Query psy4082
Match_columns 86
No_of_seqs 36 out of 38
Neff 3.1
Searched_HMMs 46136
Date Sat Aug 17 00:51:39 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy4082.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4082hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG1653|consensus 44.2 4.2 9.1E-05 31.0 -1.3 10 9-18 104-113 (175)
2 PRK11594 efflux system membran 31.7 12 0.00026 24.4 -0.6 12 3-14 37-48 (67)
3 PRK10280 dipeptidyl carboxypep 22.5 42 0.0009 29.3 1.0 13 3-15 609-621 (681)
4 PF04868 PDE6_gamma: Retinal c 21.5 47 0.001 22.7 0.9 13 73-85 60-72 (83)
5 PF15470 DUF4637: Domain of un 20.1 30 0.00065 26.3 -0.3 37 50-86 64-100 (173)
6 PF07869 DUF1656: Protein of u 19.7 22 0.00048 21.7 -0.9 14 3-16 33-46 (58)
7 COG0339 Dcp Zn-dependent oligo 16.3 69 0.0015 28.9 0.9 12 3-14 611-622 (683)
8 KOG1770|consensus 15.6 48 0.001 23.8 -0.2 17 36-53 35-51 (112)
9 PF12436 USP7_ICP0_bdg: ICP0-b 12.5 49 0.0011 25.0 -0.9 19 3-21 166-184 (249)
10 PRK14745 RepA leader peptide T 11.6 1.1E+02 0.0024 16.8 0.6 9 6-14 6-14 (26)
No 1
>KOG1653|consensus
Probab=44.23 E-value=4.2 Score=30.98 Aligned_cols=10 Identities=60% Similarity=0.926 Sum_probs=8.2
Q ss_pred hhhhhhhhhH
Q psy4082 9 LLWHRVSVHF 18 (86)
Q Consensus 9 ~~~~~~~~~~ 18 (86)
--|||||||-
T Consensus 104 tqWHRVsVf~ 113 (175)
T KOG1653|consen 104 TQWHRVSVFN 113 (175)
T ss_pred ceeEEEEeeC
Confidence 3599999985
No 2
>PRK11594 efflux system membrane protein; Provisional
Probab=31.72 E-value=12 Score=24.38 Aligned_cols=12 Identities=33% Similarity=1.074 Sum_probs=10.3
Q ss_pred chhhhhhhhhhh
Q psy4082 3 AAGYYQLLWHRV 14 (86)
Q Consensus 3 ~~~~~~~~~~~~ 14 (86)
..|.|++.||+-
T Consensus 37 r~g~YR~VWHpa 48 (67)
T PRK11594 37 PTGIYDFVWHPA 48 (67)
T ss_pred HhCcceeeecHH
Confidence 469999999985
No 3
>PRK10280 dipeptidyl carboxypeptidase II; Provisional
Probab=22.49 E-value=42 Score=29.32 Aligned_cols=13 Identities=54% Similarity=1.170 Sum_probs=11.7
Q ss_pred chhhhhhhhhhhh
Q psy4082 3 AAGYYQLLWHRVS 15 (86)
Q Consensus 3 ~~~~~~~~~~~~~ 15 (86)
+||||-.+|-+|-
T Consensus 609 ~AgYYsYlwaevl 621 (681)
T PRK10280 609 AAGYYAYLWTQML 621 (681)
T ss_pred chhhHHHHHHHHH
Confidence 6999999999984
No 4
>PF04868 PDE6_gamma: Retinal cGMP phosphodiesterase, gamma subunit; InterPro: IPR006952 Retinal rod and cone cGMP phosphodiesterases function as the effector enzymes in the vertebrate visual transduction cascade. This family represents the inhibitory gamma subunit [], which is also expressed outside retinal tissues and has been shown to interact with the G-protein-coupled receptor kinase 2 signalling system to regulate the epidermal growth factor- and thrombin-dependent stimulation of p42/p44 mitogen-activated protein kinase in human embryonic kidney 293 cells [].; GO: 0004114 3',5'-cyclic-nucleotide phosphodiesterase activity, 0030553 cGMP binding, 0007601 visual perception; PDB: 2JU4_A 1FQJ_C 3JWR_D.
Probab=21.50 E-value=47 Score=22.71 Aligned_cols=13 Identities=31% Similarity=0.687 Sum_probs=9.2
Q ss_pred eecCCCcccCCCC
Q psy4082 73 TSYQPPWKALSDF 85 (86)
Q Consensus 73 qsyqpPWKaLSdF 85 (86)
.+..|||.++++.
T Consensus 60 ~tvicpweaf~~~ 72 (83)
T PF04868_consen 60 ITVICPWEAFSHL 72 (83)
T ss_dssp HHTT-CCCCCTTT
T ss_pred eeEEcchHhhccc
Confidence 3456899999875
No 5
>PF15470 DUF4637: Domain of unknown function (DUF4637)
Probab=20.11 E-value=30 Score=26.29 Aligned_cols=37 Identities=27% Similarity=0.256 Sum_probs=22.5
Q ss_pred ccceeeeccCcCCCCCCCCcceeeecCCCcccCCCCC
Q psy4082 50 GIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDFR 86 (86)
Q Consensus 50 G~PmVAsSPvrhes~i~~~pveVqsyqpPWKaLSdFA 86 (86)
....|+-||.|++|+.+--.+.-.+=-.=|.=||+||
T Consensus 64 ergSVSY~PLRQEsStqqValLRRadsgFWgwlsPfa 100 (173)
T PF15470_consen 64 ERGSVSYCPLRQESSTQQVALLRRADSGFWGWLSPFA 100 (173)
T ss_pred cCCceecccccccchhhHHHHhhcccCCchhhhcHHH
Confidence 3557899999999976532222111112377777775
No 6
>PF07869 DUF1656: Protein of unknown function (DUF1656); InterPro: IPR012451 The proteins in this entry have no known function and belong to the AaeX family.
Probab=19.74 E-value=22 Score=21.69 Aligned_cols=14 Identities=29% Similarity=0.840 Sum_probs=10.9
Q ss_pred chhhhhhhhhhhhh
Q psy4082 3 AAGYYQLLWHRVSV 16 (86)
Q Consensus 3 ~~~~~~~~~~~~~~ 16 (86)
..|.|...||+-=.
T Consensus 33 r~~~~r~vWhp~Lf 46 (58)
T PF07869_consen 33 RLGLYRFVWHPALF 46 (58)
T ss_pred HhCcccccccHHHH
Confidence 46899999998543
No 7
>COG0339 Dcp Zn-dependent oligopeptidases [Amino acid transport and metabolism]
Probab=16.27 E-value=69 Score=28.86 Aligned_cols=12 Identities=58% Similarity=1.306 Sum_probs=10.9
Q ss_pred chhhhhhhhhhh
Q psy4082 3 AAGYYQLLWHRV 14 (86)
Q Consensus 3 ~~~~~~~~~~~~ 14 (86)
+||||..+|--|
T Consensus 611 sAGYYSY~WaeV 622 (683)
T COG0339 611 SAGYYSYLWAEV 622 (683)
T ss_pred cchhHHHHHHHH
Confidence 699999999877
No 8
>KOG1770|consensus
Probab=15.60 E-value=48 Score=23.77 Aligned_cols=17 Identities=47% Similarity=0.782 Sum_probs=13.5
Q ss_pred hhcCCCccccCcccccce
Q psy4082 36 ISMDGRKMGYGSMQGIPM 53 (86)
Q Consensus 36 Qqq~~~k~~~~gmtG~Pm 53 (86)
||.+|+|+ ++-.+|+|+
T Consensus 35 QQRnGrKt-lTtVQgi~~ 51 (112)
T KOG1770|consen 35 QQRNGRKT-LTTVQGIPM 51 (112)
T ss_pred EeeCCceE-EEEecCChh
Confidence 67788884 777889887
No 9
>PF12436 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-specific protease 7; InterPro: IPR024729 This domain is found in eukaryotes, and is approximately 40 amino acids in length. It is found in proteins of the peptidase C19 family, which contains contains ubiquitinyl hydrolases like ubiquitin-specific protease 7 (USP7). USP7 regulates the turnover of p53 [].; PDB: 2KVR_A 2YLM_A.
Probab=12.47 E-value=49 Score=24.99 Aligned_cols=19 Identities=37% Similarity=0.819 Sum_probs=16.2
Q ss_pred chhhhhhhhhhhhhhHhhh
Q psy4082 3 AAGYYQLLWHRVSVHFLAR 21 (86)
Q Consensus 3 ~~~~~~~~~~~~~~~~~~~ 21 (86)
+.-||..|-||+.|+|..+
T Consensus 166 v~~Yy~~l~nrv~V~f~~~ 184 (249)
T PF12436_consen 166 VKEYYDFLYNRVEVEFKPK 184 (249)
T ss_dssp HHHHHHHHHHEEEEEEEET
T ss_pred HHHHHHHHhCeEEEEEEEC
Confidence 4679999999999999764
No 10
>PRK14745 RepA leader peptide Tap; Provisional
Probab=11.58 E-value=1.1e+02 Score=16.84 Aligned_cols=9 Identities=44% Similarity=1.121 Sum_probs=6.2
Q ss_pred hhhhhhhhh
Q psy4082 6 YYQLLWHRV 14 (86)
Q Consensus 6 ~~~~~~~~~ 14 (86)
-|++|||-.
T Consensus 6 qylfl~hll 14 (26)
T PRK14745 6 QYLFLWHLL 14 (26)
T ss_pred HHHHHHHHH
Confidence 377888853
Done!