BLAST Results

Query Summary

Your job contains 1 sequence.

Parameters
Threshold: 0.001
Maximum number of alignments shown: 100
BLAST filter: on

Query Sequence

>psy4082
MRAAGYYQLLWHRVSVHFLARVGIMVNAPLRTLLFISMDGRKMGYGSMQGIPMVASSPVR
HDSPIGMNALEVTSYQPPWKALSDFR

High Scoring Gene Products

Symbol, full name Information P value
tup
tailup
protein from Drosophila melanogaster 5.1e-16
ISL1
Insulin gene enhancer protein ISL-1
protein from Homo sapiens 6.4e-09
ISL2
Uncharacterized protein
protein from Canis lupus familiaris 9.7e-09
ISL2
Insulin gene enhancer protein ISL-2
protein from Gallus gallus 1.1e-08
ISL1
Insulin gene enhancer protein ISL-1
protein from Gallus gallus 1.4e-08
ISL1
ISL1 protein
protein from Bos taurus 1.4e-08
ISL1
Insulin gene enhancer protein ISL-1
protein from Homo sapiens 1.4e-08
Isl1
ISL1 transcription factor, LIM/homeodomain
protein from Mus musculus 1.4e-08
Isl1
ISL LIM homeobox 1
gene from Rattus norvegicus 1.4e-08
isl1
islet1
gene_product from Danio rerio 1.4e-08
ISL1
Uncharacterized protein
protein from Canis lupus familiaris 1.5e-08
LOC100511417
Uncharacterized protein
protein from Sus scrofa 1.5e-08
isl2a
islet2a
gene_product from Danio rerio 4.1e-08
ISL2
Uncharacterized protein
protein from Bos taurus 5.3e-08
ISL2
Insulin gene enhancer protein ISL-2
protein from Homo sapiens 1.1e-07
Isl2
insulin related protein 2 (islet 2)
protein from Mus musculus 1.1e-07
isl2b
islet2b
gene_product from Danio rerio 2.3e-06
Isl2
ISL LIM homeobox 2
gene from Rattus norvegicus 1.7e-05
Isl2
Insulin gene enhancer protein ISL-2
protein from Rattus norvegicus 1.7e-05

The BLAST search returned 2 gene products which did not match your query constraints. Please see the full BLAST report below for the details.

Back to top

Raw Blast Data

BLASTP 2.0MP-WashU [04-May-2006] [linux26-i686-ILP32F64 2006-05-09T11:47:08]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  psy4082
        (86 letters)

Database:  go_20130330-seqdb.fasta
           368,745 sequences; 169,044,731 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

FB|FBgn0003896 - symbol:tup "tailup" species:7227 "Drosop...   208  5.1e-16   1
UNIPROTKB|D6RAK3 - symbol:ISL1 "Insulin gene enhancer pro...   136  6.4e-09   1
UNIPROTKB|J9P914 - symbol:ISL2 "Uncharacterized protein" ...   131  9.7e-09   1
UNIPROTKB|F1N959 - symbol:F1N959 "Uncharacterized protein...   136  1.0e-08   1
UNIPROTKB|P53410 - symbol:ISL2 "Insulin gene enhancer pro...   136  1.1e-08   1
UNIPROTKB|E1BWH2 - symbol:E1BWH2 "Uncharacterized protein...   136  1.3e-08   1
UNIPROTKB|P50211 - symbol:ISL1 "Insulin gene enhancer pro...   136  1.4e-08   1
UNIPROTKB|A6H796 - symbol:ISL1 "ISL1 protein" species:991...   136  1.4e-08   1
UNIPROTKB|P61371 - symbol:ISL1 "Insulin gene enhancer pro...   136  1.4e-08   1
MGI|MGI:101791 - symbol:Isl1 "ISL1 transcription factor, ...   136  1.4e-08   1
RGD|61957 - symbol:Isl1 "ISL LIM homeobox 1" species:1011...   136  1.4e-08   1
ZFIN|ZDB-GENE-980526-112 - symbol:isl1 "islet1" species:7...   136  1.4e-08   1
UNIPROTKB|F1PP21 - symbol:ISL1 "Uncharacterized protein" ...   136  1.5e-08   1
UNIPROTKB|F1SMF7 - symbol:ISL1 "Uncharacterized protein" ...   136  1.5e-08   1
ZFIN|ZDB-GENE-980526-562 - symbol:isl2a "islet2a" species...   132  4.1e-08   1
UNIPROTKB|E1BM60 - symbol:ISL2 "Uncharacterized protein" ...   131  5.3e-08   1
UNIPROTKB|Q96A47 - symbol:ISL2 "Insulin gene enhancer pro...   128  1.1e-07   1
MGI|MGI:109156 - symbol:Isl2 "insulin related protein 2 (...   128  1.1e-07   1
ZFIN|ZDB-GENE-990415-133 - symbol:isl2b "islet2b" species...   116  2.3e-06   1
RGD|621849 - symbol:Isl2 "ISL LIM homeobox 2" species:101...   108  1.7e-05   1
UNIPROTKB|P50480 - symbol:Isl2 "Insulin gene enhancer pro...   108  1.7e-05   1


>FB|FBgn0003896 [details] [associations]
            symbol:tup "tailup" species:7227 "Drosophila melanogaster"
            [GO:0008293 "torso signaling pathway" evidence=IGI] [GO:0007362
            "terminal region determination" evidence=IGI] [GO:0007390
            "germ-band shortening" evidence=IMP] [GO:0008258 "head involution"
            evidence=NAS] [GO:0046665 "amnioserosa maintenance" evidence=IMP]
            [GO:0007411 "axon guidance" evidence=IMP] [GO:0005634 "nucleus"
            evidence=IDA] [GO:0008270 "zinc ion binding" evidence=IEA]
            [GO:0008045 "motor neuron axon guidance" evidence=IMP] [GO:0000977
            "RNA polymerase II regulatory region sequence-specific DNA binding"
            evidence=IDA] [GO:0001102 "RNA polymerase II activating
            transcription factor binding" evidence=IPI] [GO:0007391 "dorsal
            closure" evidence=IMP] [GO:0008407 "chaeta morphogenesis"
            evidence=IMP] [GO:0005515 "protein binding" evidence=IPI]
            [GO:0043433 "negative regulation of sequence-specific DNA binding
            transcription factor activity" evidence=IDA] [GO:0070983 "dendrite
            guidance" evidence=IMP] [GO:0035310 "notum cell fate specification"
            evidence=IMP] [GO:0045944 "positive regulation of transcription
            from RNA polymerase II promoter" evidence=IDA] [GO:0007507 "heart
            development" evidence=IMP] [GO:0000980 "RNA polymerase II distal
            enhancer sequence-specific DNA binding" evidence=IDA] [GO:0048542
            "lymph gland development" evidence=IMP] [GO:0003705 "RNA polymerase
            II distal enhancer sequence-specific DNA binding transcription
            factor activity" evidence=IDA] [GO:0022416 "chaeta development"
            evidence=IMP] [GO:0007521 "muscle cell fate determination"
            evidence=IMP] Pfam:PF00412 InterPro:IPR001356 InterPro:IPR001781
            InterPro:IPR009057 InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027
            PROSITE:PS00478 PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132
            SMART:SM00389 GO:GO:0005634 GO:GO:0007507 GO:GO:0046872
            GO:GO:0007391 GO:GO:0008293 GO:GO:0008270 GO:GO:0045944
            Gene3D:1.10.10.60 SUPFAM:SSF46689 GO:GO:0003705 GO:GO:0000980
            Gene3D:2.10.110.10 GO:GO:0008045 GO:GO:0043433 GO:GO:0048542
            GO:GO:0035310 GO:GO:0008407 eggNOG:NOG264882 GO:GO:0007362
            GO:GO:0070983 GO:GO:0008258 GO:GO:0007390 GO:GO:0007521 HSSP:P50480
            GO:GO:0046665 EMBL:U89385 ProteinModelPortal:P92031 SMR:P92031
            STRING:P92031 PRIDE:P92031 FlyBase:FBgn0003896 InParanoid:P92031
            OrthoDB:EOG45DV52 ArrayExpress:P92031 Bgee:P92031 Uniprot:P92031
        Length = 534

 Score = 208 (78.3 bits), Expect = 5.1e-16, P = 5.1e-16
 Identities = 35/47 (74%), Positives = 43/47 (91%)

Query:    39 DGRKMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             +GRK+GYG+MQGIPM+ASSPVRHDSP+ +  L+V +YQPPWKALSDF
Sbjct:   312 EGRKLGYGAMQGIPMIASSPVRHDSPLNLQGLDVQTYQPPWKALSDF 358


>UNIPROTKB|D6RAK3 [details] [associations]
            symbol:ISL1 "Insulin gene enhancer protein ISL-1"
            species:9606 "Homo sapiens" [GO:0003700 "sequence-specific DNA
            binding transcription factor activity" evidence=IEA] [GO:0008270
            "zinc ion binding" evidence=IEA] [GO:0043565 "sequence-specific DNA
            binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA]
            Pfam:PF00412 InterPro:IPR001356 InterPro:IPR001781
            InterPro:IPR009057 InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027
            PROSITE:PS00478 PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132
            SMART:SM00389 GO:GO:0005634 GO:GO:0046872 GO:GO:0043565
            GO:GO:0008270 GO:GO:0003700 Gene3D:1.10.10.60 SUPFAM:SSF46689
            Gene3D:2.10.110.10 HGNC:HGNC:6132 EMBL:AC010478 IPI:IPI00966565
            Ensembl:ENST00000505475 Bgee:D6RAK3 Uniprot:D6RAK3
        Length = 260

 Score = 136 (52.9 bits), Expect = 6.4e-09, P = 6.4e-09
 Identities = 26/44 (59%), Positives = 29/44 (65%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDF
Sbjct:   190 KTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDF 233


>UNIPROTKB|J9P914 [details] [associations]
            symbol:ISL2 "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0005634 "nucleus" evidence=IEA] [GO:0043565
            "sequence-specific DNA binding" evidence=IEA] [GO:0003700
            "sequence-specific DNA binding transcription factor activity"
            evidence=IEA] InterPro:IPR001356 InterPro:IPR009057
            InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027 PROSITE:PS50071
            SMART:SM00389 GO:GO:0005634 GO:GO:0043565 GO:GO:0003700
            Gene3D:1.10.10.60 SUPFAM:SSF46689 GeneTree:ENSGT00700000104050
            EMBL:AAEX03016371 Ensembl:ENSCAFT00000046950 Uniprot:J9P914
        Length = 113

 Score = 131 (51.2 bits), Expect = 9.7e-09, P = 9.7e-09
 Identities = 23/44 (52%), Positives = 32/44 (72%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     + G P+VA SP+RH+S +  +A+EV +YQPPWKALS+F
Sbjct:    45 KTSLQGLTGTPLVAGSPIRHESAVQGSAVEVQTYQPPWKALSEF 88


>UNIPROTKB|F1N959 [details] [associations]
            symbol:F1N959 "Uncharacterized protein" species:9031
            "Gallus gallus" [GO:0003700 "sequence-specific DNA binding
            transcription factor activity" evidence=IEA] [GO:0008270 "zinc ion
            binding" evidence=IEA] [GO:0043565 "sequence-specific DNA binding"
            evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] Pfam:PF00412
            InterPro:IPR001356 InterPro:IPR001781 InterPro:IPR009057
            InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027 PROSITE:PS00478
            PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132 SMART:SM00389
            GO:GO:0005634 GO:GO:0046872 GO:GO:0043565 GO:GO:0008270
            GO:GO:0003700 Gene3D:1.10.10.60 SUPFAM:SSF46689 Gene3D:2.10.110.10
            GeneTree:ENSGT00700000104050 EMBL:AADN02072754 EMBL:AADN02072755
            EMBL:AADN02072756 EMBL:AADN02072757 EMBL:AADN02072758
            IPI:IPI00819883 Ensembl:ENSGALT00000024015 ArrayExpress:F1N959
            Uniprot:F1N959
        Length = 303

 Score = 136 (52.9 bits), Expect = 1.0e-08, P = 1.0e-08
 Identities = 26/44 (59%), Positives = 29/44 (65%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDF
Sbjct:   206 KTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDF 249


>UNIPROTKB|P53410 [details] [associations]
            symbol:ISL2 "Insulin gene enhancer protein ISL-2"
            species:9031 "Gallus gallus" [GO:0003700 "sequence-specific DNA
            binding transcription factor activity" evidence=IEA] [GO:0008270
            "zinc ion binding" evidence=IEA] [GO:0043565 "sequence-specific DNA
            binding" evidence=IEA] [GO:0007275 "multicellular organismal
            development" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA]
            Pfam:PF00412 InterPro:IPR001356 InterPro:IPR001781
            InterPro:IPR009057 InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027
            PROSITE:PS00478 PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132
            SMART:SM00389 GO:GO:0007275 GO:GO:0005634 GO:GO:0046872
            GO:GO:0043565 GO:GO:0008270 GO:GO:0003700 Gene3D:1.10.10.60
            SUPFAM:SSF46689 Gene3D:2.10.110.10 HOVERGEN:HBG004671 EMBL:L35568
            IPI:IPI00574086 PIR:I50370 UniGene:Gga.790
            ProteinModelPortal:P53410 SMR:P53410 Uniprot:P53410
        Length = 319

 Score = 136 (52.9 bits), Expect = 1.1e-08, P = 1.1e-08
 Identities = 25/44 (56%), Positives = 32/44 (72%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     + G P+VA SPVRH+S +  +A+EV +YQPPWKALSDF
Sbjct:   223 KTSLQGLTGTPLVAGSPVRHESAVQGSAVEVQTYQPPWKALSDF 266


>UNIPROTKB|E1BWH2 [details] [associations]
            symbol:E1BWH2 "Uncharacterized protein" species:9031
            "Gallus gallus" [GO:0003700 "sequence-specific DNA binding
            transcription factor activity" evidence=IEA] [GO:0008270 "zinc ion
            binding" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA]
            [GO:0000122 "negative regulation of transcription from RNA
            polymerase II promoter" evidence=IEA] [GO:0001102 "RNA polymerase
            II activating transcription factor binding" evidence=IEA]
            [GO:0001105 "RNA polymerase II transcription coactivator activity"
            evidence=IEA] [GO:0001158 "enhancer sequence-specific DNA binding"
            evidence=IEA] [GO:0001755 "neural crest cell migration"
            evidence=IEA] [GO:0003139 "secondary heart field specification"
            evidence=IEA] [GO:0003148 "outflow tract septum morphogenesis"
            evidence=IEA] [GO:0003203 "endocardial cushion morphogenesis"
            evidence=IEA] [GO:0003215 "cardiac right ventricle morphogenesis"
            evidence=IEA] [GO:0003266 "regulation of secondary heart field
            cardioblast proliferation" evidence=IEA] [GO:0003682 "chromatin
            binding" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0010575 "positive regulation
            vascular endothelial growth factor production" evidence=IEA]
            [GO:0021520 "spinal cord motor neuron cell fate specification"
            evidence=IEA] [GO:0021524 "visceral motor neuron differentiation"
            evidence=IEA] [GO:0021559 "trigeminal nerve development"
            evidence=IEA] [GO:0021983 "pituitary gland development"
            evidence=IEA] [GO:0031016 "pancreas development" evidence=IEA]
            [GO:0031290 "retinal ganglion cell axon guidance" evidence=IEA]
            [GO:0032725 "positive regulation of granulocyte macrophage
            colony-stimulating factor production" evidence=IEA] [GO:0032729
            "positive regulation of interferon-gamma production" evidence=IEA]
            [GO:0032730 "positive regulation of interleukin-1 alpha production"
            evidence=IEA] [GO:0032731 "positive regulation of interleukin-1
            beta production" evidence=IEA] [GO:0032735 "positive regulation of
            interleukin-12 production" evidence=IEA] [GO:0032755 "positive
            regulation of interleukin-6 production" evidence=IEA] [GO:0032760
            "positive regulation of tumor necrosis factor production"
            evidence=IEA] [GO:0042517 "positive regulation of tyrosine
            phosphorylation of Stat3 protein" evidence=IEA] [GO:0043388
            "positive regulation of DNA binding" evidence=IEA] [GO:0043425
            "bHLH transcription factor binding" evidence=IEA] [GO:0043524
            "negative regulation of neuron apoptotic process" evidence=IEA]
            [GO:0045665 "negative regulation of neuron differentiation"
            evidence=IEA] [GO:0045766 "positive regulation of angiogenesis"
            evidence=IEA] [GO:0048880 "sensory system development"
            evidence=IEA] [GO:0048936 "peripheral nervous system neuron
            axonogenesis" evidence=IEA] [GO:0050728 "negative regulation of
            inflammatory response" evidence=IEA] [GO:0055010 "ventricular
            cardiac muscle tissue morphogenesis" evidence=IEA] [GO:0060037
            "pharyngeal system development" evidence=IEA] [GO:0060379 "cardiac
            muscle cell myoblast differentiation" evidence=IEA] [GO:0060384
            "innervation" evidence=IEA] [GO:0060413 "atrial septum
            morphogenesis" evidence=IEA] [GO:0060913 "cardiac cell fate
            determination" evidence=IEA] [GO:0071657 "positive regulation of
            granulocyte colony-stimulating factor production" evidence=IEA]
            [GO:0090090 "negative regulation of canonical Wnt receptor
            signaling pathway" evidence=IEA] Pfam:PF00412 InterPro:IPR001356
            InterPro:IPR001781 InterPro:IPR009057 InterPro:IPR017970
            Pfam:PF00046 PROSITE:PS00027 PROSITE:PS00478 PROSITE:PS50023
            PROSITE:PS50071 SMART:SM00132 SMART:SM00389 GO:GO:0005634
            GO:GO:0046872 GO:GO:0008284 GO:GO:0008270 GO:GO:0043524
            GO:GO:0003700 GO:GO:0003682 Gene3D:1.10.10.60 SUPFAM:SSF46689
            GO:GO:0000122 Gene3D:2.10.110.10 GO:GO:0090090 GO:GO:0001105
            GO:GO:0001158 GO:GO:0042517 GeneTree:ENSGT00700000104050
            GO:GO:0043388 GO:GO:0003266 IPI:IPI00598855 OMA:TDMGDMG
            EMBL:AADN02072754 EMBL:AADN02072755 EMBL:AADN02072756
            EMBL:AADN02072757 EMBL:AADN02072758 Ensembl:ENSGALT00000038907
            ArrayExpress:E1BWH2 Uniprot:E1BWH2
        Length = 339

 Score = 136 (52.9 bits), Expect = 1.3e-08, P = 1.3e-08
 Identities = 26/44 (59%), Positives = 29/44 (65%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDF
Sbjct:   244 KTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDF 287


>UNIPROTKB|P50211 [details] [associations]
            symbol:ISL1 "Insulin gene enhancer protein ISL-1"
            species:9031 "Gallus gallus" [GO:0003700 "sequence-specific DNA
            binding transcription factor activity" evidence=IEA] [GO:0008270
            "zinc ion binding" evidence=IEA] [GO:0043565 "sequence-specific DNA
            binding" evidence=IEA] [GO:0007275 "multicellular organismal
            development" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA]
            [GO:0045892 "negative regulation of transcription, DNA-dependent"
            evidence=IDA] Pfam:PF00412 InterPro:IPR001356 InterPro:IPR001781
            InterPro:IPR009057 InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027
            PROSITE:PS00478 PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132
            SMART:SM00389 GO:GO:0007275 GO:GO:0005634 GO:GO:0045892
            GO:GO:0046872 GO:GO:0043565 GO:GO:0008270 GO:GO:0003700
            Gene3D:1.10.10.60 SUPFAM:SSF46689 Gene3D:2.10.110.10 EMBL:L35567
            IPI:IPI00598855 PIR:I50369 RefSeq:NP_990745.1 UniGene:Gga.1507
            ProteinModelPortal:P50211 SMR:P50211 GeneID:396383 KEGG:gga:396383
            CTD:3670 HOVERGEN:HBG004671 KO:K09370 NextBio:20816425
            Uniprot:P50211
        Length = 349

 Score = 136 (52.9 bits), Expect = 1.4e-08, P = 1.4e-08
 Identities = 26/44 (59%), Positives = 29/44 (65%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDF
Sbjct:   254 KTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDF 297


>UNIPROTKB|A6H796 [details] [associations]
            symbol:ISL1 "ISL1 protein" species:9913 "Bos taurus"
            [GO:0005634 "nucleus" evidence=IEA] [GO:0090090 "negative
            regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0071657 "positive regulation of granulocyte
            colony-stimulating factor production" evidence=IEA] [GO:0060913
            "cardiac cell fate determination" evidence=IEA] [GO:0060413 "atrial
            septum morphogenesis" evidence=IEA] [GO:0060384 "innervation"
            evidence=IEA] [GO:0060379 "cardiac muscle cell myoblast
            differentiation" evidence=IEA] [GO:0060037 "pharyngeal system
            development" evidence=IEA] [GO:0055010 "ventricular cardiac muscle
            tissue morphogenesis" evidence=IEA] [GO:0050728 "negative
            regulation of inflammatory response" evidence=IEA] [GO:0048936
            "peripheral nervous system neuron axonogenesis" evidence=IEA]
            [GO:0048880 "sensory system development" evidence=IEA] [GO:0045766
            "positive regulation of angiogenesis" evidence=IEA] [GO:0045665
            "negative regulation of neuron differentiation" evidence=IEA]
            [GO:0043524 "negative regulation of neuron apoptotic process"
            evidence=IEA] [GO:0043425 "bHLH transcription factor binding"
            evidence=IEA] [GO:0043388 "positive regulation of DNA binding"
            evidence=IEA] [GO:0042517 "positive regulation of tyrosine
            phosphorylation of Stat3 protein" evidence=IEA] [GO:0032760
            "positive regulation of tumor necrosis factor production"
            evidence=IEA] [GO:0032755 "positive regulation of interleukin-6
            production" evidence=IEA] [GO:0032735 "positive regulation of
            interleukin-12 production" evidence=IEA] [GO:0032731 "positive
            regulation of interleukin-1 beta production" evidence=IEA]
            [GO:0032730 "positive regulation of interleukin-1 alpha production"
            evidence=IEA] [GO:0032729 "positive regulation of interferon-gamma
            production" evidence=IEA] [GO:0032725 "positive regulation of
            granulocyte macrophage colony-stimulating factor production"
            evidence=IEA] [GO:0031290 "retinal ganglion cell axon guidance"
            evidence=IEA] [GO:0031016 "pancreas development" evidence=IEA]
            [GO:0021983 "pituitary gland development" evidence=IEA] [GO:0021559
            "trigeminal nerve development" evidence=IEA] [GO:0021524 "visceral
            motor neuron differentiation" evidence=IEA] [GO:0021520 "spinal
            cord motor neuron cell fate specification" evidence=IEA]
            [GO:0010575 "positive regulation vascular endothelial growth factor
            production" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0003682 "chromatin binding"
            evidence=IEA] [GO:0003266 "regulation of secondary heart field
            cardioblast proliferation" evidence=IEA] [GO:0003215 "cardiac right
            ventricle morphogenesis" evidence=IEA] [GO:0003203 "endocardial
            cushion morphogenesis" evidence=IEA] [GO:0003148 "outflow tract
            septum morphogenesis" evidence=IEA] [GO:0003139 "secondary heart
            field specification" evidence=IEA] [GO:0001755 "neural crest cell
            migration" evidence=IEA] [GO:0001158 "enhancer sequence-specific
            DNA binding" evidence=IEA] [GO:0001105 "RNA polymerase II
            transcription coactivator activity" evidence=IEA] [GO:0001102 "RNA
            polymerase II activating transcription factor binding"
            evidence=IEA] [GO:0000122 "negative regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0008270 "zinc
            ion binding" evidence=IEA] [GO:0003700 "sequence-specific DNA
            binding transcription factor activity" evidence=IEA] Pfam:PF00412
            InterPro:IPR001356 InterPro:IPR001781 InterPro:IPR009057
            InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027 PROSITE:PS00478
            PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132 SMART:SM00389
            GO:GO:0005634 GO:GO:0046872 GO:GO:0008284 GO:GO:0001755
            GO:GO:0008270 GO:GO:0045665 GO:GO:0043524 GO:GO:0003700
            GO:GO:0003682 Gene3D:1.10.10.60 SUPFAM:SSF46689 GO:GO:0000122
            Gene3D:2.10.110.10 GO:GO:0060037 GO:GO:0090090 GO:GO:0031016
            GO:GO:0021983 GO:GO:0001105 GO:GO:0021559 GO:GO:0001158
            GO:GO:0042517 GeneTree:ENSGT00700000104050 GO:GO:0055010
            GO:GO:0003203 GO:GO:0003139 GO:GO:0031290 GO:GO:0043388
            GO:GO:0060413 GO:GO:0003266 eggNOG:COG5576 GO:GO:0003148
            GO:GO:0003215 GO:GO:0060384 GO:GO:0021520 CTD:3670
            HOVERGEN:HBG004671 KO:K09370 HOGENOM:HOG000236304 OMA:TDMGDMG
            OrthoDB:EOG4G4GQR GO:GO:0048936 GO:GO:0060913 GO:GO:0060379
            GO:GO:0048880 GO:GO:0021524 EMBL:DAAA02050419 EMBL:BC146163
            IPI:IPI00854388 RefSeq:NP_001092600.1 UniGene:Bt.28168 SMR:A6H796
            STRING:A6H796 Ensembl:ENSBTAT00000001638 GeneID:614040
            KEGG:bta:614040 InParanoid:A6H796 NextBio:20898906 Uniprot:A6H796
        Length = 349

 Score = 136 (52.9 bits), Expect = 1.4e-08, P = 1.4e-08
 Identities = 26/44 (59%), Positives = 29/44 (65%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDF
Sbjct:   254 KTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDF 297


>UNIPROTKB|P61371 [details] [associations]
            symbol:ISL1 "Insulin gene enhancer protein ISL-1"
            species:9606 "Homo sapiens" [GO:0003700 "sequence-specific DNA
            binding transcription factor activity" evidence=IEA] [GO:0008270
            "zinc ion binding" evidence=IEA] [GO:0001755 "neural crest cell
            migration" evidence=IEA] [GO:0003266 "regulation of secondary heart
            field cardioblast proliferation" evidence=IEA] [GO:0003682
            "chromatin binding" evidence=IEA] [GO:0008284 "positive regulation
            of cell proliferation" evidence=IEA] [GO:0021520 "spinal cord motor
            neuron cell fate specification" evidence=IEA] [GO:0021524 "visceral
            motor neuron differentiation" evidence=IEA] [GO:0021983 "pituitary
            gland development" evidence=IEA] [GO:0031103 "axon regeneration"
            evidence=IEA] [GO:0031290 "retinal ganglion cell axon guidance"
            evidence=IEA] [GO:0042517 "positive regulation of tyrosine
            phosphorylation of Stat3 protein" evidence=IEA] [GO:0043388
            "positive regulation of DNA binding" evidence=IEA] [GO:0045665
            "negative regulation of neuron differentiation" evidence=IEA]
            [GO:0060379 "cardiac muscle cell myoblast differentiation"
            evidence=IEA] [GO:0090090 "negative regulation of canonical Wnt
            receptor signaling pathway" evidence=IEA] [GO:0003203 "endocardial
            cushion morphogenesis" evidence=ISS] [GO:0010575 "positive
            regulation vascular endothelial growth factor production"
            evidence=ISS] [GO:0032729 "positive regulation of interferon-gamma
            production" evidence=ISS] [GO:0032731 "positive regulation of
            interleukin-1 beta production" evidence=ISS] [GO:0032755 "positive
            regulation of interleukin-6 production" evidence=ISS] [GO:0045766
            "positive regulation of angiogenesis" evidence=ISS] [GO:0071657
            "positive regulation of granulocyte colony-stimulating factor
            production" evidence=ISS] [GO:0005737 "cytoplasm" evidence=NAS]
            [GO:0001158 "enhancer sequence-specific DNA binding"
            evidence=IDA;NAS] [GO:0005634 "nucleus" evidence=NAS] [GO:0021522
            "spinal cord motor neuron differentiation" evidence=ISS]
            [GO:0048762 "mesenchymal cell differentiation" evidence=ISS]
            [GO:0031016 "pancreas development" evidence=ISS] [GO:1901258
            "positive regulation of macrophage colony-stimulating factor
            production" evidence=ISS] [GO:0032725 "positive regulation of
            granulocyte macrophage colony-stimulating factor production"
            evidence=ISS] [GO:0032730 "positive regulation of interleukin-1
            alpha production" evidence=ISS] [GO:0032735 "positive regulation of
            interleukin-12 production" evidence=ISS] [GO:0032760 "positive
            regulation of tumor necrosis factor production" evidence=ISS]
            [GO:0050728 "negative regulation of inflammatory response"
            evidence=ISS] [GO:0045944 "positive regulation of transcription
            from RNA polymerase II promoter" evidence=ISS] [GO:0000122
            "negative regulation of transcription from RNA polymerase II
            promoter" evidence=ISS] [GO:0048936 "peripheral nervous system
            neuron axonogenesis" evidence=ISS] [GO:0048665 "neuron fate
            specification" evidence=ISS] [GO:0021559 "trigeminal nerve
            development" evidence=ISS] [GO:0043524 "negative regulation of
            neuron apoptotic process" evidence=ISS] [GO:0048880 "sensory system
            development" evidence=ISS] [GO:0060384 "innervation" evidence=ISS]
            [GO:0060413 "atrial septum morphogenesis" evidence=ISS] [GO:0060037
            "pharyngeal system development" evidence=ISS] [GO:0055010
            "ventricular cardiac muscle tissue morphogenesis" evidence=ISS]
            [GO:0003215 "cardiac right ventricle morphogenesis" evidence=ISS]
            [GO:0003151 "outflow tract morphogenesis" evidence=ISS] [GO:0003148
            "outflow tract septum morphogenesis" evidence=ISS] [GO:0003139
            "secondary heart field specification" evidence=IMP] [GO:0043425
            "bHLH transcription factor binding" evidence=IPI] [GO:0001105 "RNA
            polymerase II transcription coactivator activity" evidence=IDA]
            [GO:0001102 "RNA polymerase II activating transcription factor
            binding" evidence=IPI] [GO:0060913 "cardiac cell fate
            determination" evidence=IDA] [GO:0071385 "cellular response to
            glucocorticoid stimulus" evidence=ISS] [GO:0032024 "positive
            regulation of insulin secretion" evidence=IC] [GO:0090074 "negative
            regulation of protein homodimerization activity" evidence=ISS]
            [GO:0033147 "negative regulation of intracellular estrogen receptor
            signaling pathway" evidence=ISS] [GO:0030331 "estrogen receptor
            binding" evidence=ISS] [GO:0016922 "ligand-dependent nuclear
            receptor binding" evidence=ISS] Pfam:PF00412 InterPro:IPR001356
            InterPro:IPR001781 InterPro:IPR009057 InterPro:IPR017970
            Pfam:PF00046 PROSITE:PS00027 PROSITE:PS00478 PROSITE:PS50023
            PROSITE:PS50071 SMART:SM00132 SMART:SM00389 GO:GO:0005634
            GO:GO:0005737 GO:GO:0046872 GO:GO:0008284 GO:GO:0001755
            GO:GO:0050728 GO:GO:0008270 GO:GO:0071385 GO:GO:0045665
            GO:GO:0043524 GO:GO:0032755 GO:GO:0010575 GO:GO:0032024
            GO:GO:0003700 GO:GO:0045766 GO:GO:0003682 Gene3D:1.10.10.60
            SUPFAM:SSF46689 GO:GO:0000122 Gene3D:2.10.110.10 GO:GO:0021522
            GO:GO:0060037 GO:GO:0090090 GO:GO:0032731 GO:GO:0031016
            GO:GO:0021983 GO:GO:0001105 GO:GO:0030331 GO:GO:0021559
            GO:GO:0001158 GO:GO:0042517 GO:GO:0048665 GO:GO:0032729
            GO:GO:0032760 GO:GO:0016922 GO:GO:0031103 GO:GO:0055010
            GO:GO:0003203 GO:GO:0048762 GO:GO:0003139 GO:GO:0031290
            GO:GO:0043388 GO:GO:0032730 GO:GO:0032735 GO:GO:0071657
            GO:GO:0060413 GO:GO:0033147 GO:GO:0003266 eggNOG:COG5576
            GO:GO:0003148 GO:GO:0003215 GO:GO:0060384 GO:GO:0021520
            GO:GO:0032725 CTD:3670 HOVERGEN:HBG004671 KO:K09370
            HOGENOM:HOG000236304 OMA:TDMGDMG OrthoDB:EOG4G4GQR GO:GO:0048936
            EMBL:S70721 EMBL:U07559 EMBL:BC031213 IPI:IPI00025071 PIR:I53277
            RefSeq:NP_002193.2 UniGene:Hs.505 ProteinModelPortal:P61371
            SMR:P61371 IntAct:P61371 STRING:P61371 PhosphoSite:P61371
            DMDM:47606423 PRIDE:P61371 DNASU:3670 Ensembl:ENST00000230658
            GeneID:3670 KEGG:hsa:3670 UCSC:uc003jor.3 GeneCards:GC05P050714
            HGNC:HGNC:6132 MIM:600366 neXtProt:NX_P61371 PharmGKB:PA29932
            InParanoid:P61371 PhylomeDB:P61371 GenomeRNAi:3670 NextBio:14363
            ArrayExpress:P61371 Bgee:P61371 CleanEx:HS_ISL1
            Genevestigator:P61371 GermOnline:ENSG00000016082 GO:GO:0060913
            GO:GO:0060379 GO:GO:0090074 GO:GO:0048880 GO:GO:0021524
            Uniprot:P61371
        Length = 349

 Score = 136 (52.9 bits), Expect = 1.4e-08, P = 1.4e-08
 Identities = 26/44 (59%), Positives = 29/44 (65%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDF
Sbjct:   254 KTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDF 297


>MGI|MGI:101791 [details] [associations]
            symbol:Isl1 "ISL1 transcription factor, LIM/homeodomain"
            species:10090 "Mus musculus" [GO:0000122 "negative regulation of
            transcription from RNA polymerase II promoter" evidence=IMP]
            [GO:0001102 "RNA polymerase II activating transcription factor
            binding" evidence=ISO] [GO:0001105 "RNA polymerase II transcription
            coactivator activity" evidence=ISO;IDA] [GO:0001158 "enhancer
            sequence-specific DNA binding" evidence=ISO] [GO:0001755 "neural
            crest cell migration" evidence=IGI] [GO:0003007 "heart
            morphogenesis" evidence=IGI] [GO:0003139 "secondary heart field
            specification" evidence=ISO] [GO:0003148 "outflow tract septum
            morphogenesis" evidence=IGI] [GO:0003151 "outflow tract
            morphogenesis" evidence=IGI] [GO:0003203 "endocardial cushion
            morphogenesis" evidence=IGI] [GO:0003215 "cardiac right ventricle
            morphogenesis" evidence=IGI] [GO:0003266 "regulation of secondary
            heart field cardioblast proliferation" evidence=IMP] [GO:0003677
            "DNA binding" evidence=IDA] [GO:0003682 "chromatin binding"
            evidence=IDA] [GO:0003700 "sequence-specific DNA binding
            transcription factor activity" evidence=IEA] [GO:0005515 "protein
            binding" evidence=IPI] [GO:0005622 "intracellular" evidence=IDA]
            [GO:0005634 "nucleus" evidence=ISO;IDA] [GO:0006355 "regulation of
            transcription, DNA-dependent" evidence=IEA;ISO] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0007507
            "heart development" evidence=IMP] [GO:0008270 "zinc ion binding"
            evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IDA] [GO:0010468 "regulation of gene
            expression" evidence=IMP] [GO:0010575 "positive regulation vascular
            endothelial growth factor production" evidence=IDA] [GO:0016922
            "ligand-dependent nuclear receptor binding" evidence=ISO]
            [GO:0021520 "spinal cord motor neuron cell fate specification"
            evidence=IGI] [GO:0021522 "spinal cord motor neuron
            differentiation" evidence=IMP] [GO:0021524 "visceral motor neuron
            differentiation" evidence=IGI] [GO:0021559 "trigeminal nerve
            development" evidence=IMP] [GO:0021983 "pituitary gland
            development" evidence=IMP] [GO:0030182 "neuron differentiation"
            evidence=IGI;IMP] [GO:0030331 "estrogen receptor binding"
            evidence=ISO] [GO:0031016 "pancreas development" evidence=IMP]
            [GO:0031290 "retinal ganglion cell axon guidance" evidence=IMP]
            [GO:0032024 "positive regulation of insulin secretion"
            evidence=ISO] [GO:0032725 "positive regulation of granulocyte
            macrophage colony-stimulating factor production" evidence=IDA]
            [GO:0032729 "positive regulation of interferon-gamma production"
            evidence=IDA] [GO:0032730 "positive regulation of interleukin-1
            alpha production" evidence=IDA] [GO:0032731 "positive regulation of
            interleukin-1 beta production" evidence=IDA] [GO:0032735 "positive
            regulation of interleukin-12 production" evidence=IDA] [GO:0032755
            "positive regulation of interleukin-6 production" evidence=IDA]
            [GO:0032760 "positive regulation of tumor necrosis factor
            production" evidence=IDA] [GO:0033147 "negative regulation of
            intracellular estrogen receptor signaling pathway" evidence=ISO]
            [GO:0042517 "positive regulation of tyrosine phosphorylation of
            Stat3 protein" evidence=IDA] [GO:0043388 "positive regulation of
            DNA binding" evidence=IDA] [GO:0043425 "bHLH transcription factor
            binding" evidence=ISO] [GO:0043524 "negative regulation of neuron
            apoptotic process" evidence=IMP] [GO:0043565 "sequence-specific DNA
            binding" evidence=ISO] [GO:0045665 "negative regulation of neuron
            differentiation" evidence=IGI] [GO:0045766 "positive regulation of
            angiogenesis" evidence=IMP] [GO:0045944 "positive regulation of
            transcription from RNA polymerase II promoter"
            evidence=ISO;IGI;IDA;IMP] [GO:0046872 "metal ion binding"
            evidence=IEA] [GO:0048663 "neuron fate commitment" evidence=IGI]
            [GO:0048665 "neuron fate specification" evidence=IMP] [GO:0048762
            "mesenchymal cell differentiation" evidence=IMP] [GO:0048880
            "sensory system development" evidence=IMP] [GO:0048936 "peripheral
            nervous system neuron axonogenesis" evidence=IMP] [GO:0050728
            "negative regulation of inflammatory response" evidence=IMP]
            [GO:0055010 "ventricular cardiac muscle tissue morphogenesis"
            evidence=IGI] [GO:0060037 "pharyngeal system development"
            evidence=IGI] [GO:0060379 "cardiac muscle cell myoblast
            differentiation" evidence=IMP] [GO:0060384 "innervation"
            evidence=IMP] [GO:0060413 "atrial septum morphogenesis"
            evidence=IGI] [GO:0060913 "cardiac cell fate determination"
            evidence=ISO;IMP] [GO:0071657 "positive regulation of granulocyte
            colony-stimulating factor production" evidence=IDA] [GO:0090074
            "negative regulation of protein homodimerization activity"
            evidence=ISO] [GO:0090090 "negative regulation of canonical Wnt
            receptor signaling pathway" evidence=IGI] [GO:1901258 "positive
            regulation of macrophage colony-stimulating factor production"
            evidence=IDA] Pfam:PF00412 InterPro:IPR001356 InterPro:IPR001781
            InterPro:IPR009057 InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027
            PROSITE:PS00478 PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132
            SMART:SM00389 MGI:MGI:101791 GO:GO:0005634 GO:GO:0046872
            GO:GO:0003677 GO:GO:0008284 GO:GO:0001755 GO:GO:0050728
            GO:GO:0008270 GO:GO:0045665 GO:GO:0043524 GO:GO:0032755
            GO:GO:0010575 GO:GO:0032024 GO:GO:0003700 GO:GO:0045766
            GO:GO:0003682 Gene3D:1.10.10.60 SUPFAM:SSF46689 GO:GO:0000122
            Gene3D:2.10.110.10 GO:GO:0060037 GO:GO:0090090 GO:GO:0032731
            GO:GO:0031016 GO:GO:0021983 GO:GO:0001105 GO:GO:0021559
            GO:GO:0001158 GO:GO:0042517 GO:GO:0032729 GO:GO:0032760
            GeneTree:ENSGT00700000104050 GO:GO:0031103 GO:GO:0055010
            GO:GO:0003203 GO:GO:0003139 GO:GO:0031290 GO:GO:0043388
            GO:GO:0032730 GO:GO:0032735 GO:GO:0071657 GO:GO:0060413
            GO:GO:0003266 eggNOG:COG5576 GO:GO:0003148 GO:GO:0003215
            GO:GO:0060384 GO:GO:0021520 GO:GO:0032725 CTD:3670
            HOVERGEN:HBG004671 KO:K09370 HOGENOM:HOG000236304 OMA:TDMGDMG
            OrthoDB:EOG4G4GQR GO:GO:0048936 GO:GO:0060913 GO:GO:0060379
            GO:GO:0048880 GO:GO:0021524 EMBL:AJ132765 EMBL:AB104633
            IPI:IPI00121604 IPI:IPI00415262 RefSeq:NP_067434.3 UniGene:Mm.42242
            PDB:2RGT PDBsum:2RGT ProteinModelPortal:P61372 SMR:P61372
            MINT:MINT-4594016 STRING:P61372 PhosphoSite:P61372 PRIDE:P61372
            Ensembl:ENSMUST00000036060 Ensembl:ENSMUST00000176044 GeneID:16392
            KEGG:mmu:16392 UCSC:uc007ryf.2 InParanoid:P61372
            EvolutionaryTrace:P61372 NextBio:289537 Bgee:P61372 CleanEx:MM_ISL1
            Genevestigator:P61372 GermOnline:ENSMUSG00000042258 Uniprot:P61372
        Length = 349

 Score = 136 (52.9 bits), Expect = 1.4e-08, P = 1.4e-08
 Identities = 26/44 (59%), Positives = 29/44 (65%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDF
Sbjct:   254 KTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDF 297


>RGD|61957 [details] [associations]
            symbol:Isl1 "ISL LIM homeobox 1" species:10116 "Rattus norvegicus"
           [GO:0000122 "negative regulation of transcription from RNA
           polymerase II promoter" evidence=IEA;ISO] [GO:0001102 "RNA
           polymerase II activating transcription factor binding"
           evidence=IEA;ISO] [GO:0001105 "RNA polymerase II transcription
           coactivator activity" evidence=IEA;ISO] [GO:0001158 "enhancer
           sequence-specific DNA binding" evidence=IEA;ISO] [GO:0001755 "neural
           crest cell migration" evidence=IEA;ISO] [GO:0003007 "heart
           morphogenesis" evidence=ISO] [GO:0003139 "secondary heart field
           specification" evidence=IEA;ISO] [GO:0003148 "outflow tract septum
           morphogenesis" evidence=IEA;ISO] [GO:0003151 "outflow tract
           morphogenesis" evidence=ISO] [GO:0003203 "endocardial cushion
           morphogenesis" evidence=IEA;ISO] [GO:0003215 "cardiac right
           ventricle morphogenesis" evidence=IEA;ISO] [GO:0003266 "regulation
           of secondary heart field cardioblast proliferation"
           evidence=IEA;ISO] [GO:0003677 "DNA binding" evidence=ISO]
           [GO:0003682 "chromatin binding" evidence=IEA;ISO] [GO:0003700
           "sequence-specific DNA binding transcription factor activity"
           evidence=IEA] [GO:0005515 "protein binding" evidence=IPI]
           [GO:0005622 "intracellular" evidence=ISO] [GO:0005634 "nucleus"
           evidence=ISO;IDA] [GO:0006355 "regulation of transcription,
           DNA-dependent" evidence=IDA] [GO:0007507 "heart development"
           evidence=ISO] [GO:0008270 "zinc ion binding" evidence=IEA]
           [GO:0008284 "positive regulation of cell proliferation"
           evidence=IEA;ISO] [GO:0010468 "regulation of gene expression"
           evidence=ISO] [GO:0010575 "positive regulation vascular endothelial
           growth factor production" evidence=IEA;ISO] [GO:0016922
           "ligand-dependent nuclear receptor binding" evidence=IDA;IPI]
           [GO:0021520 "spinal cord motor neuron cell fate specification"
           evidence=IEA;ISO] [GO:0021522 "spinal cord motor neuron
           differentiation" evidence=ISO] [GO:0021524 "visceral motor neuron
           differentiation" evidence=IEA;ISO] [GO:0021559 "trigeminal nerve
           development" evidence=IEA;ISO] [GO:0021983 "pituitary gland
           development" evidence=IEA;ISO] [GO:0030182 "neuron differentiation"
           evidence=ISO] [GO:0030331 "estrogen receptor binding" evidence=IDA]
           [GO:0031016 "pancreas development" evidence=IEA;ISO] [GO:0031103
           "axon regeneration" evidence=IEP] [GO:0031290 "retinal ganglion cell
           axon guidance" evidence=IEA;ISO] [GO:0032024 "positive regulation of
           insulin secretion" evidence=IMP] [GO:0032725 "positive regulation of
           granulocyte macrophage colony-stimulating factor production"
           evidence=IEA;ISO] [GO:0032729 "positive regulation of
           interferon-gamma production" evidence=IEA;ISO] [GO:0032730 "positive
           regulation of interleukin-1 alpha production" evidence=IEA;ISO]
           [GO:0032731 "positive regulation of interleukin-1 beta production"
           evidence=IEA;ISO] [GO:0032735 "positive regulation of interleukin-12
           production" evidence=IEA;ISO] [GO:0032755 "positive regulation of
           interleukin-6 production" evidence=IEA;ISO] [GO:0032760 "positive
           regulation of tumor necrosis factor production" evidence=IEA;ISO]
           [GO:0033147 "negative regulation of intracellular estrogen receptor
           signaling pathway" evidence=IDA] [GO:0042517 "positive regulation of
           tyrosine phosphorylation of Stat3 protein" evidence=IEA;ISO]
           [GO:0043388 "positive regulation of DNA binding" evidence=IEA;ISO]
           [GO:0043425 "bHLH transcription factor binding" evidence=IEA;ISO]
           [GO:0043524 "negative regulation of neuron apoptotic process"
           evidence=IEA;ISO] [GO:0043565 "sequence-specific DNA binding"
           evidence=IDA] [GO:0045665 "negative regulation of neuron
           differentiation" evidence=IEA;ISO] [GO:0045766 "positive regulation
           of angiogenesis" evidence=IEA;ISO] [GO:0045944 "positive regulation
           of transcription from RNA polymerase II promoter" evidence=ISO;IDA]
           [GO:0048663 "neuron fate commitment" evidence=ISO] [GO:0048665
           "neuron fate specification" evidence=ISO] [GO:0048762 "mesenchymal
           cell differentiation" evidence=ISO] [GO:0048880 "sensory system
           development" evidence=IEA;ISO] [GO:0048936 "peripheral nervous
           system neuron axonogenesis" evidence=IEA;ISO] [GO:0050728 "negative
           regulation of inflammatory response" evidence=IEA;ISO] [GO:0055010
           "ventricular cardiac muscle tissue morphogenesis" evidence=IEA;ISO]
           [GO:0060037 "pharyngeal system development" evidence=IEA;ISO]
           [GO:0060379 "cardiac muscle cell myoblast differentiation"
           evidence=IEA;ISO] [GO:0060384 "innervation" evidence=IEA;ISO]
           [GO:0060413 "atrial septum morphogenesis" evidence=IEA;ISO]
           [GO:0060913 "cardiac cell fate determination" evidence=IEA;ISO]
           [GO:0071385 "cellular response to glucocorticoid stimulus"
           evidence=IEP] [GO:0071657 "positive regulation of granulocyte
           colony-stimulating factor production" evidence=IEA;ISO] [GO:0090074
           "negative regulation of protein homodimerization activity"
           evidence=IDA] [GO:0090090 "negative regulation of canonical Wnt
           receptor signaling pathway" evidence=IEA;ISO] [GO:1901258 "positive
           regulation of macrophage colony-stimulating factor production"
           evidence=ISO] Pfam:PF00412 InterPro:IPR001356 InterPro:IPR001781
           InterPro:IPR009057 InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027
           PROSITE:PS00478 PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132
           SMART:SM00389 RGD:61957 GO:GO:0005634 GO:GO:0046872 GO:GO:0008284
           GO:GO:0001755 GO:GO:0043565 GO:GO:0008270 GO:GO:0071385
           GO:GO:0045944 GO:GO:0045665 GO:GO:0043524 GO:GO:0032024
           GO:GO:0003700 GO:GO:0003682 Gene3D:1.10.10.60 SUPFAM:SSF46689
           GO:GO:0000122 Gene3D:2.10.110.10 GO:GO:0060037 GO:GO:0090090
           GO:GO:0031016 GO:GO:0021983 GO:GO:0001105 GO:GO:0030331
           GO:GO:0021559 GO:GO:0001158 GO:GO:0042517
           GeneTree:ENSGT00700000104050 GO:GO:0016922 GO:GO:0031103
           GO:GO:0055010 GO:GO:0003203 GO:GO:0003139 GO:GO:0031290
           GO:GO:0043388 GO:GO:0060413 GO:GO:0033147 GO:GO:0003266
           eggNOG:COG5576 GO:GO:0003148 GO:GO:0003215 GO:GO:0060384
           GO:GO:0021520 CTD:3670 HOVERGEN:HBG004671 KO:K09370
           HOGENOM:HOG000236304 OMA:TDMGDMG OrthoDB:EOG4G4GQR GO:GO:0048936
           GO:GO:0060913 GO:GO:0060379 GO:GO:0090074 GO:GO:0048880
           GO:GO:0021524 EMBL:S69329 EMBL:AY557632 EMBL:X53258 IPI:IPI00201439
           IPI:IPI00417237 PIR:I67417 RefSeq:NP_059035.3 UniGene:Rn.36202
           ProteinModelPortal:P61374 SMR:P61374 STRING:P61374
           PhosphoSite:P61374 PRIDE:P61374 Ensembl:ENSRNOT00000017305
           GeneID:64444 KEGG:rno:64444 InParanoid:P61374 NextBio:613174
           Genevestigator:P61374 GermOnline:ENSRNOG00000012556 Uniprot:P61374
        Length = 349

 Score = 136 (52.9 bits), Expect = 1.4e-08, P = 1.4e-08
 Identities = 26/44 (59%), Positives = 29/44 (65%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDF
Sbjct:   254 KTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDF 297


>ZFIN|ZDB-GENE-980526-112 [details] [associations]
            symbol:isl1 "islet1" species:7955 "Danio rerio"
            [GO:0043565 "sequence-specific DNA binding" evidence=IEA]
            [GO:0005634 "nucleus" evidence=IEA;IDA] [GO:0008270 "zinc ion
            binding" evidence=IEA] [GO:0003677 "DNA binding" evidence=IEA]
            [GO:0006355 "regulation of transcription, DNA-dependent"
            evidence=IEA] [GO:0003700 "sequence-specific DNA binding
            transcription factor activity" evidence=IEA] [GO:0048936
            "peripheral nervous system neuron axonogenesis" evidence=IMP]
            [GO:0031017 "exocrine pancreas development" evidence=IMP]
            [GO:0048665 "neuron fate specification" evidence=IGI;IMP]
            [GO:0021522 "spinal cord motor neuron differentiation"
            evidence=IGI] [GO:0046872 "metal ion binding" evidence=IEA]
            [GO:0007275 "multicellular organismal development" evidence=IEA]
            [GO:0055011 "atrial cardiac muscle cell differentiation"
            evidence=IMP] [GO:0055012 "ventricular cardiac muscle cell
            differentiation" evidence=IMP] Pfam:PF00412 InterPro:IPR001356
            InterPro:IPR001781 InterPro:IPR009057 InterPro:IPR017970
            Pfam:PF00046 PROSITE:PS00027 PROSITE:PS00478 PROSITE:PS50023
            PROSITE:PS50071 SMART:SM00132 SMART:SM00389
            ZFIN:ZDB-GENE-980526-112 GO:GO:0005634 GO:GO:0046872 GO:GO:0043565
            GO:GO:0008270 GO:GO:0003700 Gene3D:1.10.10.60 SUPFAM:SSF46689
            Gene3D:2.10.110.10 GO:GO:0021522 GO:GO:0048665
            GeneTree:ENSGT00700000104050 GO:GO:0031017 eggNOG:COG5576 CTD:3670
            HOVERGEN:HBG004671 KO:K09370 EMBL:D21135 EMBL:AL954694
            EMBL:BC060892 IPI:IPI00487340 PIR:I51739 RefSeq:NP_571037.1
            UniGene:Dr.75106 ProteinModelPortal:P53405 SMR:P53405 STRING:P53405
            Ensembl:ENSDART00000010896 GeneID:30147 KEGG:dre:30147
            HOGENOM:HOG000236304 InParanoid:A2AWM5 OMA:TDMGDMG
            OrthoDB:EOG4G4GQR NextBio:20806622 Bgee:P53405 GO:GO:0055011
            GO:GO:0048936 Uniprot:P53405
        Length = 349

 Score = 136 (52.9 bits), Expect = 1.4e-08, P = 1.4e-08
 Identities = 26/44 (59%), Positives = 29/44 (65%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDF
Sbjct:   254 KTNIQGMTGTPMVATSPERHDGGLQANQVEVQSYQPPWKVLSDF 297


>UNIPROTKB|F1PP21 [details] [associations]
            symbol:ISL1 "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0005634 "nucleus" evidence=IEA] [GO:0008270
            "zinc ion binding" evidence=IEA] [GO:0003700 "sequence-specific DNA
            binding transcription factor activity" evidence=IEA] [GO:0043565
            "sequence-specific DNA binding" evidence=IEA] Pfam:PF00412
            InterPro:IPR001356 InterPro:IPR001781 InterPro:IPR009057
            InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027 PROSITE:PS00478
            PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132 SMART:SM00389
            GO:GO:0005634 GO:GO:0046872 GO:GO:0043565 GO:GO:0008270
            GO:GO:0003700 Gene3D:1.10.10.60 SUPFAM:SSF46689 Gene3D:2.10.110.10
            GeneTree:ENSGT00700000104050 OMA:TDMGDMG EMBL:AAEX03003122
            Ensembl:ENSCAFT00000029303 Uniprot:F1PP21
        Length = 360

 Score = 136 (52.9 bits), Expect = 1.5e-08, P = 1.5e-08
 Identities = 26/44 (59%), Positives = 29/44 (65%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDF
Sbjct:   264 KTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDF 307


>UNIPROTKB|F1SMF7 [details] [associations]
            symbol:ISL1 "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:0005634 "nucleus" evidence=IEA] [GO:0090090 "negative
            regulation of canonical Wnt receptor signaling pathway"
            evidence=IEA] [GO:0071657 "positive regulation of granulocyte
            colony-stimulating factor production" evidence=IEA] [GO:0060913
            "cardiac cell fate determination" evidence=IEA] [GO:0060413 "atrial
            septum morphogenesis" evidence=IEA] [GO:0060384 "innervation"
            evidence=IEA] [GO:0060379 "cardiac muscle cell myoblast
            differentiation" evidence=IEA] [GO:0060037 "pharyngeal system
            development" evidence=IEA] [GO:0055010 "ventricular cardiac muscle
            tissue morphogenesis" evidence=IEA] [GO:0050728 "negative
            regulation of inflammatory response" evidence=IEA] [GO:0048936
            "peripheral nervous system neuron axonogenesis" evidence=IEA]
            [GO:0048880 "sensory system development" evidence=IEA] [GO:0045766
            "positive regulation of angiogenesis" evidence=IEA] [GO:0045665
            "negative regulation of neuron differentiation" evidence=IEA]
            [GO:0043524 "negative regulation of neuron apoptotic process"
            evidence=IEA] [GO:0043425 "bHLH transcription factor binding"
            evidence=IEA] [GO:0043388 "positive regulation of DNA binding"
            evidence=IEA] [GO:0042517 "positive regulation of tyrosine
            phosphorylation of Stat3 protein" evidence=IEA] [GO:0032760
            "positive regulation of tumor necrosis factor production"
            evidence=IEA] [GO:0032755 "positive regulation of interleukin-6
            production" evidence=IEA] [GO:0032735 "positive regulation of
            interleukin-12 production" evidence=IEA] [GO:0032731 "positive
            regulation of interleukin-1 beta production" evidence=IEA]
            [GO:0032730 "positive regulation of interleukin-1 alpha production"
            evidence=IEA] [GO:0032729 "positive regulation of interferon-gamma
            production" evidence=IEA] [GO:0032725 "positive regulation of
            granulocyte macrophage colony-stimulating factor production"
            evidence=IEA] [GO:0031290 "retinal ganglion cell axon guidance"
            evidence=IEA] [GO:0031016 "pancreas development" evidence=IEA]
            [GO:0021983 "pituitary gland development" evidence=IEA] [GO:0021559
            "trigeminal nerve development" evidence=IEA] [GO:0021524 "visceral
            motor neuron differentiation" evidence=IEA] [GO:0021520 "spinal
            cord motor neuron cell fate specification" evidence=IEA]
            [GO:0010575 "positive regulation vascular endothelial growth factor
            production" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0003682 "chromatin binding"
            evidence=IEA] [GO:0003266 "regulation of secondary heart field
            cardioblast proliferation" evidence=IEA] [GO:0003215 "cardiac right
            ventricle morphogenesis" evidence=IEA] [GO:0003203 "endocardial
            cushion morphogenesis" evidence=IEA] [GO:0003148 "outflow tract
            septum morphogenesis" evidence=IEA] [GO:0003139 "secondary heart
            field specification" evidence=IEA] [GO:0001755 "neural crest cell
            migration" evidence=IEA] [GO:0001158 "enhancer sequence-specific
            DNA binding" evidence=IEA] [GO:0001105 "RNA polymerase II
            transcription coactivator activity" evidence=IEA] [GO:0001102 "RNA
            polymerase II activating transcription factor binding"
            evidence=IEA] [GO:0000122 "negative regulation of transcription
            from RNA polymerase II promoter" evidence=IEA] [GO:0008270 "zinc
            ion binding" evidence=IEA] [GO:0003700 "sequence-specific DNA
            binding transcription factor activity" evidence=IEA] Pfam:PF00412
            InterPro:IPR001356 InterPro:IPR001781 InterPro:IPR009057
            InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027 PROSITE:PS00478
            PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132 SMART:SM00389
            GO:GO:0005634 GO:GO:0046872 GO:GO:0008284 GO:GO:0001755
            GO:GO:0008270 GO:GO:0045665 GO:GO:0043524 GO:GO:0003700
            GO:GO:0003682 Gene3D:1.10.10.60 SUPFAM:SSF46689 GO:GO:0000122
            Gene3D:2.10.110.10 GO:GO:0060037 GO:GO:0090090 GO:GO:0031016
            GO:GO:0021983 GO:GO:0001105 GO:GO:0021559 GO:GO:0001158
            GO:GO:0042517 GeneTree:ENSGT00700000104050 GO:GO:0055010
            GO:GO:0003203 GO:GO:0003139 GO:GO:0031290 GO:GO:0043388
            GO:GO:0060413 GO:GO:0003266 GO:GO:0003148 GO:GO:0003215
            GO:GO:0060384 GO:GO:0021520 OMA:TDMGDMG GO:GO:0048936 GO:GO:0060913
            GO:GO:0060379 GO:GO:0048880 GO:GO:0021524 EMBL:CU915536
            Ensembl:ENSSSCT00000018387 Uniprot:F1SMF7
        Length = 361

 Score = 136 (52.9 bits), Expect = 1.5e-08, P = 1.5e-08
 Identities = 26/44 (59%), Positives = 29/44 (65%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     M G PMVA+SP RHD  +  N +EV SYQPPWK LSDF
Sbjct:   266 KTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDF 309


>ZFIN|ZDB-GENE-980526-562 [details] [associations]
            symbol:isl2a "islet2a" species:7955 "Danio rerio"
            [GO:0003677 "DNA binding" evidence=IEA] [GO:0006355 "regulation of
            transcription, DNA-dependent" evidence=IEA] [GO:0043565
            "sequence-specific DNA binding" evidence=IEA] [GO:0003700
            "sequence-specific DNA binding transcription factor activity"
            evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0008270 "zinc
            ion binding" evidence=IEA] [GO:0007409 "axonogenesis"
            evidence=IGI;IMP] [GO:0048665 "neuron fate specification"
            evidence=IGI;IMP] [GO:0048675 "axon extension" evidence=IMP]
            [GO:0046872 "metal ion binding" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] Pfam:PF00412
            InterPro:IPR001356 InterPro:IPR001781 InterPro:IPR009057
            InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027 PROSITE:PS00478
            PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132 SMART:SM00389
            ZFIN:ZDB-GENE-980526-562 GO:GO:0005634 GO:GO:0046872 GO:GO:0043565
            GO:GO:0008270 GO:GO:0003700 Gene3D:1.10.10.60 SUPFAM:SSF46689
            Gene3D:2.10.110.10 GO:GO:0048665 GeneTree:ENSGT00700000104050
            GO:GO:0048676 eggNOG:COG5576 HOVERGEN:HBG004671 KO:K09370
            HOGENOM:HOG000236304 OrthoDB:EOG4G4GQR EMBL:D38453 EMBL:X88805
            EMBL:U09403 IPI:IPI00483445 PIR:I51734 RefSeq:NP_571045.1
            UniGene:Dr.281 ProteinModelPortal:P53406 SMR:P53406
            Ensembl:ENSDART00000012862 GeneID:30157 KEGG:dre:30157 CTD:30157
            InParanoid:P53406 OMA:RHDSAVQ NextBio:20806628 ArrayExpress:P53406
            Bgee:P53406 Uniprot:P53406
        Length = 359

 Score = 132 (51.5 bits), Expect = 4.1e-08, P = 4.1e-08
 Identities = 23/44 (52%), Positives = 31/44 (70%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     + G P+VA SP+RHD+ +  N +EV +YQPPWKALS+F
Sbjct:   264 KTNLQGLTGTPLVAGSPIRHDTTVQGNPVEVQTYQPPWKALSEF 307


>UNIPROTKB|E1BM60 [details] [associations]
            symbol:ISL2 "Uncharacterized protein" species:9913 "Bos
            taurus" [GO:0005634 "nucleus" evidence=IEA] [GO:0045665 "negative
            regulation of neuron differentiation" evidence=IEA] [GO:0031290
            "retinal ganglion cell axon guidance" evidence=IEA] [GO:0021524
            "visceral motor neuron differentiation" evidence=IEA] [GO:0021520
            "spinal cord motor neuron cell fate specification" evidence=IEA]
            [GO:0043565 "sequence-specific DNA binding" evidence=IEA]
            [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0003700
            "sequence-specific DNA binding transcription factor activity"
            evidence=IEA] Pfam:PF00412 InterPro:IPR001356 InterPro:IPR001781
            InterPro:IPR009057 InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027
            PROSITE:PS00478 PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132
            SMART:SM00389 GO:GO:0005634 GO:GO:0046872 GO:GO:0043565
            GO:GO:0008270 GO:GO:0045665 GO:GO:0003700 Gene3D:1.10.10.60
            SUPFAM:SSF46689 Gene3D:2.10.110.10 GeneTree:ENSGT00700000104050
            GO:GO:0031290 GO:GO:0021520 GO:GO:0021524 OMA:RHDSAVQ
            EMBL:DAAA02052446 IPI:IPI00701951 UniGene:Bt.34422
            Ensembl:ENSBTAT00000022147 NextBio:20928153 Uniprot:E1BM60
        Length = 359

 Score = 131 (51.2 bits), Expect = 5.3e-08, P = 5.3e-08
 Identities = 23/44 (52%), Positives = 32/44 (72%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     + G P+VA SP+RH+S +  +A+EV +YQPPWKALS+F
Sbjct:   264 KTSLQGLTGTPLVAGSPIRHESAVQGSAVEVQTYQPPWKALSEF 307


>UNIPROTKB|Q96A47 [details] [associations]
            symbol:ISL2 "Insulin gene enhancer protein ISL-2"
            species:9606 "Homo sapiens" [GO:0003700 "sequence-specific DNA
            binding transcription factor activity" evidence=IEA] [GO:0008270
            "zinc ion binding" evidence=IEA] [GO:0043565 "sequence-specific DNA
            binding" evidence=IEA] [GO:0021520 "spinal cord motor neuron cell
            fate specification" evidence=IEA] [GO:0021524 "visceral motor
            neuron differentiation" evidence=IEA] [GO:0031290 "retinal ganglion
            cell axon guidance" evidence=IEA] [GO:0045665 "negative regulation
            of neuron differentiation" evidence=IEA] [GO:0048935 "peripheral
            nervous system neuron development" evidence=TAS] [GO:0003677 "DNA
            binding" evidence=ISS] [GO:0005634 "nucleus" evidence=IC]
            [GO:0048666 "neuron development" evidence=TAS] Pfam:PF00412
            InterPro:IPR001356 InterPro:IPR001781 InterPro:IPR009057
            InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027 PROSITE:PS00478
            PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132 SMART:SM00389
            GO:GO:0005634 GO:GO:0046872 GO:GO:0003677 GO:GO:0043565
            GO:GO:0008270 GO:GO:0045665 GO:GO:0003700 Gene3D:1.10.10.60
            SUPFAM:SSF46689 Gene3D:2.10.110.10 EMBL:CH471136 GO:GO:0031290
            GO:GO:0048935 eggNOG:COG5576 GO:GO:0021520 HOVERGEN:HBG004671
            KO:K09370 HOGENOM:HOG000236304 OrthoDB:EOG4G4GQR GO:GO:0021524
            OMA:RHDSAVQ EMBL:AK001022 EMBL:BC011967 EMBL:BC012136
            IPI:IPI00059240 RefSeq:NP_665804.1 UniGene:Hs.444677
            ProteinModelPortal:Q96A47 SMR:Q96A47 STRING:Q96A47
            PhosphoSite:Q96A47 DMDM:20978495 PRIDE:Q96A47 DNASU:64843
            Ensembl:ENST00000290759 GeneID:64843 KEGG:hsa:64843 UCSC:uc002bbw.1
            CTD:64843 GeneCards:GC15P076629 HGNC:HGNC:18524 MIM:609481
            neXtProt:NX_Q96A47 PharmGKB:PA38566 InParanoid:Q96A47
            PhylomeDB:Q96A47 GenomeRNAi:64843 NextBio:66950 Bgee:Q96A47
            CleanEx:HS_ISL2 Genevestigator:Q96A47 GermOnline:ENSG00000159556
            Uniprot:Q96A47
        Length = 359

 Score = 128 (50.1 bits), Expect = 1.1e-07, P = 1.1e-07
 Identities = 22/44 (50%), Positives = 32/44 (72%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     + G P+VA SP+RH++ +  +A+EV +YQPPWKALS+F
Sbjct:   264 KTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEF 307


>MGI|MGI:109156 [details] [associations]
            symbol:Isl2 "insulin related protein 2 (islet 2)"
            species:10090 "Mus musculus" [GO:0003677 "DNA binding"
            evidence=IEA] [GO:0003700 "sequence-specific DNA binding
            transcription factor activity" evidence=IEA] [GO:0005622
            "intracellular" evidence=IDA] [GO:0005634 "nucleus" evidence=IEA]
            [GO:0006355 "regulation of transcription, DNA-dependent"
            evidence=IEA] [GO:0007275 "multicellular organismal development"
            evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA]
            [GO:0021520 "spinal cord motor neuron cell fate specification"
            evidence=IGI] [GO:0021524 "visceral motor neuron differentiation"
            evidence=IGI;IMP] [GO:0031290 "retinal ganglion cell axon guidance"
            evidence=IMP] [GO:0043565 "sequence-specific DNA binding"
            evidence=IEA] [GO:0045665 "negative regulation of neuron
            differentiation" evidence=IGI;IMP] [GO:0046872 "metal ion binding"
            evidence=IEA] [GO:0048663 "neuron fate commitment"
            evidence=IGI;IMP] Pfam:PF00412 InterPro:IPR001356
            InterPro:IPR001781 InterPro:IPR009057 InterPro:IPR017970
            Pfam:PF00046 PROSITE:PS00027 PROSITE:PS00478 PROSITE:PS50023
            PROSITE:PS50071 SMART:SM00132 SMART:SM00389 MGI:MGI:109156
            GO:GO:0005634 GO:GO:0046872 GO:GO:0043565 GO:GO:0008270
            GO:GO:0045665 GO:GO:0003700 EMBL:CH466522 GO:GO:0005622
            Gene3D:1.10.10.60 SUPFAM:SSF46689 Gene3D:2.10.110.10
            GeneTree:ENSGT00700000104050 GO:GO:0031290 eggNOG:COG5576
            GO:GO:0021520 HOVERGEN:HBG004671 KO:K09370 HOGENOM:HOG000236304
            OrthoDB:EOG4G4GQR GO:GO:0021524 OMA:RHDSAVQ CTD:64843 EMBL:AK013964
            EMBL:AC116699 IPI:IPI00110854 RefSeq:NP_081673.2 UniGene:Mm.273996
            PDB:3MMK PDBsum:3MMK ProteinModelPortal:Q9CXV0 STRING:Q9CXV0
            PhosphoSite:Q9CXV0 PRIDE:Q9CXV0 DNASU:104360
            Ensembl:ENSMUST00000034869 GeneID:104360 KEGG:mmu:104360
            UCSC:uc009psm.1 InParanoid:Q9CXV0 NextBio:356992 CleanEx:MM_ISL2
            Genevestigator:Q9CXV0 GermOnline:ENSMUSG00000032318 Uniprot:Q9CXV0
        Length = 359

 Score = 128 (50.1 bits), Expect = 1.1e-07, P = 1.1e-07
 Identities = 22/44 (50%), Positives = 32/44 (72%)

Query:    42 KMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             K     + G P+VA SP+RH++ +  +A+EV +YQPPWKALS+F
Sbjct:   264 KASLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEF 307


>ZFIN|ZDB-GENE-990415-133 [details] [associations]
            symbol:isl2b "islet2b" species:7955 "Danio rerio"
            [GO:0043565 "sequence-specific DNA binding" evidence=IEA]
            [GO:0003700 "sequence-specific DNA binding transcription factor
            activity" evidence=IEA] [GO:0006355 "regulation of transcription,
            DNA-dependent" evidence=IEA] [GO:0005634 "nucleus" evidence=IEA]
            [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0003677 "DNA
            binding" evidence=IEA] [GO:0046872 "metal ion binding"
            evidence=IEA] [GO:0007275 "multicellular organismal development"
            evidence=IEA] Pfam:PF00412 InterPro:IPR001356 InterPro:IPR001781
            InterPro:IPR009057 InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027
            PROSITE:PS00478 PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132
            SMART:SM00389 ZFIN:ZDB-GENE-990415-133 GO:GO:0007275 GO:GO:0005634
            GO:GO:0046872 GO:GO:0043565 GO:GO:0008270 GO:GO:0003700
            Gene3D:1.10.10.60 SUPFAM:SSF46689 Gene3D:2.10.110.10
            eggNOG:NOG264882 GeneTree:ENSGT00700000104050 HOVERGEN:HBG004671
            HOGENOM:HOG000236304 OrthoDB:EOG4G4GQR EMBL:D38454 EMBL:AL845510
            EMBL:BC095011 EMBL:U09404 IPI:IPI00485578 PIR:I51735
            RefSeq:NP_571039.1 UniGene:Dr.20916 ProteinModelPortal:P53407
            SMR:P53407 STRING:P53407 Ensembl:ENSDART00000055936 GeneID:30151
            KEGG:dre:30151 CTD:30151 InParanoid:P53407 OMA:HAHKQAE
            NextBio:20806624 Bgee:P53407 Uniprot:P53407
        Length = 358

 Score = 116 (45.9 bits), Expect = 2.3e-06, P = 2.3e-06
 Identities = 21/46 (45%), Positives = 30/46 (65%)

Query:    40 GRKMGYGSMQGIPMVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             G K     M G  +VA SP+RH+  +  + ++V +YQPPWKALS+F
Sbjct:   261 GDKTNLQGMTGTALVAGSPIRHNPSVPGHPVDVQAYQPPWKALSEF 306


>RGD|621849 [details] [associations]
            symbol:Isl2 "ISL LIM homeobox 2" species:10116 "Rattus
            norvegicus" [GO:0003674 "molecular_function" evidence=ND]
            [GO:0003700 "sequence-specific DNA binding transcription factor
            activity" evidence=IEA] [GO:0005575 "cellular_component"
            evidence=ND] [GO:0005622 "intracellular" evidence=ISO] [GO:0005634
            "nucleus" evidence=IEA] [GO:0007275 "multicellular organismal
            development" evidence=IEA] [GO:0008150 "biological_process"
            evidence=ND] [GO:0008270 "zinc ion binding" evidence=IEA]
            [GO:0021520 "spinal cord motor neuron cell fate specification"
            evidence=IEA;ISO] [GO:0021524 "visceral motor neuron
            differentiation" evidence=IEA;ISO] [GO:0031290 "retinal ganglion
            cell axon guidance" evidence=IEA;ISO] [GO:0043565
            "sequence-specific DNA binding" evidence=IEA] [GO:0045665 "negative
            regulation of neuron differentiation" evidence=IEA;ISO] [GO:0048663
            "neuron fate commitment" evidence=ISO] Pfam:PF00412
            InterPro:IPR001356 InterPro:IPR001781 InterPro:IPR009057
            InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027 PROSITE:PS00478
            PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132 SMART:SM00389
            RGD:621849 GO:GO:0005634 GO:GO:0046872 GO:GO:0043565 GO:GO:0008270
            GO:GO:0045665 GO:GO:0003700 Gene3D:1.10.10.60 SUPFAM:SSF46689
            Gene3D:2.10.110.10 GO:GO:0031290 eggNOG:COG5576 GO:GO:0021520
            HOVERGEN:HBG004671 KO:K09370 HOGENOM:HOG000236304 OrthoDB:EOG4G4GQR
            GO:GO:0021524 CTD:64843 EMBL:L35571 IPI:IPI00198543 PIR:A55198
            RefSeq:NP_065204.1 UniGene:Rn.10026 PDB:1BW5 PDBsum:1BW5
            ProteinModelPortal:P50480 SMR:P50480 STRING:P50480 PRIDE:P50480
            GeneID:57233 KEGG:rno:57233 UCSC:RGD:621849 InParanoid:P50480
            EvolutionaryTrace:P50480 NextBio:611298 ArrayExpress:P50480
            Genevestigator:P50480 GermOnline:ENSRNOG00000015336 Uniprot:P50480
        Length = 360

 Score = 108 (43.1 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 21/42 (50%), Positives = 31/42 (73%)

Query:    47 SMQGIP---MVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             S+QG+    +VA SP  H++ +  +A+EV +YQPPWKALS+F
Sbjct:   267 SLQGLTGTLLVAGSPSAHENAVQGSAVEVQTYQPPWKALSEF 308


>UNIPROTKB|P50480 [details] [associations]
            symbol:Isl2 "Insulin gene enhancer protein ISL-2"
            species:10116 "Rattus norvegicus" [GO:0003700 "sequence-specific
            DNA binding transcription factor activity" evidence=IEA]
            [GO:0005634 "nucleus" evidence=IEA] [GO:0008270 "zinc ion binding"
            evidence=IEA] [GO:0043565 "sequence-specific DNA binding"
            evidence=IEA] Pfam:PF00412 InterPro:IPR001356 InterPro:IPR001781
            InterPro:IPR009057 InterPro:IPR017970 Pfam:PF00046 PROSITE:PS00027
            PROSITE:PS00478 PROSITE:PS50023 PROSITE:PS50071 SMART:SM00132
            SMART:SM00389 RGD:621849 GO:GO:0005634 GO:GO:0046872 GO:GO:0043565
            GO:GO:0008270 GO:GO:0045665 GO:GO:0003700 Gene3D:1.10.10.60
            SUPFAM:SSF46689 Gene3D:2.10.110.10 GO:GO:0031290 eggNOG:COG5576
            GO:GO:0021520 HOVERGEN:HBG004671 KO:K09370 HOGENOM:HOG000236304
            OrthoDB:EOG4G4GQR GO:GO:0021524 CTD:64843 EMBL:L35571
            IPI:IPI00198543 PIR:A55198 RefSeq:NP_065204.1 UniGene:Rn.10026
            PDB:1BW5 PDBsum:1BW5 ProteinModelPortal:P50480 SMR:P50480
            STRING:P50480 PRIDE:P50480 GeneID:57233 KEGG:rno:57233
            UCSC:RGD:621849 InParanoid:P50480 EvolutionaryTrace:P50480
            NextBio:611298 ArrayExpress:P50480 Genevestigator:P50480
            GermOnline:ENSRNOG00000015336 Uniprot:P50480
        Length = 360

 Score = 108 (43.1 bits), Expect = 1.7e-05, P = 1.7e-05
 Identities = 21/42 (50%), Positives = 31/42 (73%)

Query:    47 SMQGIP---MVASSPVRHDSPIGMNALEVTSYQPPWKALSDF 85
             S+QG+    +VA SP  H++ +  +A+EV +YQPPWKALS+F
Sbjct:   267 SLQGLTGTLLVAGSPSAHENAVQGSAVEVQTYQPPWKALSEF 308


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.326   0.137   0.432    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       86        86   0.00091  102 3  11 22  0.39    29
                                                     29  0.47    30


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  21
  No. of states in DFA:  515 (55 KB)
  Total size of DFA:  103 KB (2072 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  8.51u 0.11s 8.62t   Elapsed:  00:00:02
  Total cpu time:  8.51u 0.11s 8.62t   Elapsed:  00:00:02
  Start:  Thu Aug 15 17:09:33 2013   End:  Thu Aug 15 17:09:35 2013

Back to top