxanthin biosynthetic beta-carotene hydroxylase. However, CrtR does show sequence similarity to the green alga, Haematococcus pluvialis, beta-carotene ketolase (CrtW), which converts beta-carotene to canthaxanthin. Sequences of the CrtR_beta-carotene-hydroxylase domain family, as well as, the CrtW_beta-carotene-ketolase domain family appear to be structurally related 
Probab=82.48  E-value=0.37  Score=36.90  Aligned_cols=25  Identities=24%  Similarity=0.302  Sum_probs=20.0

Q ss_pred             CccccccchhcccCCCCCC-CCCCCC
Q psy408            3 SVFNWVRDHRVHHKYSETD-ADPHNS   27 (132)
Q Consensus         3 s~~~W~~~HR~HH~~sD~~-~DPhsp   27 (132)
                      |...|...|..||+++.++ +||-..
T Consensus        71 ~~~~w~~~H~~HH~~~~~~~~DpD~~   96 (207)
T cd03514          71 PFPVFRRVHMQHHAHTNDPEKDPDHF   96 (207)
T ss_pred             CHHHHHHHHHHHhcCcCcCCcCccHH
Confidence            4457899999999999875 888554


No 13 
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional
Probab=76.70  E-value=0.94  Score=39.15  Aligned_cols=18  Identities=28%  Similarity=0.453  Sum_probs=16.2

Q ss_pred             CccccccchhcccCCCCC
Q psy408            3 SVFNWVRDHRVHHKYSET   20 (132)
Q Consensus         3 s~~~W~~~HR~HH~~sD~   20 (132)
                      |..+|...|-.||.+++.
T Consensus       209 S~~wW~~~Hn~HH~~tN~  226 (485)
T PLN03199        209 SMQWWKNKHNGHHAVPNL  226 (485)
T ss_pred             ChHHHHHHHhhhhcCcCc
Confidence            567999999999999985


No 14 
>PLN03198 delta6-acyl-lipid desaturase; Provisional
Probab=68.41  E-value=1.8  Score=37.99  Aligned_cols=20  Identities=25%  Similarity=0.368  Sum_probs=17.4

Q ss_pred             CccccccchhcccCCCCCCC
Q psy408            3 SVFNWVRDHRVHHKYSETDA   22 (132)
Q Consensus         3 s~~~W~~~HR~HH~~sD~~~   22 (132)
                      |+.+|...|..||.++...+
T Consensus       284 s~~~W~~~Hn~HH~~tN~~~  303 (526)
T PLN03198        284 STGWWKEKHNLHHAAPNECD  303 (526)
T ss_pred             CHHHHHHHHHHhccCCCCCC
Confidence            57799999999999998754


No 15 
>cd03508 Delta4-sphingolipid-FADS-like The Delta4-sphingolipid Fatty Acid Desaturase (Delta4-sphingolipid-FADS)-like CD includes the integral-membrane enzymes, dihydroceramide Delta-4 desaturase, involved in the synthesis of sphingosine; and the human membrane fatty acid (lipid) desaturase (MLD), reported to modulate biosynthesis of the epidermal growth factor receptor; and other related proteins. These proteins are found in various eukaryotes including vertebrates, higher plants, and fungi. Studies show that MLD is localized to the endoplasmic reticulum. As with other members of this superfamily, this domain family has extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for
Probab=68.28  E-value=2.3  Score=34.46  Aligned_cols=22  Identities=27%  Similarity=0.462  Sum_probs=17.1

Q ss_pred             ccccchhcccCCCCCC-CCCCCC
Q psy408            6 NWVRDHRVHHKYSETD-ADPHNS   27 (132)
Q Consensus         6 ~W~~~HR~HH~~sD~~-~DPhsp   27 (132)
                      +|...|..||+++.++ .||=-+
T Consensus        96 ~~r~~H~~HH~~~n~~~~DpDi~  118 (289)
T cd03508          96 SFKKYHLEHHRYLGEDGLDTDIP  118 (289)
T ss_pred             HHHHHHHHhccCCCCCCCCCCcc
Confidence            4788999999999864 477544


No 16 
>cd03507 Delta12-FADS-like The Delta12 Fatty Acid Desaturase (Delta12-FADS)-like CD includes the integral-membrane enzymes, delta-12 acyl-lipid desaturases, oleate 12-hydroxylases, omega3 and omega6 fatty acid desaturases, and other related proteins, found in a wide range of organisms including higher plants, green algae, diatoms, nematodes, fungi, and bacteria. The expression of these proteins appears to be temperature dependent: decreases in temperature result in increased levels of fatty acid desaturation within membrane lipids subsequently altering cell membrane fluidity. An important enzyme for the production of polyunsaturates in plants is the oleate delta-12 desaturase (Arabidopsis FAD2) of the endoplasmic reticulum. This enzyme accepts l-acyl-2-oleoyl-sn-glycero-3-phosphocholine as substrate and requires NADH:cytochrome b oxidoreductase, cytochrome b, and oxygen for activity. FAD2 converts oleate(18:1) to linoleate (18:2) and is closely related to oleate 12-hydroxylase which cat
Probab=66.33  E-value=1.9  Score=33.28  Aligned_cols=24  Identities=21%  Similarity=0.378  Sum_probs=18.9

Q ss_pred             CccccccchhcccCCCCC-CCCCCC
Q psy408            3 SVFNWVRDHRVHHKYSET-DADPHN   26 (132)
Q Consensus         3 s~~~W~~~HR~HH~~sD~-~~DPhs   26 (132)
                      +.-.|...|.+||+++.+ ++||-.
T Consensus        80 p~~~w~~~H~~HH~~~~~~~~D~~~  104 (222)
T cd03507          80 PYHSWRISHNRHHAHTGNLEGDEVW  104 (222)
T ss_pred             ChHHHHHHHHHHHhccCCCCCCCcc
Confidence            345789999999999876 677655


No 17 
>COG3239 DesA Fatty acid desaturase [Lipid metabolism]
Probab=62.77  E-value=3.1  Score=34.38  Aligned_cols=23  Identities=22%  Similarity=0.299  Sum_probs=19.1

Q ss_pred             CccccccchhcccCCCCCCCCCC
Q psy408            3 SVFNWVRDHRVHHKYSETDADPH   25 (132)
Q Consensus         3 s~~~W~~~HR~HH~~sD~~~DPh   25 (132)
                      ++..|-..|.+||+++.+++||.
T Consensus       111 p~~~wR~~H~~HH~~t~~~~~d~  133 (343)
T COG3239         111 PPVFWRISHNQHHAHTNILDDDP  133 (343)
T ss_pred             ChhhhhhhHHHhhcccCCCCCCH
Confidence            35678888999999999988883


No 18 
>PLN02505 omega-6 fatty acid desaturase
Probab=61.79  E-value=2.7  Score=35.45  Aligned_cols=22  Identities=32%  Similarity=0.702  Sum_probs=18.1

Q ss_pred             CccccccchhcccCCCCC-CCCC
Q psy408            3 SVFNWVRDHRVHHKYSET-DADP   24 (132)
Q Consensus         3 s~~~W~~~HR~HH~~sD~-~~DP   24 (132)
                      +...|-..|+.||+++.. +.||
T Consensus       133 p~~~Wr~~H~~HH~~tn~~~~D~  155 (381)
T PLN02505        133 PYFSWKYSHRRHHSNTGSLERDE  155 (381)
T ss_pred             CHHHHHHHHHHHhhccCCCCCCc
Confidence            456799999999999975 6676


No 19 
>PLN02498 omega-3 fatty acid desaturase
Probab=60.80  E-value=3  Score=36.09  Aligned_cols=22  Identities=27%  Similarity=0.567  Sum_probs=17.6

Q ss_pred             ccccccchhcccCCCCC-CCCCC
Q psy408            4 VFNWVRDHRVHHKYSET-DADPH   25 (132)
Q Consensus         4 ~~~W~~~HR~HH~~sD~-~~DPh   25 (132)
                      .-.|-..|+.||+++.+ ++||-
T Consensus       198 y~~Wr~sH~~HH~~Tn~~e~D~~  220 (450)
T PLN02498        198 YHGWRISHRTHHQNHGHVENDES  220 (450)
T ss_pred             HHHHHHHHHHHhcCCCCCCCCCC
Confidence            45799999999999974 66663


No 20 
>cd03509 DesA_FADS-like Fatty acid desaturase protein family subgroup, a delta-12 acyl-lipid desaturase-like, DesA-like, yet uncharacterized subgroup of membrane fatty acid desaturase proteins found in alpha-, beta-, and gamma-proteobacteria. Sequences of this domain family appear to be structurally related to membrane fatty acid desaturases and alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of these sequences also reveals three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA desaturase and alkane hydroxylase.
Probab=60.13  E-value=3.2  Score=33.54  Aligned_cols=23  Identities=22%  Similarity=0.479  Sum_probs=17.9

Q ss_pred             cccccchhcccCCCC---CCCCCCCC
Q psy408            5 FNWVRDHRVHHKYSE---TDADPHNS   27 (132)
Q Consensus         5 ~~W~~~HR~HH~~sD---~~~DPhsp   27 (132)
                      ..|-..|-.||++++   .+.||-+.
T Consensus        75 ~~wr~~H~~HH~~~nl~~~~~Dpd~~  100 (288)
T cd03509          75 TRYRDTHLAHHRDEDLTDPGDDPESN  100 (288)
T ss_pred             HHHHHHHHHHcCCCCCCCCCCCCccc
Confidence            478899999999985   24688654


No 21 
>PLN02598 omega-6 fatty acid desaturase
Probab=52.12  E-value=5.2  Score=34.22  Aligned_cols=21  Identities=24%  Similarity=0.398  Sum_probs=17.1

Q ss_pred             ccccccchhcccCCCCC-CCCC
Q psy408            4 VFNWVRDHRVHHKYSET-DADP   24 (132)
Q Consensus         4 ~~~W~~~HR~HH~~sD~-~~DP   24 (132)
                      .-.|-..|+.||+++.. ++||
T Consensus       173 ~~~wr~~H~~HH~~tn~~~~D~  194 (421)
T PLN02598        173 FEPWRIKHNTHHAHTNKLVMDT  194 (421)
T ss_pred             HHHHHHHHHHHccCcCCCCCCC
Confidence            35688999999999974 6785


No 22 
>PLN02579 sphingolipid delta-4 desaturase
Probab=49.13  E-value=6.8  Score=32.30  Aligned_cols=23  Identities=17%  Similarity=0.339  Sum_probs=18.4

Q ss_pred             cccccchhcccCCCCC-CCCCCCC
Q psy408            5 FNWVRDHRVHHKYSET-DADPHNS   27 (132)
Q Consensus         5 ~~W~~~HR~HH~~sD~-~~DPhsp   27 (132)
                      .+|.+.|..||+++.. +.||--|
T Consensus       124 ~~~~~~H~~HH~~~n~~~~D~Di~  147 (323)
T PLN02579        124 VTFQKYHLEHHRFQGVDGIDMDIP  147 (323)
T ss_pred             HHHHHHHHHHccCCCCCCCCCCCC
Confidence            3688899999999964 4577766


No 23 
>COG3080 FrdD Fumarate reductase subunit D [Energy production and conversion]
Probab=44.65  E-value=5.2  Score=28.26  Aligned_cols=14  Identities=36%  Similarity=0.840  Sum_probs=11.7

Q ss_pred             cccchhcccCCCCC
Q psy408            7 WVRDHRVHHKYSET   20 (132)
Q Consensus         7 W~~~HR~HH~~sD~   20 (132)
                      |.+.||.||.--|-
T Consensus        76 w~a~HRihHgmhdl   89 (118)
T COG3080          76 WCALHRIHHGMHDL   89 (118)
T ss_pred             HHHHHHHHhhhhhe
Confidence            88999999987764


No 24 
>PRK05470 fumarate reductase subunit D; Provisional
Probab=29.34  E-value=12  Score=26.62  Aligned_cols=13  Identities=38%  Similarity=0.928  Sum_probs=10.6

Q ss_pred             cccchhcccCCCC
Q psy408            7 WVRDHRVHHKYSE   19 (132)
Q Consensus         7 W~~~HR~HH~~sD   19 (132)
                      |.+.||.||--=|
T Consensus        76 Wh~~HRihHglHD   88 (118)
T PRK05470         76 WCGLHRIHHGMHD   88 (118)
T ss_pred             HHHHHHHHHHHhc
Confidence            7888999987755


No 25 
>KOG4232|consensus
Probab=27.49  E-value=78  Score=27.39  Aligned_cols=25  Identities=32%  Similarity=0.545  Sum_probs=20.4

Q ss_pred             CccccccchhcccCCCCC-CCCCCCC
Q psy408            3 SVFNWVRDHRVHHKYSET-DADPHNS   27 (132)
Q Consensus         3 s~~~W~~~HR~HH~~sD~-~~DPhsp   27 (132)
                      |.-||...|-.||..++. +.||=+-
T Consensus       191 sa~WW~~~H~~HHa~pN~~~~DpDi~  216 (430)
T KOG4232|consen  191 SAAWWKSHHNQHHAAPNSLDKDPDID  216 (430)
T ss_pred             cHHHHHHHHhhhhccCccCCCCcccc
Confidence            677999999999999986 6676553


No 26 
>PF08047 His_leader:  Histidine operon leader peptide;  InterPro: IPR012565 This family consists of the leader peptide of the histidine (his) operon. The his operon contains all the genes necessary for histidine biosynthesis. The region corresponding to the untranslated 5'-end of the transcript, named the his leader region, displays the typical features of the T box transcriptional attenuation mechanism which is involved in the regulation of many amino acid biosynthetic operons [].; GO: 0000105 histidine biosynthetic process
Probab=23.18  E-value=41  Score=15.49  Aligned_cols=8  Identities=38%  Similarity=0.642  Sum_probs=3.9

Q ss_pred             hhcccCCC
Q psy408           11 HRVHHKYS   18 (132)
Q Consensus        11 HR~HH~~s   18 (132)
                      |+.||.+-
T Consensus         8 ~hhhhhhp   15 (16)
T PF08047_consen    8 HHHHHHHP   15 (16)
T ss_pred             ccccccCC
Confidence            44555443


No 27 
>PF08349 DUF1722:  Protein of unknown function (DUF1722);  InterPro: IPR013560 This domain of unknown function is found in bacteria and archaea and is homologous to the hypothetical protein ybgA from Escherichia coli. 
Probab=22.18  E-value=24  Score=24.43  Aligned_cols=12  Identities=33%  Similarity=0.534  Sum_probs=10.1

Q ss_pred             hhhhhhhhhcCC
Q psy408          116 WAVNSAAHIWGN  127 (132)
Q Consensus       116 ~~VNS~~H~~G~  127 (132)
                      -.||.+-|+||+
T Consensus        50 ~~~Nvl~Hi~Gy   61 (117)
T PF08349_consen   50 SHINVLQHIFGY   61 (117)
T ss_pred             hHHHHHHHHHHH
Confidence            478999999995


No 28 
>PF11859 DUF3379:  Protein of unknown function (DUF3379);  InterPro: IPR021806  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 234 to 251 amino acids in length. 
Probab=22.06  E-value=21  Score=28.34  Aligned_cols=18  Identities=28%  Similarity=0.344  Sum_probs=13.6

Q ss_pred             ccccCcccCCCCceEEEe
Q psy408           51 GRMVDMSDVMADPLVRFH   68 (132)
Q Consensus        51 ~~~~~~~Dl~~dp~~~~~   68 (132)
                      ..++++||=++|+++.-|
T Consensus        48 Al~VdVPddLAdkiLl~Q   65 (232)
T PF11859_consen   48 ALKVDVPDDLADKILLRQ   65 (232)
T ss_pred             HcCCCCCccHHHHHHhhc
Confidence            345788988888887666


Done!