Query         psy4082
Match_columns 86
No_of_seqs    36 out of 38
Neff          3.1 
Searched_HMMs 46136
Date          Sat Aug 17 00:51:39 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4082.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4082hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1653|consensus               44.2     4.2 9.1E-05   31.0  -1.3   10    9-18    104-113 (175)
  2 PRK11594 efflux system membran  31.7      12 0.00026   24.4  -0.6   12    3-14     37-48  (67)
  3 PRK10280 dipeptidyl carboxypep  22.5      42  0.0009   29.3   1.0   13    3-15    609-621 (681)
  4 PF04868 PDE6_gamma:  Retinal c  21.5      47   0.001   22.7   0.9   13   73-85     60-72  (83)
  5 PF15470 DUF4637:  Domain of un  20.1      30 0.00065   26.3  -0.3   37   50-86     64-100 (173)
  6 PF07869 DUF1656:  Protein of u  19.7      22 0.00048   21.7  -0.9   14    3-16     33-46  (58)
  7 COG0339 Dcp Zn-dependent oligo  16.3      69  0.0015   28.9   0.9   12    3-14    611-622 (683)
  8 KOG1770|consensus               15.6      48   0.001   23.8  -0.2   17   36-53     35-51  (112)
  9 PF12436 USP7_ICP0_bdg:  ICP0-b  12.5      49  0.0011   25.0  -0.9   19    3-21    166-184 (249)
 10 PRK14745 RepA leader peptide T  11.6 1.1E+02  0.0024   16.8   0.6    9    6-14      6-14  (26)

No 1  
>KOG1653|consensus
Probab=44.23  E-value=4.2  Score=30.98  Aligned_cols=10  Identities=60%  Similarity=0.926  Sum_probs=8.2

Q ss_pred             hhhhhhhhhH
Q psy4082           9 LLWHRVSVHF   18 (86)
Q Consensus         9 ~~~~~~~~~~   18 (86)
                      --|||||||-
T Consensus       104 tqWHRVsVf~  113 (175)
T KOG1653|consen  104 TQWHRVSVFN  113 (175)
T ss_pred             ceeEEEEeeC
Confidence            3599999985


No 2  
>PRK11594 efflux system membrane protein; Provisional
Probab=31.72  E-value=12  Score=24.38  Aligned_cols=12  Identities=33%  Similarity=1.074  Sum_probs=10.3

Q ss_pred             chhhhhhhhhhh
Q psy4082           3 AAGYYQLLWHRV   14 (86)
Q Consensus         3 ~~~~~~~~~~~~   14 (86)
                      ..|.|++.||+-
T Consensus        37 r~g~YR~VWHpa   48 (67)
T PRK11594         37 PTGIYDFVWHPA   48 (67)
T ss_pred             HhCcceeeecHH
Confidence            469999999985


No 3  
>PRK10280 dipeptidyl carboxypeptidase II; Provisional
Probab=22.49  E-value=42  Score=29.32  Aligned_cols=13  Identities=54%  Similarity=1.170  Sum_probs=11.7

Q ss_pred             chhhhhhhhhhhh
Q psy4082           3 AAGYYQLLWHRVS   15 (86)
Q Consensus         3 ~~~~~~~~~~~~~   15 (86)
                      +||||-.+|-+|-
T Consensus       609 ~AgYYsYlwaevl  621 (681)
T PRK10280        609 AAGYYAYLWTQML  621 (681)
T ss_pred             chhhHHHHHHHHH
Confidence            6999999999984


No 4  
>PF04868 PDE6_gamma:  Retinal cGMP phosphodiesterase, gamma subunit;  InterPro: IPR006952 Retinal rod and cone cGMP phosphodiesterases function as the effector enzymes in the vertebrate visual transduction cascade. This family represents the inhibitory gamma subunit [], which is also expressed outside retinal tissues and has been shown to interact with the G-protein-coupled receptor kinase 2 signalling system to regulate the epidermal growth factor- and thrombin-dependent stimulation of p42/p44 mitogen-activated protein kinase in human embryonic kidney 293 cells [].; GO: 0004114 3',5'-cyclic-nucleotide phosphodiesterase activity, 0030553 cGMP binding, 0007601 visual perception; PDB: 2JU4_A 1FQJ_C 3JWR_D.
Probab=21.50  E-value=47  Score=22.71  Aligned_cols=13  Identities=31%  Similarity=0.687  Sum_probs=9.2

Q ss_pred             eecCCCcccCCCC
Q psy4082          73 TSYQPPWKALSDF   85 (86)
Q Consensus        73 qsyqpPWKaLSdF   85 (86)
                      .+..|||.++++.
T Consensus        60 ~tvicpweaf~~~   72 (83)
T PF04868_consen   60 ITVICPWEAFSHL   72 (83)
T ss_dssp             HHTT-CCCCCTTT
T ss_pred             eeEEcchHhhccc
Confidence            3456899999875


No 5  
>PF15470 DUF4637:  Domain of unknown function (DUF4637)
Probab=20.11  E-value=30  Score=26.29  Aligned_cols=37  Identities=27%  Similarity=0.256  Sum_probs=22.5

Q ss_pred             ccceeeeccCcCCCCCCCCcceeeecCCCcccCCCCC
Q psy4082          50 GIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDFR   86 (86)
Q Consensus        50 G~PmVAsSPvrhes~i~~~pveVqsyqpPWKaLSdFA   86 (86)
                      ....|+-||.|++|+.+--.+.-.+=-.=|.=||+||
T Consensus        64 ergSVSY~PLRQEsStqqValLRRadsgFWgwlsPfa  100 (173)
T PF15470_consen   64 ERGSVSYCPLRQESSTQQVALLRRADSGFWGWLSPFA  100 (173)
T ss_pred             cCCceecccccccchhhHHHHhhcccCCchhhhcHHH
Confidence            3557899999999976532222111112377777775


No 6  
>PF07869 DUF1656:  Protein of unknown function (DUF1656);  InterPro: IPR012451  The proteins in this entry have no known function and belong to the AaeX family.
Probab=19.74  E-value=22  Score=21.69  Aligned_cols=14  Identities=29%  Similarity=0.840  Sum_probs=10.9

Q ss_pred             chhhhhhhhhhhhh
Q psy4082           3 AAGYYQLLWHRVSV   16 (86)
Q Consensus         3 ~~~~~~~~~~~~~~   16 (86)
                      ..|.|...||+-=.
T Consensus        33 r~~~~r~vWhp~Lf   46 (58)
T PF07869_consen   33 RLGLYRFVWHPALF   46 (58)
T ss_pred             HhCcccccccHHHH
Confidence            46899999998543


No 7  
>COG0339 Dcp Zn-dependent oligopeptidases [Amino acid transport and metabolism]
Probab=16.27  E-value=69  Score=28.86  Aligned_cols=12  Identities=58%  Similarity=1.306  Sum_probs=10.9

Q ss_pred             chhhhhhhhhhh
Q psy4082           3 AAGYYQLLWHRV   14 (86)
Q Consensus         3 ~~~~~~~~~~~~   14 (86)
                      +||||..+|--|
T Consensus       611 sAGYYSY~WaeV  622 (683)
T COG0339         611 SAGYYSYLWAEV  622 (683)
T ss_pred             cchhHHHHHHHH
Confidence            699999999877


No 8  
>KOG1770|consensus
Probab=15.60  E-value=48  Score=23.77  Aligned_cols=17  Identities=47%  Similarity=0.782  Sum_probs=13.5

Q ss_pred             hhcCCCccccCcccccce
Q psy4082          36 ISMDGRKMGYGSMQGIPM   53 (86)
Q Consensus        36 Qqq~~~k~~~~gmtG~Pm   53 (86)
                      ||.+|+|+ ++-.+|+|+
T Consensus        35 QQRnGrKt-lTtVQgi~~   51 (112)
T KOG1770|consen   35 QQRNGRKT-LTTVQGIPM   51 (112)
T ss_pred             EeeCCceE-EEEecCChh
Confidence            67788884 777889887


No 9  
>PF12436 USP7_ICP0_bdg:  ICP0-binding domain of Ubiquitin-specific protease 7;  InterPro: IPR024729 This domain is found in eukaryotes, and is approximately 40 amino acids in length. It is found in proteins of the peptidase C19 family, which contains contains ubiquitinyl hydrolases like ubiquitin-specific protease 7 (USP7). USP7 regulates the turnover of p53 [].; PDB: 2KVR_A 2YLM_A.
Probab=12.47  E-value=49  Score=24.99  Aligned_cols=19  Identities=37%  Similarity=0.819  Sum_probs=16.2

Q ss_pred             chhhhhhhhhhhhhhHhhh
Q psy4082           3 AAGYYQLLWHRVSVHFLAR   21 (86)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~   21 (86)
                      +.-||..|-||+.|+|..+
T Consensus       166 v~~Yy~~l~nrv~V~f~~~  184 (249)
T PF12436_consen  166 VKEYYDFLYNRVEVEFKPK  184 (249)
T ss_dssp             HHHHHHHHHHEEEEEEEET
T ss_pred             HHHHHHHHhCeEEEEEEEC
Confidence            4679999999999999764


No 10 
>PRK14745 RepA leader peptide Tap; Provisional
Probab=11.58  E-value=1.1e+02  Score=16.84  Aligned_cols=9  Identities=44%  Similarity=1.121  Sum_probs=6.2

Q ss_pred             hhhhhhhhh
Q psy4082           6 YYQLLWHRV   14 (86)
Q Consensus         6 ~~~~~~~~~   14 (86)
                      -|++|||-.
T Consensus         6 qylfl~hll   14 (26)
T PRK14745          6 QYLFLWHLL   14 (26)
T ss_pred             HHHHHHHHH
Confidence            377888853


Done!