Query         psy4084
Match_columns 86
No_of_seqs    122 out of 1828
Neff          11.9
Searched_HMMs 46136
Date          Sat Aug 17 00:53:37 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4084.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4084hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 5.7E-28 1.2E-32  126.6   4.7   84    1-86    164-250 (279)
  2 KOG2462|consensus               99.9 1.2E-25 2.7E-30  117.9   2.4   74    1-74    190-266 (279)
  3 KOG3623|consensus               99.7 4.1E-17 8.9E-22   95.6   3.4   86    1-86    213-316 (1007)
  4 KOG3576|consensus               99.6 4.2E-16 9.1E-21   79.8   2.3   77    1-77    148-238 (267)
  5 KOG3623|consensus               99.6 2.6E-16 5.7E-21   92.3   1.4   72    1-72    897-971 (1007)
  6 KOG3576|consensus               99.6 2.1E-16 4.5E-21   80.9   0.3   86    1-86    120-219 (267)
  7 KOG1074|consensus               99.6 1.5E-15 3.2E-20   90.1   3.0   46    1-46    356-401 (958)
  8 KOG3608|consensus               99.6 3.4E-15 7.5E-20   81.8   3.4   84    3-86    184-299 (467)
  9 KOG1074|consensus               99.5 7.1E-16 1.5E-20   91.3  -0.3   75    1-75    608-692 (958)
 10 PHA00733 hypothetical protein   99.4 8.4E-13 1.8E-17   64.3   4.6   76    1-76     43-124 (128)
 11 KOG3608|consensus               99.4 6.8E-13 1.5E-17   73.0   4.7   80    2-84    241-324 (467)
 12 PLN03086 PRLI-interacting fact  99.4 2.9E-12 6.3E-17   74.6   5.8   80    1-86    456-548 (567)
 13 PHA02768 hypothetical protein;  99.3 3.2E-12 6.9E-17   53.1   1.6   40    1-42      8-47  (55)
 14 PHA02768 hypothetical protein;  99.2 1.8E-11 3.9E-16   50.9   2.7   38   27-64      6-44  (55)
 15 PHA00616 hypothetical protein   99.2 1.5E-11 3.2E-16   48.9   1.4   34   51-84      1-34  (44)
 16 PF13465 zf-H2C2_2:  Zinc-finge  99.1 4.9E-11 1.1E-15   42.8   2.4   25   13-37      1-25  (26)
 17 PHA00733 hypothetical protein   99.0 4.7E-10   1E-14   54.8   3.1   74   11-86     25-106 (128)
 18 PLN03086 PRLI-interacting fact  98.9 2.2E-09 4.7E-14   63.0   3.3   60   24-86    451-511 (567)
 19 PHA00616 hypothetical protein   98.8 2.8E-09 6.2E-14   42.4   2.0   32    1-32      4-35  (44)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.8   2E-09 4.3E-14   38.6   1.2   21   66-86      1-21  (26)
 21 PHA00732 hypothetical protein   98.8 4.6E-09 9.9E-14   47.2   2.5   42    1-48      4-46  (79)
 22 PF00096 zf-C2H2:  Zinc finger,  98.7 2.1E-08 4.5E-13   34.8   1.8   23   52-74      1-23  (23)
 23 PF12756 zf-C2H2_2:  C2H2 type   98.5 9.9E-08 2.2E-12   44.5   2.9   70    1-74      2-73  (100)
 24 PF13912 zf-C2H2_6:  C2H2-type   98.5 1.1E-07 2.4E-12   34.2   2.2   26   51-76      1-26  (27)
 25 PF05605 zf-Di19:  Drought indu  98.5 2.4E-07 5.3E-12   38.8   3.3   47   26-75      2-53  (54)
 26 PF13894 zf-C2H2_4:  C2H2-type   98.5 1.5E-07 3.3E-12   32.7   2.0   24   52-75      1-24  (24)
 27 PHA00732 hypothetical protein   98.5 2.3E-07 4.9E-12   41.8   3.0   47   26-75      1-48  (79)
 28 KOG3993|consensus               98.4 9.5E-08 2.1E-12   54.3   1.0   76    1-76    270-381 (500)
 29 PF00096 zf-C2H2:  Zinc finger,  98.4 2.9E-07 6.4E-12   31.8   1.5   21    1-21      3-23  (23)
 30 PF09237 GAGA:  GAGA factor;  I  98.3 4.1E-07 8.9E-12   37.1   1.8   35   45-79     18-52  (54)
 31 PF13894 zf-C2H2_4:  C2H2-type   98.1 2.6E-06 5.6E-11   29.4   1.9   22    1-22      3-24  (24)
 32 smart00355 ZnF_C2H2 zinc finge  98.0   1E-05 2.2E-10   28.3   2.2   24   52-75      1-24  (26)
 33 PF05605 zf-Di19:  Drought indu  97.9 2.2E-05 4.7E-10   32.9   3.0   35   51-86      2-38  (54)
 34 PF09237 GAGA:  GAGA factor;  I  97.8 2.3E-05 5.1E-10   32.1   2.4   26    1-26     27-52  (54)
 35 COG5189 SFP1 Putative transcri  97.8   5E-06 1.1E-10   46.1   0.3   48   24-71    347-418 (423)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.8 8.6E-06 1.9E-10   29.1   0.6   22    1-22      4-25  (27)
 37 PF12874 zf-met:  Zinc-finger o  97.8   2E-05 4.3E-10   27.6   1.5   23   52-74      1-23  (25)
 38 smart00355 ZnF_C2H2 zinc finge  97.7 4.9E-05 1.1E-09   26.4   2.1   22    1-22      3-24  (26)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.7 3.4E-05 7.4E-10   26.8   1.3   23   52-75      1-23  (24)
 40 PRK04860 hypothetical protein;  97.4 0.00012 2.5E-09   37.4   2.1   32   51-86    119-150 (160)
 41 PF12874 zf-met:  Zinc-finger o  97.4 8.8E-05 1.9E-09   25.9   0.9   21    1-21      3-23  (25)
 42 PF13913 zf-C2HC_2:  zinc-finge  97.2  0.0004 8.6E-09   24.4   1.9   20   52-72      3-22  (25)
 43 PF12171 zf-C2H2_jaz:  Zinc-fin  97.2 8.3E-05 1.8E-09   26.6   0.1   22   52-73      2-23  (27)
 44 COG5189 SFP1 Putative transcri  97.2 0.00024 5.1E-09   39.8   1.5   38   49-86    347-405 (423)
 45 PRK04860 hypothetical protein;  97.0 0.00035 7.7E-09   35.6   1.2   35   26-64    119-156 (160)
 46 KOG3993|consensus               97.0 0.00022 4.7E-09   41.3   0.2   49   26-74    267-318 (500)
 47 smart00451 ZnF_U1 U1-like zinc  96.5  0.0034 7.3E-08   23.5   2.1   23   51-73      3-25  (35)
 48 cd00350 rubredoxin_like Rubred  96.2  0.0041 8.9E-08   23.3   1.4   24   27-59      2-25  (33)
 49 PF12756 zf-C2H2_2:  C2H2 type   95.2   0.016 3.4E-07   26.8   1.6   21    1-21     53-73  (100)
 50 KOG1146|consensus               95.0   0.014 3.1E-07   38.6   1.4   25   49-73    516-540 (1406)
 51 COG1592 Rubrerythrin [Energy p  94.8    0.03 6.6E-07   28.9   2.1   11   76-86    146-156 (166)
 52 PF13717 zinc_ribbon_4:  zinc-r  94.4   0.058 1.3E-06   20.6   2.0   33   27-61      3-35  (36)
 53 PF09538 FYDLN_acid:  Protein o  94.3   0.026 5.7E-07   27.1   1.1   30   27-64     10-39  (108)
 54 COG2888 Predicted Zn-ribbon RN  94.0   0.078 1.7E-06   22.6   2.1   10   49-58     48-57  (61)
 55 KOG2893|consensus               93.8    0.01 2.2E-07   32.4  -0.8   41   29-70     13-53  (341)
 56 PF13719 zinc_ribbon_5:  zinc-r  93.8   0.084 1.8E-06   20.2   1.9   34   27-62      3-36  (37)
 57 TIGR02098 MJ0042_CXXC MJ0042 f  93.7   0.049 1.1E-06   20.8   1.2   34   27-62      3-36  (38)
 58 COG4049 Uncharacterized protei  93.6   0.033 7.1E-07   23.4   0.7   23   51-73     17-39  (65)
 59 PF09986 DUF2225:  Uncharacteri  93.6   0.025 5.3E-07   30.4   0.3   40   25-64      4-61  (214)
 60 PF10571 UPF0547:  Uncharacteri  93.5   0.045 9.8E-07   19.3   0.9   10   53-62     16-25  (26)
 61 PRK14890 putative Zn-ribbon RN  93.2     0.1 2.3E-06   22.2   1.9    9   50-58     47-55  (59)
 62 smart00531 TFIIE Transcription  93.2    0.18 3.9E-06   25.5   3.0   38   23-61     96-133 (147)
 63 smart00734 ZnF_Rad18 Rad18-lik  92.9    0.14   3E-06   18.1   1.7   20   52-72      2-21  (26)
 64 TIGR00373 conserved hypothetic  92.5    0.11 2.4E-06   26.7   1.7   16   52-67    110-125 (158)
 65 cd00729 rubredoxin_SM Rubredox  92.5    0.12 2.6E-06   19.4   1.4   25   26-59      2-26  (34)
 66 smart00614 ZnF_BED BED zinc fi  92.4    0.19 4.2E-06   20.5   2.1   23   52-74     19-47  (50)
 67 PHA00626 hypothetical protein   92.3   0.064 1.4E-06   22.6   0.6   14   50-63     22-35  (59)
 68 PF12013 DUF3505:  Protein of u  92.1     0.2 4.3E-06   24.0   2.2   27   50-76     79-109 (109)
 69 KOG4167|consensus               92.1   0.028 6.2E-07   35.3  -0.8   25   51-75    792-816 (907)
 70 KOG2785|consensus               92.0    0.39 8.3E-06   28.2   3.6   69    1-73    169-242 (390)
 71 PRK06266 transcription initiat  91.9    0.14   3E-06   26.9   1.7   17   51-67    117-133 (178)
 72 PF02892 zf-BED:  BED zinc fing  91.7    0.33 7.2E-06   19.1   2.4   24   50-73     15-42  (45)
 73 PRK00398 rpoP DNA-directed RNA  91.4    0.13 2.9E-06   20.6   1.1   29   26-61      3-31  (46)
 74 smart00834 CxxC_CXXC_SSSS Puta  90.4   0.072 1.6E-06   20.6  -0.1   29   27-59      6-34  (41)
 75 KOG2893|consensus               90.4    0.17 3.6E-06   27.9   1.1   33   49-86      9-41  (341)
 76 TIGR02300 FYDLN_acid conserved  90.2    0.19 4.1E-06   24.9   1.2   30   27-64     10-39  (129)
 77 PRK09678 DNA-binding transcrip  90.1    0.12 2.5E-06   23.1   0.4   14   49-62     25-40  (72)
 78 COG5048 FOG: Zn-finger [Genera  90.0   0.093   2E-06   30.3   0.1   55   26-80    289-352 (467)
 79 KOG2231|consensus               89.9    0.81 1.8E-05   29.0   3.8   64    9-74    125-205 (669)
 80 PF12760 Zn_Tnp_IS1595:  Transp  89.8    0.72 1.6E-05   18.5   2.6   39   15-59      7-45  (46)
 81 PF09723 Zn-ribbon_8:  Zinc rib  89.7   0.075 1.6E-06   21.0  -0.4   29   27-59      6-34  (42)
 82 smart00659 RPOLCX RNA polymera  89.5     0.3 6.5E-06   19.6   1.3   26   27-60      3-28  (44)
 83 PF05443 ROS_MUCR:  ROS/MUCR tr  89.5    0.33 7.2E-06   24.3   1.7   28   49-79     70-97  (132)
 84 TIGR02605 CxxC_CxxC_SSSS putat  89.4     0.1 2.2E-06   21.4  -0.1   29   27-59      6-34  (52)
 85 TIGR00622 ssl1 transcription f  89.4    0.61 1.3E-05   22.7   2.5   46   29-74     58-104 (112)
 86 COG5048 FOG: Zn-finger [Genera  88.4   0.088 1.9E-06   30.4  -0.8   48    1-48    292-345 (467)
 87 COG1996 RPC10 DNA-directed RNA  87.7    0.45 9.6E-06   19.6   1.3   29   25-60      5-33  (49)
 88 PRK00464 nrdR transcriptional   86.9    0.22 4.9E-06   25.5   0.2   12   27-38     29-40  (154)
 89 KOG2186|consensus               86.8    0.52 1.1E-05   26.2   1.6   13   26-38     29-41  (276)
 90 KOG2785|consensus               86.4     1.3 2.9E-05   26.1   3.1   73    1-73      6-90  (390)
 91 PF07754 DUF1610:  Domain of un  86.0    0.48   1E-05   16.4   0.8    9   50-58     15-23  (24)
 92 PF04959 ARS2:  Arsenite-resist  85.8    0.72 1.6E-05   25.1   1.8   27   49-75     75-101 (214)
 93 KOG2231|consensus               85.7     1.9 4.1E-05   27.5   3.6   46   28-74    184-235 (669)
 94 KOG4173|consensus               84.5     0.5 1.1E-05   25.5   0.8   67    4-73     87-168 (253)
 95 PF03604 DNA_RNApol_7kD:  DNA d  84.2    0.68 1.5E-05   17.2   0.9    9   51-59     17-25  (32)
 96 KOG1146|consensus               84.1    0.54 1.2E-05   32.0   1.0   49   24-73   1282-1350(1406)
 97 KOG2593|consensus               83.5    0.72 1.6E-05   27.6   1.2   34   50-86    127-160 (436)
 98 COG1997 RPL43A Ribosomal prote  83.0    0.85 1.8E-05   21.1   1.1   33   25-64     34-66  (89)
 99 KOG2593|consensus               82.5     2.3 4.9E-05   25.7   2.9   40   21-60    123-162 (436)
100 PF15269 zf-C2H2_7:  Zinc-finge  82.0     1.7 3.6E-05   17.5   1.7   22   52-73     21-42  (54)
101 PRK04023 DNA polymerase II lar  81.9     2.1 4.5E-05   28.8   2.8    7   28-34    628-634 (1121)
102 PF04606 Ogr_Delta:  Ogr/Delta-  81.6    0.44 9.6E-06   19.2  -0.0   34   29-62      2-38  (47)
103 COG1198 PriA Primosomal protei  81.1     1.3 2.9E-05   28.5   1.8   30   28-58    437-469 (730)
104 COG5236 Uncharacterized conser  80.9     4.8  0.0001   23.8   3.8   71    1-73    223-303 (493)
105 KOG2482|consensus               80.3     1.4 2.9E-05   25.9   1.5   23   51-73    195-217 (423)
106 KOG3408|consensus               80.2     1.3 2.8E-05   21.9   1.2   23   26-48     57-79  (129)
107 PF10537 WAC_Acf1_DNA_bd:  ATP-  80.1     3.1 6.8E-05   19.9   2.5   29    5-34     10-38  (102)
108 PF13878 zf-C2H2_3:  zinc-finge  78.8     3.2 6.8E-05   16.3   2.0   22    1-22     16-39  (41)
109 PF14311 DUF4379:  Domain of un  78.8     2.6 5.6E-05   17.5   1.8   17   50-66     27-43  (55)
110 COG3357 Predicted transcriptio  78.3     1.1 2.4E-05   20.9   0.7   13   26-38     58-70  (97)
111 PF02176 zf-TRAF:  TRAF-type zi  78.1     1.5 3.2E-05   18.3   1.1   40   24-63      7-54  (60)
112 COG4530 Uncharacterized protei  78.1     1.1 2.5E-05   21.7   0.7   28   28-63     11-38  (129)
113 PF08274 PhnA_Zn_Ribbon:  PhnA   77.6     1.3 2.7E-05   16.2   0.6   11   50-60     18-28  (30)
114 COG0068 HypF Hydrogenase matur  77.1    0.28 6.1E-06   31.1  -1.8   57    1-61    126-183 (750)
115 PRK03824 hypA hydrogenase nick  76.4     1.1 2.4E-05   22.5   0.5   10   52-61     71-80  (135)
116 smart00154 ZnF_AN1 AN1-like Zi  75.4     1.8   4E-05   16.7   0.9   14   51-64     12-25  (39)
117 COG3364 Zn-ribbon containing p  75.4     2.2 4.7E-05   20.5   1.2   16   26-41      2-17  (112)
118 PF12907 zf-met2:  Zinc-binding  75.0     2.5 5.3E-05   16.6   1.2   25   52-76      2-30  (40)
119 TIGR01206 lysW lysine biosynth  74.3     1.7 3.6E-05   18.3   0.7   30   27-61      3-32  (54)
120 KOG4167|consensus               74.2     1.2 2.6E-05   28.7   0.3   24    1-24    795-818 (907)
121 COG5236 Uncharacterized conser  74.0     5.1 0.00011   23.7   2.6   19   29-47    223-241 (493)
122 PRK14873 primosome assembly pr  74.0     1.4   3E-05   28.1   0.5    9   51-59    422-430 (665)
123 COG5151 SSL1 RNA polymerase II  72.3     6.4 0.00014   23.0   2.7   26   49-74    386-411 (421)
124 PF04423 Rad50_zn_hook:  Rad50   72.1     1.3 2.8E-05   18.3   0.1   11    1-11     23-33  (54)
125 COG3677 Transposase and inacti  72.0     1.3 2.9E-05   22.1   0.1   35   27-63     31-65  (129)
126 PF04780 DUF629:  Protein of un  71.9     4.4 9.6E-05   24.9   2.2   23   51-73     57-79  (466)
127 PF01428 zf-AN1:  AN1-like Zinc  71.7     1.9 4.1E-05   17.0   0.5   15   50-64     12-26  (43)
128 PF13451 zf-trcl:  Probable zin  71.6     2.3 5.1E-05   17.5   0.8   18   49-66      2-19  (49)
129 TIGR00595 priA primosomal prot  70.9     0.9 1.9E-05   27.8  -0.7    9   51-59    253-261 (505)
130 PF11672 DUF3268:  Protein of u  70.1     1.5 3.2E-05   21.1   0.0   10   25-34      1-10  (102)
131 PF10071 DUF2310:  Zn-ribbon-co  69.5     1.9 4.1E-05   24.2   0.4   30   49-85    218-247 (258)
132 COG4957 Predicted transcriptio  69.3     5.4 0.00012   20.2   1.8   25   52-79     77-101 (148)
133 PRK12380 hydrogenase nickel in  68.3     3.3 7.2E-05   20.1   1.0   10   52-61     71-80  (113)
134 TIGR00100 hypA hydrogenase nic  68.1     2.8 6.1E-05   20.4   0.8   11   52-62     71-81  (115)
135 PF07282 OrfB_Zn_ribbon:  Putat  68.1     9.2  0.0002   16.5   2.9   33   27-66     29-61  (69)
136 COG1773 Rubredoxin [Energy pro  67.5     2.9 6.2E-05   17.7   0.6   12   51-62      3-14  (55)
137 PF01927 Mut7-C:  Mut7-C RNAse   67.5     4.9 0.00011   20.4   1.6   43   27-69     92-142 (147)
138 COG1675 TFA1 Transcription ini  67.4     7.6 0.00016   20.6   2.3   43   13-61    100-142 (176)
139 PF10013 DUF2256:  Uncharacteri  67.4     4.7  0.0001   16.0   1.2   15   53-67     10-24  (42)
140 TIGR00686 phnA alkylphosphonat  67.3     3.5 7.6E-05   20.0   1.0   14   51-64     19-32  (109)
141 PF07503 zf-HYPF:  HypF finger;  66.7    0.91   2E-05   17.2  -0.9   10   52-61     22-31  (35)
142 PF04810 zf-Sec23_Sec24:  Sec23  66.4     2.3 4.9E-05   16.5   0.2   12   49-60     22-33  (40)
143 PTZ00255 60S ribosomal protein  64.6     3.4 7.5E-05   19.3   0.6   32   25-63     35-66  (90)
144 PF02891 zf-MIZ:  MIZ/SP-RING z  63.0     3.5 7.6E-05   16.9   0.5    7   27-33     42-48  (50)
145 KOG0978|consensus               63.0     4.5 9.8E-05   26.1   1.1   21   50-70    677-697 (698)
146 PF13824 zf-Mss51:  Zinc-finger  62.0     6.2 0.00013   16.7   1.1   12   24-35     12-23  (55)
147 PF08209 Sgf11:  Sgf11 (transcr  62.0     8.8 0.00019   14.4   1.4   21   51-72      4-24  (33)
148 COG4338 Uncharacterized protei  60.6     3.7   8E-05   16.8   0.3   15   53-67     14-28  (54)
149 PF12230 PRP21_like_P:  Pre-mRN  60.5     2.9 6.2E-05   22.9   0.0   31   50-81    167-197 (229)
150 PF10276 zf-CHCC:  Zinc-finger   60.5     4.4 9.4E-05   15.9   0.5   12   50-61     28-39  (40)
151 KOG1842|consensus               60.4     6.5 0.00014   24.1   1.4   25   51-75     15-39  (505)
152 PF14803 Nudix_N_2:  Nudix N-te  60.0     2.3 4.9E-05   16.0  -0.3    8   52-59     23-30  (34)
153 KOG1994|consensus               59.6     7.7 0.00017   21.6   1.5   25   50-74    238-262 (268)
154 PF14446 Prok-RING_1:  Prokaryo  59.3     3.2 6.9E-05   17.5   0.0   10   28-37      7-16  (54)
155 PF11789 zf-Nse:  Zinc-finger o  58.9     6.2 0.00013   16.7   0.9   32   49-84     22-53  (57)
156 PF08790 zf-LYAR:  LYAR-type C2  58.8     1.5 3.4E-05   15.8  -0.8    8   29-36      3-10  (28)
157 PF00301 Rubredoxin:  Rubredoxi  58.8     5.4 0.00012   16.2   0.7   12   52-63      2-13  (47)
158 KOG0717|consensus               57.3     9.4  0.0002   23.6   1.7   22   52-73    293-314 (508)
159 PF01155 HypA:  Hydrogenase exp  56.8     5.1 0.00011   19.4   0.5   11   52-62     71-81  (113)
160 PRK00564 hypA hydrogenase nick  56.0     6.5 0.00014   19.3   0.8    9   52-60     72-80  (117)
161 COG1571 Predicted DNA-binding   55.1     7.5 0.00016   23.6   1.1   13   51-63    367-379 (421)
162 PRK10220 hypothetical protein;  54.7      10 0.00022   18.5   1.3   13   51-63     20-32  (111)
163 COG4888 Uncharacterized Zn rib  54.6       3 6.5E-05   19.9  -0.4   38   24-62     20-57  (104)
164 PF12773 DZR:  Double zinc ribb  54.3     7.5 0.00016   15.5   0.8   25   28-60     14-38  (50)
165 COG3091 SprT Zn-dependent meta  54.0     9.8 0.00021   19.8   1.3   32   50-86    116-147 (156)
166 PRK03681 hypA hydrogenase nick  53.7     7.5 0.00016   18.9   0.8   10   27-36     71-80  (114)
167 smart00440 ZnF_C2C2 C2C2 Zinc   53.4     3.2 6.9E-05   16.1  -0.4   10   52-61     29-38  (40)
168 cd00730 rubredoxin Rubredoxin;  52.9     5.9 0.00013   16.3   0.3   12   52-63      2-13  (50)
169 PF07975 C1_4:  TFIIH C1-like d  52.7     2.4 5.1E-05   17.6  -0.9   17   51-67     21-37  (51)
170 PF15135 UPF0515:  Uncharacteri  52.4      12 0.00027   21.1   1.6   14   51-64    155-168 (278)
171 PLN02294 cytochrome c oxidase   52.2     8.1 0.00018   20.4   0.8   14   25-38    140-153 (174)
172 PF02591 DUF164:  Putative zinc  52.1      18 0.00039   15.0   1.8   32   28-60     24-55  (56)
173 COG2879 Uncharacterized small   52.0      22 0.00047   15.6   2.1   18    9-26     23-40  (65)
174 PF01363 FYVE:  FYVE zinc finge  52.0      13 0.00028   16.0   1.4   10   28-37     11-20  (69)
175 PF07295 DUF1451:  Protein of u  51.7     3.1 6.8E-05   21.3  -0.7   30   25-61    111-140 (146)
176 PRK00432 30S ribosomal protein  51.3      13 0.00027   15.3   1.2   12   50-61     36-47  (50)
177 PF09845 DUF2072:  Zn-ribbon co  50.6     6.8 0.00015   19.8   0.4   13   52-64      2-14  (131)
178 PF14353 CpXC:  CpXC protein     50.2     9.4  0.0002   18.8   0.9   15   50-64     37-51  (128)
179 COG5112 UFD2 U1-like Zn-finger  48.5     8.5 0.00019   18.7   0.5   24   25-48     54-77  (126)
180 COG1326 Uncharacterized archae  48.2      26 0.00056   19.1   2.3   37   26-63      6-42  (201)
181 KOG2071|consensus               47.8      12 0.00026   23.8   1.2   23    1-23    421-443 (579)
182 PTZ00448 hypothetical protein;  47.3      19 0.00041   21.6   1.8   24   51-74    314-337 (373)
183 COG5188 PRP9 Splicing factor 3  46.8      11 0.00024   22.5   0.9   20    1-20    241-260 (470)
184 TIGR03829 YokU_near_AblA uncha  46.6      13 0.00028   17.5   1.0   15    1-15     38-52  (89)
185 PF05191 ADK_lid:  Adenylate ki  46.4      10 0.00022   14.4   0.5   11   52-62      2-12  (36)
186 KOG2636|consensus               45.5      45 0.00098   20.8   3.2   24   49-72    399-423 (497)
187 cd00924 Cyt_c_Oxidase_Vb Cytoc  45.5      12 0.00026   17.8   0.8   14   25-38     78-91  (97)
188 COG0675 Transposase and inacti  45.5      32 0.00069   19.6   2.6   22   49-70    320-341 (364)
189 PF03811 Zn_Tnp_IS1:  InsA N-te  45.2     1.8 3.8E-05   16.6  -1.7    8   50-57     28-35  (36)
190 PF13453 zf-TFIIB:  Transcripti  44.1      23  0.0005   13.6   1.4   16    1-16     22-37  (41)
191 COG4391 Uncharacterized protei  44.1     4.5 9.8E-05   17.5  -0.7   45   17-62     15-59  (62)
192 PF01286 XPA_N:  XPA protein N-  44.1     7.6 0.00016   14.7   0.0    6    3-8       8-13  (34)
193 PLN03238 probable histone acet  43.8      33 0.00072   19.9   2.4   25   49-73     46-70  (290)
194 KOG2907|consensus               43.6      16 0.00035   18.0   1.0   11   52-62    103-113 (116)
195 TIGR00143 hypF [NiFe] hydrogen  43.5     1.7 3.6E-05   28.0  -2.8   11   51-61    140-150 (711)
196 KOG3507|consensus               43.2      19  0.0004   15.5   1.1   28   26-61     20-47  (62)
197 PRK05580 primosome assembly pr  43.1      27 0.00058   22.8   2.2    9   51-59    421-429 (679)
198 PF14369 zf-RING_3:  zinc-finge  43.1     9.6 0.00021   14.4   0.2    8    1-8      24-31  (35)
199 cd00065 FYVE FYVE domain; Zinc  43.0      19 0.00041   14.7   1.2    9   53-61     20-28  (57)
200 KOG0782|consensus               42.1     4.3 9.4E-05   25.8  -1.2   51   13-65    240-290 (1004)
201 PF14255 Cys_rich_CPXG:  Cystei  41.7      11 0.00025   15.7   0.3    9   53-61      2-10  (52)
202 TIGR00515 accD acetyl-CoA carb  41.0      21 0.00046   20.6   1.4   10   52-61     46-55  (285)
203 PLN02748 tRNA dimethylallyltra  40.8      28  0.0006   21.7   1.9   24   50-73    417-441 (468)
204 TIGR01562 FdhE formate dehydro  40.7      20 0.00044   20.9   1.3    9   27-35    185-193 (305)
205 PF03966 Trm112p:  Trm112p-like  40.5      12 0.00026   16.2   0.4   14   49-62     51-64  (68)
206 PF06397 Desulfoferrod_N:  Desu  40.2      16 0.00034   14.0   0.6   10   51-60      6-15  (36)
207 TIGR02159 PA_CoA_Oxy4 phenylac  40.2     4.4 9.6E-05   20.7  -1.2   11   51-61    130-140 (146)
208 PRK05452 anaerobic nitric oxid  40.0      14 0.00031   22.8   0.7   13   25-37    424-436 (479)
209 KOG2807|consensus               40.0      40 0.00087   20.1   2.4   24   51-74    345-368 (378)
210 COG1656 Uncharacterized conser  39.5      28  0.0006   18.4   1.6   46   27-72     98-151 (165)
211 PRK14714 DNA polymerase II lar  39.4      24 0.00051   25.0   1.6    6   53-58    711-716 (1337)
212 COG1998 RPS31 Ribosomal protei  39.4      28 0.00062   14.4   1.3   10   51-60     37-46  (51)
213 TIGR03831 YgiT_finger YgiT-typ  38.6      15 0.00032   14.1   0.5   11   52-62     33-43  (46)
214 PF13821 DUF4187:  Domain of un  38.5      22 0.00048   14.9   1.0   22   49-70     25-46  (55)
215 COG4306 Uncharacterized protei  38.5      13 0.00028   18.7   0.3   17   49-65     66-82  (160)
216 PF14205 Cys_rich_KTR:  Cystein  38.4     9.8 0.00021   16.1  -0.1   11   50-60     27-37  (55)
217 PF08792 A2L_zn_ribbon:  A2L zi  37.9      19 0.00041   13.4   0.7   12   51-62     21-32  (33)
218 PRK00420 hypothetical protein;  37.3      27  0.0006   17.2   1.3   28   27-62     24-51  (112)
219 PF00130 C1_1:  Phorbol esters/  37.1      32 0.00069   13.8   1.4   28   25-60     10-37  (53)
220 PF06524 NOA36:  NOA36 protein;  36.5       7 0.00015   22.2  -0.8   24   49-72    207-230 (314)
221 PF05129 Elf1:  Transcription e  35.9      18 0.00039   16.5   0.6    9   50-58     21-29  (81)
222 PHA02998 RNA polymerase subuni  35.7      13 0.00029   19.9   0.1   11   52-62    172-182 (195)
223 KOG1280|consensus               35.5      50  0.0011   19.9   2.3   27   50-76     78-104 (381)
224 PRK05978 hypothetical protein;  35.5      22 0.00049   18.4   0.9   30   27-62     34-63  (148)
225 PRK14559 putative protein seri  35.5      15 0.00033   23.7   0.4   12   53-64     43-54  (645)
226 TIGR01384 TFS_arch transcripti  35.3      14 0.00031   17.4   0.2   25    1-37      3-27  (104)
227 PRK04351 hypothetical protein;  35.1      24 0.00051   18.3   0.9   28   51-86    112-139 (149)
228 CHL00174 accD acetyl-CoA carbo  35.1      30 0.00065   20.2   1.4   11   27-37     58-68  (296)
229 PF14690 zf-ISL3:  zinc-finger   35.1      20 0.00043   14.0   0.6   10   51-60      2-11  (47)
230 PRK03564 formate dehydrogenase  34.8      39 0.00085   19.8   1.9   11   25-35    186-196 (309)
231 PF10263 SprT-like:  SprT-like   34.8      12 0.00025   19.0  -0.1   11   51-61    123-133 (157)
232 PF08271 TF_Zn_Ribbon:  TFIIB z  34.7      22 0.00047   13.8   0.7    9   52-60      1-9   (43)
233 PF02701 zf-Dof:  Dof domain, z  34.6     1.9   4E-05   18.7  -2.5   43   24-66      3-45  (63)
234 PRK01343 zinc-binding protein;  34.5      26 0.00055   15.0   0.9   10   52-61     10-19  (57)
235 smart00109 C1 Protein kinase C  34.4      29 0.00064   13.3   1.1    9   51-59     27-35  (49)
236 smart00064 FYVE Protein presen  34.2      27 0.00059   14.9   1.0   26   28-62     12-37  (68)
237 PF09963 DUF2197:  Uncharacteri  34.0      23 0.00051   15.1   0.7   34   27-60      3-40  (56)
238 PRK00762 hypA hydrogenase nick  33.9      31 0.00067   17.1   1.2    9   52-61     71-79  (124)
239 COG1579 Zn-ribbon protein, pos  33.8      30 0.00066   19.5   1.3   34   28-62    199-232 (239)
240 PRK12860 transcriptional activ  33.7      42  0.0009   18.3   1.7   28   51-86    134-161 (189)
241 KOG2817|consensus               33.5      44 0.00096   20.4   1.9   35   49-86    347-381 (394)
242 PF01780 Ribosomal_L37ae:  Ribo  33.4      18  0.0004   17.0   0.4   31   25-62     34-64  (90)
243 PRK12722 transcriptional activ  33.2      42 0.00092   18.2   1.7   27   52-86    135-161 (187)
244 PF03884 DUF329:  Domain of unk  33.2      22 0.00047   15.2   0.5   12   52-63      3-14  (57)
245 PF10083 DUF2321:  Uncharacteri  33.2      15 0.00033   19.2   0.1   19   49-67     66-84  (158)
246 KOG2747|consensus               32.9      31 0.00067   21.0   1.3   25   49-73    156-180 (396)
247 COG2331 Uncharacterized protei  32.8      29 0.00063   15.8   0.9   30   27-60     13-42  (82)
248 PLN00104 MYST -like histone ac  32.8      44 0.00095   20.8   1.9   25   49-73    196-220 (450)
249 PRK05654 acetyl-CoA carboxylas  32.2      44 0.00095   19.4   1.8   10   52-61     47-56  (292)
250 PLN03239 histone acetyltransfe  32.1      49  0.0011   19.9   1.9   25   49-73    104-128 (351)
251 PF02146 SIR2:  Sir2 family;  I  31.8      78  0.0017   16.6   2.6   13   52-64    106-118 (178)
252 PF14787 zf-CCHC_5:  GAG-polypr  31.4      21 0.00046   13.7   0.3   14   53-66      4-17  (36)
253 PF09416 UPF1_Zn_bind:  RNA hel  31.4      43 0.00093   17.5   1.5   34    1-34     17-68  (152)
254 PF01215 COX5B:  Cytochrome c o  31.4      23  0.0005   18.1   0.5   14   49-62    110-123 (136)
255 COG5216 Uncharacterized conser  30.5      40 0.00087   14.5   1.1   11   49-59     42-52  (67)
256 COG5109 Uncharacterized conser  30.4      53  0.0011   19.6   1.9   10   76-85    373-382 (396)
257 PRK08222 hydrogenase 4 subunit  30.2      41  0.0009   17.9   1.4   19   50-68    113-131 (181)
258 PF05741 zf-nanos:  Nanos RNA b  29.9      16 0.00034   15.5  -0.1   10   50-59     32-41  (55)
259 PTZ00064 histone acetyltransfe  29.4      60  0.0013   20.7   2.1   25   49-73    278-302 (552)
260 PF04641 Rtf2:  Rtf2 RING-finge  29.4      21 0.00046   20.1   0.3   15   24-38    111-125 (260)
261 PHA02942 putative transposase;  29.1 1.2E+02  0.0025   18.5   3.2   30   28-65    327-356 (383)
262 KOG2857|consensus               29.1      31 0.00068   17.8   0.8   23   50-72     16-38  (157)
263 PF13248 zf-ribbon_3:  zinc-rib  29.0      21 0.00047   12.2   0.2    7   28-34      4-10  (26)
264 TIGR03830 CxxCG_CxxCG_HTH puta  29.0      78  0.0017   15.3   2.2   21   50-70     30-50  (127)
265 KOG4727|consensus               28.8      46   0.001   17.8   1.4   22   51-72     75-96  (193)
266 PF06220 zf-U1:  U1 zinc finger  28.7      48   0.001   12.7   1.4   10   52-61      4-13  (38)
267 cd00974 DSRD Desulforedoxin (D  28.7      34 0.00075   12.5   0.7   11   51-61      4-14  (34)
268 TIGR00627 tfb4 transcription f  28.7      50  0.0011   19.1   1.6   14   49-62    253-266 (279)
269 COG1327 Predicted transcriptio  28.6      22 0.00048   18.5   0.3   13    1-13     31-43  (156)
270 TIGR00280 L37a ribosomal prote  28.5      31 0.00067   16.3   0.7   32   25-63     34-65  (91)
271 PTZ00043 cytochrome c oxidase   28.4      29 0.00063   19.5   0.6   17   24-40    179-195 (268)
272 TIGR00319 desulf_FeS4 desulfof  28.3      36 0.00078   12.4   0.7   11   51-61      7-17  (34)
273 PF01096 TFIIS_C:  Transcriptio  28.3      30 0.00064   13.3   0.5   11   51-61     28-38  (39)
274 PF05495 zf-CHY:  CHY zinc fing  27.7      10 0.00023   16.7  -0.9   12   51-62     41-52  (71)
275 PF02748 PyrI_C:  Aspartate car  27.6      28 0.00061   14.5   0.4   16   49-64     33-48  (52)
276 PRK11827 hypothetical protein;  27.3      54  0.0012   14.2   1.3   16   51-66     26-41  (60)
277 smart00661 RPOL9 RNA polymeras  27.2      35 0.00077   13.6   0.7   13   51-63     20-32  (52)
278 KOG1088|consensus               26.8      38 0.00083   16.9   0.8   19   21-39     93-111 (124)
279 COG4640 Predicted membrane pro  26.8      47   0.001   20.5   1.3   20   25-44     14-33  (465)
280 PF10122 Mu-like_Com:  Mu-like   26.7      21 0.00046   14.9   0.0   10   51-60     24-33  (51)
281 cd00122 MBD MeCP2, MBD1, MBD2,  26.7      60  0.0013   13.8   1.4   18    4-21     33-50  (62)
282 PF00641 zf-RanBP:  Zn-finger i  26.1      27  0.0006   12.2   0.2    6   80-85      5-10  (30)
283 COG3024 Uncharacterized protei  26.1      37 0.00081   14.9   0.7   12   52-63      8-19  (65)
284 PTZ00409 Sir2 (Silent Informat  26.1      94   0.002   17.9   2.4   15   51-65    137-151 (271)
285 PF09889 DUF2116:  Uncharacteri  26.0      34 0.00075   14.7   0.6    7    1-7       6-12  (59)
286 TIGR01053 LSD1 zinc finger dom  25.6      39 0.00084   12.4   0.6    6   80-85     20-25  (31)
287 cd01413 SIR2_Af2 SIR2_Af2: Arc  25.5      94   0.002   17.1   2.3   14   51-64    113-126 (222)
288 PRK12387 formate hydrogenlyase  25.4      58  0.0013   17.2   1.4   19   50-68    113-131 (180)
289 PF06170 DUF983:  Protein of un  25.4      30 0.00064   16.1   0.3    8    1-8      11-18  (86)
290 PRK03976 rpl37ae 50S ribosomal  25.3      39 0.00084   16.0   0.7   32   25-63     35-66  (90)
291 TIGR00244 transcriptional regu  25.1      27 0.00059   18.1   0.2   14    1-14     31-44  (147)
292 smart00391 MBD Methyl-CpG bind  24.9      59  0.0013   14.7   1.2   19    4-22     36-54  (77)
293 COG1594 RPB9 DNA-directed RNA   24.8     8.4 0.00018   18.8  -1.6   12   51-62    100-111 (113)
294 PF04988 AKAP95:  A-kinase anch  24.2      65  0.0014   17.1   1.4   22   52-73      1-22  (165)
295 PF01844 HNH:  HNH endonuclease  23.6      31 0.00067   13.2   0.2    9    1-9       1-9   (47)
296 cd04476 RPA1_DBD_C RPA1_DBD_C:  23.6      21 0.00046   18.4  -0.4   12   50-61     50-61  (166)
297 KOG4118|consensus               23.5      49  0.0011   14.6   0.8   29   51-79     38-66  (74)
298 KOG0801|consensus               23.4      18 0.00038   19.1  -0.6   17   67-86    129-145 (205)
299 PF09082 DUF1922:  Domain of un  22.8      29 0.00062   15.5   0.0    7   53-60     22-28  (68)
300 COG5027 SAS2 Histone acetyltra  22.7      54  0.0012   19.8   1.1   25   49-73    156-180 (395)
301 KOG1940|consensus               22.6 1.3E+02  0.0027   17.6   2.4    8   27-34    197-204 (276)
302 cd01410 SIRT7 SIRT7: Eukaryoti  22.3 1.3E+02  0.0027   16.5   2.3    6   29-34     98-103 (206)
303 PF14447 Prok-RING_4:  Prokaryo  22.2      52  0.0011   14.0   0.7   15   49-63     37-51  (55)
304 KOG2923|consensus               22.0      93   0.002   13.7   1.7   10   49-58     42-51  (67)
305 COG1779 C4-type Zn-finger prot  22.0      24 0.00052   19.3  -0.3   14   50-63     42-55  (201)
306 KOG0402|consensus               22.0      51  0.0011   15.4   0.7   23   38-60     18-45  (92)
307 PF14149 YhfH:  YhfH-like prote  21.5      29 0.00062   13.4  -0.1    7    1-7      16-22  (37)
308 PF11931 DUF3449:  Domain of un  21.3      32 0.00068   18.8   0.0   14   73-86     95-108 (196)
309 PRK14138 NAD-dependent deacety  21.3 1.3E+02  0.0028   16.9   2.3   16   51-66    119-134 (244)
310 smart00132 LIM Zinc-binding do  21.1      46   0.001   11.8   0.5   10   52-61     28-37  (39)
311 PF14354 Lar_restr_allev:  Rest  21.1      53  0.0011   13.7   0.7    8   53-60      5-12  (61)
312 PF10367 Vps39_2:  Vacuolar sor  20.9      39 0.00085   15.7   0.3    6    2-7      82-87  (109)
313 PRK11032 hypothetical protein;  20.8      47   0.001   17.5   0.6   30   25-61    123-152 (160)
314 PRK00418 DNA gyrase inhibitor;  20.8      59  0.0013   14.2   0.8   11   51-61      6-16  (62)
315 COG0846 SIR2 NAD-dependent pro  20.6      93   0.002   17.7   1.7   11   52-62    123-133 (250)
316 PF11023 DUF2614:  Protein of u  20.4      56  0.0012   16.2   0.7   13   49-61     67-79  (114)
317 KOG3352|consensus               20.2      43 0.00094   17.5   0.3   14   25-38    132-145 (153)
318 PF07649 C1_3:  C1-like domain;  20.1      58  0.0012   11.4   0.6   11   50-60     14-24  (30)
319 KOG4602|consensus               20.0      48   0.001   19.1   0.5   11   50-60    267-277 (318)

No 1  
>KOG2462|consensus
Probab=99.95  E-value=5.7e-28  Score=126.62  Aligned_cols=84  Identities=25%  Similarity=0.478  Sum_probs=79.4

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC---CcceecccccccccCHHHHHHHHHhCCCC
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS---DRQFACHMCIKVFPSQDKLRMHMLSGLQT   77 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~---~~~~~C~~C~~~~~~~~~l~~h~~~~~~~   77 (86)
                      |++||+.|.+...|.+|+++|+  -+++|.+||+.|....-|+.|+++   +|||.|+.|+++|++.++|+.||++|.+.
T Consensus       164 C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~  241 (279)
T KOG2462|consen  164 CKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDV  241 (279)
T ss_pred             CCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCC
Confidence            7899999999999999999997  479999999999999999999997   99999999999999999999999999999


Q ss_pred             ccCCCCcCC
Q psy4084          78 FDLKSKLCT   86 (86)
Q Consensus        78 ~~~~c~~C~   86 (86)
                      +.|+|..|+
T Consensus       242 K~~qC~~C~  250 (279)
T KOG2462|consen  242 KKHQCPRCG  250 (279)
T ss_pred             ccccCcchh
Confidence            999999885


No 2  
>KOG2462|consensus
Probab=99.91  E-value=1.2e-25  Score=117.93  Aligned_cols=74  Identities=30%  Similarity=0.548  Sum_probs=71.1

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC---CcceecccccccccCHHHHHHHHHhC
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS---DRQFACHMCIKVFPSQDKLRMHMLSG   74 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~---~~~~~C~~C~~~~~~~~~l~~h~~~~   74 (86)
                      |.+||++|....-|+.|+|+|+||+||.|+.|++.|...++|+.||.+   .++|+|..|++.|+..+.|+.|....
T Consensus       190 C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  190 CGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             cccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhhc
Confidence            789999999999999999999999999999999999999999999998   68999999999999999999998764


No 3  
>KOG3623|consensus
Probab=99.67  E-value=4.1e-17  Score=95.59  Aligned_cols=86  Identities=23%  Similarity=0.481  Sum_probs=77.0

Q ss_pred             CcchhhhccChHHHHhhHHHHhC--CCceecccccccCCChHHHhhhhhC----------------Ccceeccccccccc
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHS--DRQFACHMCIKVFPSQDKLRMHMLS----------------DRQFACHMCIKVFP   62 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~--~~~~~c~~c~~~~~~~~~l~~h~~~----------------~~~~~C~~C~~~~~   62 (86)
                      |++|.+.+.+...|+.|+...+.  +..|.|..|...|.....|.+|+..                .+.|+|.+||++|.
T Consensus       213 cpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFK  292 (1007)
T KOG3623|consen  213 CPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFK  292 (1007)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhh
Confidence            78899999999999999885443  4568999999999999999999853                37799999999999


Q ss_pred             CHHHHHHHHHhCCCCccCCCCcCC
Q psy4084          63 SQDKLRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        63 ~~~~l~~h~~~~~~~~~~~c~~C~   86 (86)
                      ++..|..|+++|.+++||.|.+|.
T Consensus       293 fKHHLKEHlRIHSGEKPfeCpnCk  316 (1007)
T KOG3623|consen  293 FKHHLKEHLRIHSGEKPFECPNCK  316 (1007)
T ss_pred             hHHHHHhhheeecCCCCcCCcccc
Confidence            999999999999999999999984


No 4  
>KOG3576|consensus
Probab=99.60  E-value=4.2e-16  Score=79.76  Aligned_cols=77  Identities=19%  Similarity=0.395  Sum_probs=54.5

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC--------------CcceecccccccccCHHH
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS--------------DRQFACHMCIKVFPSQDK   66 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~--------------~~~~~C~~C~~~~~~~~~   66 (86)
                      |..||+.|....+|++|+|+|+|.+||.|..|++.|...-+|..|...              .+.|.|+.||.+......
T Consensus       148 ct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~  227 (267)
T KOG3576|consen  148 CTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEV  227 (267)
T ss_pred             HhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhH
Confidence            445777777777777777777777777777777777777777666542              355777777777777777


Q ss_pred             HHHHHHhCCCC
Q psy4084          67 LRMHMLSGLQT   77 (86)
Q Consensus        67 l~~h~~~~~~~   77 (86)
                      +..|+..|+-.
T Consensus       228 ~~~h~~~~hp~  238 (267)
T KOG3576|consen  228 YYLHLKLHHPF  238 (267)
T ss_pred             HHHHHHhcCCC
Confidence            77777766543


No 5  
>KOG3623|consensus
Probab=99.60  E-value=2.6e-16  Score=92.31  Aligned_cols=72  Identities=24%  Similarity=0.548  Sum_probs=63.4

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC---CcceecccccccccCHHHHHHHHH
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS---DRQFACHMCIKVFPSQDKLRMHML   72 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~---~~~~~C~~C~~~~~~~~~l~~h~~   72 (86)
                      |+.|+++|...+.|-+|.-.|+|.+||+|.+|.+.|..+-.|..|++.   ++||+|..|++.|...+...+||.
T Consensus       897 CDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  897 CDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             HHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhhc
Confidence            678899998888899998899999999999999999998888888875   889999999999998888888885


No 6  
>KOG3576|consensus
Probab=99.59  E-value=2.1e-16  Score=80.86  Aligned_cols=86  Identities=21%  Similarity=0.405  Sum_probs=69.5

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC---CcceecccccccccCHHHHHHHHHhCC--
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS---DRQFACHMCIKVFPSQDKLRMHMLSGL--   75 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~---~~~~~C~~C~~~~~~~~~l~~h~~~~~--   75 (86)
                      |.+||+.|....-|.+|+.-|...+.+-|..||++|...-.|.+|+++   .+||+|..|+++|...-.|..|++.-+  
T Consensus       120 CrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv  199 (267)
T KOG3576|consen  120 CRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGV  199 (267)
T ss_pred             eehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCc
Confidence            677888888888888888888888888888899988888888888886   688899999999888888888887532  


Q ss_pred             ---------CCccCCCCcCC
Q psy4084          76 ---------QTFDLKSKLCT   86 (86)
Q Consensus        76 ---------~~~~~~c~~C~   86 (86)
                               +++-|.|+.|+
T Consensus       200 ~~~yaykerr~kl~vcedcg  219 (267)
T KOG3576|consen  200 QHQYAYKERRAKLYVCEDCG  219 (267)
T ss_pred             hHHHHHHHhhhheeeecccC
Confidence                     34446676664


No 7  
>KOG1074|consensus
Probab=99.57  E-value=1.5e-15  Score=90.05  Aligned_cols=46  Identities=24%  Similarity=0.617  Sum_probs=35.5

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhh
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHM   46 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~   46 (86)
                      |..|++.|.+.+.|+.|+|+|+|++||+|++||..|.++.+|..|.
T Consensus       356 Cr~CakvfgS~SaLqiHlRSHTGERPfqCnvCG~~FSTkGNLKvH~  401 (958)
T KOG1074|consen  356 CRFCAKVFGSDSALQIHLRSHTGERPFQCNVCGNRFSTKGNLKVHF  401 (958)
T ss_pred             hhhhHhhcCchhhhhhhhhccCCCCCeeecccccccccccceeeee
Confidence            5677788888888888888888888888888888887777776654


No 8  
>KOG3608|consensus
Probab=99.56  E-value=3.4e-15  Score=81.76  Aligned_cols=84  Identities=24%  Similarity=0.437  Sum_probs=63.4

Q ss_pred             chhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC-------------------------------Ccc
Q psy4084           3 ECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS-------------------------------DRQ   51 (86)
Q Consensus         3 ~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~-------------------------------~~~   51 (86)
                      .|-+.+.++..|..|+++|++++...|+.||..|.....|..|.+.                               ..-
T Consensus       184 ~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~  263 (467)
T KOG3608|consen  184 MCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNC  263 (467)
T ss_pred             hhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhc
Confidence            3667778888888888888888888888888888888777777642                               234


Q ss_pred             eecccccccccCHHHHHHHHHh-CCCCccCCCCcCC
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLS-GLQTFDLKSKLCT   86 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~-~~~~~~~~c~~C~   86 (86)
                      |.|+.|.-+....+.|..|++. |.+++||+|+.|+
T Consensus       264 ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd  299 (467)
T KOG3608|consen  264 YKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECD  299 (467)
T ss_pred             ccccccccCCCChHHHHHHHHhhhccCCCccccchh
Confidence            5666677777777777777775 7788999998875


No 9  
>KOG1074|consensus
Probab=99.54  E-value=7.1e-16  Score=91.32  Aligned_cols=75  Identities=28%  Similarity=0.571  Sum_probs=69.7

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC-------Ccceecc---cccccccCHHHHHHH
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS-------DRQFACH---MCIKVFPSQDKLRMH   70 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~-------~~~~~C~---~C~~~~~~~~~l~~h   70 (86)
                      |..|-+...-++.|+.|.|+|+|++||+|.+|++.|.++.+|+.|+..       ..++.|+   +|-+.|.....|..|
T Consensus       608 CiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lpQh  687 (958)
T KOG1074|consen  608 CIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLPQH  687 (958)
T ss_pred             eeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccccce
Confidence            778999999999999999999999999999999999999999999975       3468899   899999999999999


Q ss_pred             HHhCC
Q psy4084          71 MLSGL   75 (86)
Q Consensus        71 ~~~~~   75 (86)
                      ++.|.
T Consensus       688 IriH~  692 (958)
T KOG1074|consen  688 IRIHL  692 (958)
T ss_pred             EEeec
Confidence            99987


No 10 
>PHA00733 hypothetical protein
Probab=99.40  E-value=8.4e-13  Score=64.28  Aligned_cols=76  Identities=18%  Similarity=0.323  Sum_probs=59.3

Q ss_pred             CcchhhhccChHHHHhh--HH---HHhCCCceecccccccCCChHHHhhhhhC-CcceecccccccccCHHHHHHHHHhC
Q psy4084           1 MSECMGKFTEYQVIRKH--IR---TFHSDRQFACHMCIKVFPSQDKLRMHMLS-DRQFACHMCIKVFPSQDKLRMHMLSG   74 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h--~~---~~~~~~~~~c~~c~~~~~~~~~l~~h~~~-~~~~~C~~C~~~~~~~~~l~~h~~~~   74 (86)
                      |.+|++.|.....|..+  ++   .+.+.+||.|..|++.|.....|..|+.. ..++.|..|++.|.....|..|+...
T Consensus        43 ~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h~~~~~C~~CgK~F~~~~sL~~H~~~~  122 (128)
T PHA00733         43 RAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYTEHSKVCPVCGKEFRNTDSTLDHVCKK  122 (128)
T ss_pred             HHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcCCcCccCCCCCCccCCHHHHHHHHHHh
Confidence            34566666666555544  22   23347899999999999999999999885 56799999999999999999999875


Q ss_pred             CC
Q psy4084          75 LQ   76 (86)
Q Consensus        75 ~~   76 (86)
                      ++
T Consensus       123 h~  124 (128)
T PHA00733        123 HN  124 (128)
T ss_pred             cC
Confidence            53


No 11 
>KOG3608|consensus
Probab=99.39  E-value=6.8e-13  Score=73.00  Aligned_cols=80  Identities=18%  Similarity=0.404  Sum_probs=58.6

Q ss_pred             cchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC----CcceecccccccccCHHHHHHHHHhCCCC
Q psy4084           2 SECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS----DRQFACHMCIKVFPSQDKLRMHMLSGLQT   77 (86)
Q Consensus         2 ~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~----~~~~~C~~C~~~~~~~~~l~~h~~~~~~~   77 (86)
                      ..|.+.|.....|+.|++.|.  +-|.|+.|..+....++|..|++.    ++||+|..|.+.+.+.+.|+.|...|. +
T Consensus       241 ~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~  317 (467)
T KOG3608|consen  241 AQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-K  317 (467)
T ss_pred             HHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-c
Confidence            344455555555555555543  347888888888888888888875    788899888888888888888888775 6


Q ss_pred             ccCCCCc
Q psy4084          78 FDLKSKL   84 (86)
Q Consensus        78 ~~~~c~~   84 (86)
                      ..|.|+.
T Consensus       318 ~~y~C~h  324 (467)
T KOG3608|consen  318 TVYQCEH  324 (467)
T ss_pred             cceecCC
Confidence            7788775


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.35  E-value=2.9e-12  Score=74.61  Aligned_cols=80  Identities=20%  Similarity=0.416  Sum_probs=67.1

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC---CcceecccccccccC----------HHHH
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS---DRQFACHMCIKVFPS----------QDKL   67 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~---~~~~~C~~C~~~~~~----------~~~l   67 (86)
                      |+.|++.|. ...|..|+..++  .++.|+ |+..+ ....|..|+..   .+++.|+.|+..+..          ...|
T Consensus       456 C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~L  530 (567)
T PLN03086        456 CEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGM  530 (567)
T ss_pred             CCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhH
Confidence            788999996 677999999975  789999 99654 66888899875   789999999999852          4589


Q ss_pred             HHHHHhCCCCccCCCCcCC
Q psy4084          68 RMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        68 ~~h~~~~~~~~~~~c~~C~   86 (86)
                      ..|... .+.+++.|..|+
T Consensus       531 t~HE~~-CG~rt~~C~~Cg  548 (567)
T PLN03086        531 SEHESI-CGSRTAPCDSCG  548 (567)
T ss_pred             HHHHHh-cCCcceEccccC
Confidence            999988 499999999996


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.25  E-value=3.2e-12  Score=53.08  Aligned_cols=40  Identities=10%  Similarity=0.257  Sum_probs=27.2

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHH
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKL   42 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l   42 (86)
                      |+.||+.|...++|..|+++|+  +++.|..|++.|...+.|
T Consensus         8 C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          8 CPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            6677777777777777777776  466777777766654443


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.20  E-value=1.8e-11  Score=50.87  Aligned_cols=38  Identities=11%  Similarity=0.447  Sum_probs=18.3

Q ss_pred             eecccccccCCChHHHhhhhhC-CcceecccccccccCH
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLS-DRQFACHMCIKVFPSQ   64 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~-~~~~~C~~C~~~~~~~   64 (86)
                      |+|+.||+.|...+.|..|++. .++++|..|++.|...
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~k~~kc~~C~k~f~~~   44 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHNTNLKLSNCKRISLRT   44 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcCCcccCCcccceeccc
Confidence            4455555555555555555544 2344555555544433


No 15 
>PHA00616 hypothetical protein
Probab=99.16  E-value=1.5e-11  Score=48.87  Aligned_cols=34  Identities=21%  Similarity=0.388  Sum_probs=31.5

Q ss_pred             ceecccccccccCHHHHHHHHHhCCCCccCCCCc
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKL   84 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~   84 (86)
                      ||+|+.||+.|.....|..|+++|+++.++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            6899999999999999999999999999998763


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.14  E-value=4.9e-11  Score=42.85  Aligned_cols=25  Identities=32%  Similarity=0.805  Sum_probs=22.8

Q ss_pred             HHHhhHHHHhCCCceecccccccCC
Q psy4084          13 VIRKHIRTFHSDRQFACHMCIKVFP   37 (86)
Q Consensus        13 ~l~~h~~~~~~~~~~~c~~c~~~~~   37 (86)
                      +|..|+++|++++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4889999999999999999998875


No 17 
>PHA00733 hypothetical protein
Probab=99.00  E-value=4.7e-10  Score=54.75  Aligned_cols=74  Identities=12%  Similarity=0.257  Sum_probs=54.8

Q ss_pred             hHHHHhhHHHHhCCCceecccccccCCChHHHhhh------hhC--CcceecccccccccCHHHHHHHHHhCCCCccCCC
Q psy4084          11 YQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMH------MLS--DRQFACHMCIKVFPSQDKLRMHMLSGLQTFDLKS   82 (86)
Q Consensus        11 ~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h------~~~--~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c   82 (86)
                      .+.|.++-......+++.|.+|...+.....|..+      +..  .+||.|+.|++.|.....|..|++.+  +.++.|
T Consensus        25 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C  102 (128)
T PHA00733         25 LEELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVC  102 (128)
T ss_pred             HHHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccC
Confidence            34444443434456788999998877776655544      222  67999999999999999999999976  356899


Q ss_pred             CcCC
Q psy4084          83 KLCT   86 (86)
Q Consensus        83 ~~C~   86 (86)
                      ..|+
T Consensus       103 ~~Cg  106 (128)
T PHA00733        103 PVCG  106 (128)
T ss_pred             CCCC
Confidence            9885


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.87  E-value=2.2e-09  Score=63.01  Aligned_cols=60  Identities=20%  Similarity=0.458  Sum_probs=51.0

Q ss_pred             CCceecccccccCCChHHHhhhhhC-CcceecccccccccCHHHHHHHHHhCCCCccCCCCcCC
Q psy4084          24 DRQFACHMCIKVFPSQDKLRMHMLS-DRQFACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        24 ~~~~~c~~c~~~~~~~~~l~~h~~~-~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~C~   86 (86)
                      ++.+.|+.|++.|. ...+..|+.. .+++.|+ ||..+ ....|..|+.+|...+++.|.+|+
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~Hkpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~  511 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFHEPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCG  511 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcCCCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCC
Confidence            34568999999986 5778899886 6889999 99755 668999999999999999999995


No 19 
>PHA00616 hypothetical protein
Probab=98.83  E-value=2.8e-09  Score=42.39  Aligned_cols=32  Identities=16%  Similarity=0.364  Sum_probs=29.0

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccc
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMC   32 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c   32 (86)
                      |+.||+.|..++.|..|++.|++++++.+..-
T Consensus         4 C~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~~   35 (44)
T PHA00616          4 CLRCGGIFRKKKEVIEHLLSVHKQNKLTLEYF   35 (44)
T ss_pred             cchhhHHHhhHHHHHHHHHHhcCCCccceeEE
Confidence            78999999999999999999999999887653


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.82  E-value=2e-09  Score=38.60  Aligned_cols=21  Identities=29%  Similarity=0.362  Sum_probs=19.4

Q ss_pred             HHHHHHHhCCCCccCCCCcCC
Q psy4084          66 KLRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        66 ~l~~h~~~~~~~~~~~c~~C~   86 (86)
                      +|..|+++|+++++|.|+.|+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~   21 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCG   21 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSS
T ss_pred             CHHHHhhhcCCCCCCCCCCCc
Confidence            588999999999999999996


No 21 
>PHA00732 hypothetical protein
Probab=98.81  E-value=4.6e-09  Score=47.22  Aligned_cols=42  Identities=21%  Similarity=0.393  Sum_probs=24.8

Q ss_pred             CcchhhhccChHHHHhhHHH-HhCCCceecccccccCCChHHHhhhhhC
Q psy4084           1 MSECMGKFTEYQVIRKHIRT-FHSDRQFACHMCIKVFPSQDKLRMHMLS   48 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~-~~~~~~~~c~~c~~~~~~~~~l~~h~~~   48 (86)
                      |..||+.|.+...|..|++. |.+   +.|+.|++.|.   .+..|+.+
T Consensus         4 C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          4 CPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhhcc
Confidence            56667777777777777663 432   35666666665   24455543


No 22 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.65  E-value=2.1e-08  Score=34.80  Aligned_cols=23  Identities=35%  Similarity=0.735  Sum_probs=19.8

Q ss_pred             eecccccccccCHHHHHHHHHhC
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLSG   74 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~~   74 (86)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            67899999999999999998763


No 23 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.54  E-value=9.9e-08  Score=44.49  Aligned_cols=70  Identities=23%  Similarity=0.334  Sum_probs=21.9

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC--CcceecccccccccCHHHHHHHHHhC
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS--DRQFACHMCIKVFPSQDKLRMHMLSG   74 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~--~~~~~C~~C~~~~~~~~~l~~h~~~~   74 (86)
                      |..|+..|.+...|..|+...++-..-..    ..+.....+......  ...+.|..|+..|.+...|..||+.+
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~~~~~~----~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGFDIPDQ----KYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ---------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccccccccccc----cccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            78899999999999999987665432111    111122222223222  34689999999999999999999974


No 24 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.52  E-value=1.1e-07  Score=34.20  Aligned_cols=26  Identities=38%  Similarity=0.560  Sum_probs=22.9

Q ss_pred             ceecccccccccCHHHHHHHHHhCCC
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLSGLQ   76 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~~~~   76 (86)
                      ||.|..|++.|.+...|..|++.|.+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57899999999999999999988754


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.50  E-value=2.4e-07  Score=38.80  Aligned_cols=47  Identities=28%  Similarity=0.441  Sum_probs=30.6

Q ss_pred             ceecccccccCCChHHHhhhhhC-----CcceecccccccccCHHHHHHHHHhCC
Q psy4084          26 QFACHMCIKVFPSQDKLRMHMLS-----DRQFACHMCIKVFPSQDKLRMHMLSGL   75 (86)
Q Consensus        26 ~~~c~~c~~~~~~~~~l~~h~~~-----~~~~~C~~C~~~~~~~~~l~~h~~~~~   75 (86)
                      .|.|+.|++ ......|..|...     .+.+.|+.|...+.  .+|..|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            367777777 4445667777654     34577888876533  47788887654


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.47  E-value=1.5e-07  Score=32.66  Aligned_cols=24  Identities=42%  Similarity=0.755  Sum_probs=19.0

Q ss_pred             eecccccccccCHHHHHHHHHhCC
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLSGL   75 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~~~   75 (86)
                      |.|+.|++.|.+...|..|+.+++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            679999999999999999998753


No 27 
>PHA00732 hypothetical protein
Probab=98.47  E-value=2.3e-07  Score=41.77  Aligned_cols=47  Identities=23%  Similarity=0.424  Sum_probs=39.7

Q ss_pred             ceecccccccCCChHHHhhhhhC-CcceecccccccccCHHHHHHHHHhCC
Q psy4084          26 QFACHMCIKVFPSQDKLRMHMLS-DRQFACHMCIKVFPSQDKLRMHMLSGL   75 (86)
Q Consensus        26 ~~~c~~c~~~~~~~~~l~~h~~~-~~~~~C~~C~~~~~~~~~l~~h~~~~~   75 (86)
                      ||.|..|++.|.....|..|+.. ..++.|+.|++.|.   .+..|++++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTLTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCCCccCCCCCEeC---ChhhhhcccC
Confidence            57899999999999999999974 56779999999998   4778886653


No 28 
>KOG3993|consensus
Probab=98.40  E-value=9.5e-08  Score=54.29  Aligned_cols=76  Identities=28%  Similarity=0.441  Sum_probs=54.8

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC--------------------------------
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS--------------------------------   48 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~--------------------------------   48 (86)
                      |..|...|.....|-.|.-.-.-..-|.|+.|+++|.-..+|..|.+=                                
T Consensus       270 CqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg  349 (500)
T KOG3993|consen  270 CQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSG  349 (500)
T ss_pred             HHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccC
Confidence            345666666666666664433333448888888888888888777630                                


Q ss_pred             ----CcceecccccccccCHHHHHHHHHhCCC
Q psy4084          49 ----DRQFACHMCIKVFPSQDKLRMHMLSGLQ   76 (86)
Q Consensus        49 ----~~~~~C~~C~~~~~~~~~l~~h~~~~~~   76 (86)
                          +-.|.|..|++.|.+...|+.|..+|+.
T Consensus       350 ~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  350 DDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             CcccCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence                1238899999999999999999888753


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.36  E-value=2.9e-07  Score=31.80  Aligned_cols=21  Identities=19%  Similarity=0.469  Sum_probs=18.2

Q ss_pred             CcchhhhccChHHHHhhHHHH
Q psy4084           1 MSECMGKFTEYQVIRKHIRTF   21 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~   21 (86)
                      |+.|++.|.....|..|++.|
T Consensus         3 C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    3 CPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             ETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCccCCHHHHHHHHhHC
Confidence            688999999999999998864


No 30 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=98.33  E-value=4.1e-07  Score=37.10  Aligned_cols=35  Identities=20%  Similarity=0.266  Sum_probs=24.2

Q ss_pred             hhhCCcceecccccccccCHHHHHHHHHhCCCCcc
Q psy4084          45 HMLSDRQFACHMCIKVFPSQDKLRMHMLSGLQTFD   79 (86)
Q Consensus        45 h~~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~   79 (86)
                      ++.++.|..|++|+..+....+|++|+...+..++
T Consensus        18 ~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   18 KSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            34447899999999999999999999988776654


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.13  E-value=2.6e-06  Score=29.39  Aligned_cols=22  Identities=32%  Similarity=0.570  Sum_probs=17.5

Q ss_pred             CcchhhhccChHHHHhhHHHHh
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFH   22 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~   22 (86)
                      |+.|+..|.+...|..|+.+++
T Consensus         3 C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    3 CPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             -SSTS-EESSHHHHHHHHHHHS
T ss_pred             CcCCCCcCCcHHHHHHHHHhhC
Confidence            7889999999999999988763


No 32 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.97  E-value=1e-05  Score=28.27  Aligned_cols=24  Identities=38%  Similarity=0.683  Sum_probs=20.2

Q ss_pred             eecccccccccCHHHHHHHHHhCC
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLSGL   75 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~~~   75 (86)
                      +.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            468889999999999999988654


No 33 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.92  E-value=2.2e-05  Score=32.88  Aligned_cols=35  Identities=23%  Similarity=0.380  Sum_probs=27.4

Q ss_pred             ceecccccccccCHHHHHHHHHhCC-C-CccCCCCcCC
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLSGL-Q-TFDLKSKLCT   86 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~~~-~-~~~~~c~~C~   86 (86)
                      .|.|++|++ ..+...|..|....+ . .+.+.|++|.
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~   38 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICS   38 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCch
Confidence            478999999 566788999988744 3 3568999984


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.85  E-value=2.3e-05  Score=32.06  Aligned_cols=26  Identities=15%  Similarity=0.326  Sum_probs=20.2

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCc
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQ   26 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~   26 (86)
                      |++|+..+.+..+|++|+...++.+|
T Consensus        27 CP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   27 CPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             -TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCcchhhccchhhHHHHHHHHhcccC
Confidence            88999999999999999998888765


No 35 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.81  E-value=5e-06  Score=46.14  Aligned_cols=48  Identities=29%  Similarity=0.758  Sum_probs=36.4

Q ss_pred             CCceeccc--ccccCCChHHHhhhhhC----------------------CcceecccccccccCHHHHHHHH
Q psy4084          24 DRQFACHM--CIKVFPSQDKLRMHMLS----------------------DRQFACHMCIKVFPSQDKLRMHM   71 (86)
Q Consensus        24 ~~~~~c~~--c~~~~~~~~~l~~h~~~----------------------~~~~~C~~C~~~~~~~~~l~~h~   71 (86)
                      ++||.|++  |.+.+.....|.-|+..                      .+||.|++|++.+.....|.-|+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            47888886  88888888888777642                      47888888888887777776554


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.78  E-value=8.6e-06  Score=29.11  Aligned_cols=22  Identities=27%  Similarity=0.555  Sum_probs=18.4

Q ss_pred             CcchhhhccChHHHHhhHHHHh
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFH   22 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~   22 (86)
                      |..|++.|.+...|..|++.|.
T Consensus         4 C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    4 CDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             ETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCccCCccCChhHHHHHhHHhc
Confidence            6788999999999999887764


No 37 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.77  E-value=2e-05  Score=27.60  Aligned_cols=23  Identities=43%  Similarity=0.856  Sum_probs=18.6

Q ss_pred             eecccccccccCHHHHHHHHHhC
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLSG   74 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~~   74 (86)
                      |.|..|+..|.+...+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56888888888888888888753


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.69  E-value=4.9e-05  Score=26.40  Aligned_cols=22  Identities=27%  Similarity=0.535  Sum_probs=18.8

Q ss_pred             CcchhhhccChHHHHhhHHHHh
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFH   22 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~   22 (86)
                      |+.|++.|.....|..|++.|.
T Consensus         3 C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        3 CPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCcchhCCHHHHHHHHHHhc
Confidence            7789999999999999988654


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.65  E-value=3.4e-05  Score=26.77  Aligned_cols=23  Identities=17%  Similarity=0.430  Sum_probs=17.6

Q ss_pred             eecccccccccCHHHHHHHHHhCC
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLSGL   75 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~~~   75 (86)
                      |+|+.|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            67999999887 889999998753


No 40 
>PRK04860 hypothetical protein; Provisional
Probab=97.44  E-value=0.00012  Score=37.36  Aligned_cols=32  Identities=19%  Similarity=0.346  Sum_probs=28.2

Q ss_pred             ceecccccccccCHHHHHHHHHhCCCCccCCCCcCC
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~C~   86 (86)
                      +|.|. |+.   ....+.+|.++|.++++|.|..|+
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~  150 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCG  150 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCC
Confidence            68998 987   677789999999999999999985


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.37  E-value=8.8e-05  Score=25.87  Aligned_cols=21  Identities=24%  Similarity=0.502  Sum_probs=16.7

Q ss_pred             CcchhhhccChHHHHhhHHHH
Q psy4084           1 MSECMGKFTEYQVIRKHIRTF   21 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~   21 (86)
                      |..|+..|.+...+..|++.+
T Consensus         3 C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    3 CDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             ETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCcCCHHHHHHHHCcC
Confidence            677888888888888887754


No 42 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=97.23  E-value=0.0004  Score=24.42  Aligned_cols=20  Identities=30%  Similarity=0.688  Sum_probs=14.6

Q ss_pred             eecccccccccCHHHHHHHHH
Q psy4084          52 FACHMCIKVFPSQDKLRMHML   72 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~   72 (86)
                      .+|+.||+.| ..+.|..|++
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4688888888 5666777765


No 43 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.22  E-value=8.3e-05  Score=26.56  Aligned_cols=22  Identities=45%  Similarity=0.862  Sum_probs=15.2

Q ss_pred             eecccccccccCHHHHHHHHHh
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      |.|..|++.|.+...+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4577777777777777666654


No 44 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.17  E-value=0.00024  Score=39.83  Aligned_cols=38  Identities=26%  Similarity=0.697  Sum_probs=31.9

Q ss_pred             Ccceeccc--ccccccCHHHHHHHHHhC-------------------CCCccCCCCcCC
Q psy4084          49 DRQFACHM--CIKVFPSQDKLRMHMLSG-------------------LQTFDLKSKLCT   86 (86)
Q Consensus        49 ~~~~~C~~--C~~~~~~~~~l~~h~~~~-------------------~~~~~~~c~~C~   86 (86)
                      ++||+|++  |.+.+..+..|.-|+.-.                   .+++||.|+.|+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~  405 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCD  405 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccc
Confidence            59999987  999999999999998632                   256899999985


No 45 
>PRK04860 hypothetical protein; Provisional
Probab=97.01  E-value=0.00035  Score=35.64  Aligned_cols=35  Identities=20%  Similarity=0.513  Sum_probs=23.3

Q ss_pred             ceecccccccCCChHHHhhhhhC---CcceecccccccccCH
Q psy4084          26 QFACHMCIKVFPSQDKLRMHMLS---DRQFACHMCIKVFPSQ   64 (86)
Q Consensus        26 ~~~c~~c~~~~~~~~~l~~h~~~---~~~~~C~~C~~~~~~~   64 (86)
                      +|.|. |+.   ...++.+|.+.   +++|.|..|+..+...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            57887 776   44455566543   5778888888876543


No 46 
>KOG3993|consensus
Probab=96.96  E-value=0.00022  Score=41.30  Aligned_cols=49  Identities=22%  Similarity=0.475  Sum_probs=41.9

Q ss_pred             ceecccccccCCChHHHhhhhhC---CcceecccccccccCHHHHHHHHHhC
Q psy4084          26 QFACHMCIKVFPSQDKLRMHMLS---DRQFACHMCIKVFPSQDKLRMHMLSG   74 (86)
Q Consensus        26 ~~~c~~c~~~~~~~~~l~~h~~~---~~~~~C~~C~~~~~~~~~l~~h~~~~   74 (86)
                      .|.|..|...|...=.|..|.-.   ...|.|++|++.|.-..+|..|.+=|
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWH  318 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWH  318 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhccc
Confidence            48899998888888888888654   45799999999999999999999865


No 47 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.52  E-value=0.0034  Score=23.52  Aligned_cols=23  Identities=22%  Similarity=0.579  Sum_probs=18.1

Q ss_pred             ceecccccccccCHHHHHHHHHh
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      +|.|..|+..|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46788888888888888888764


No 48 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=96.18  E-value=0.0041  Score=23.27  Aligned_cols=24  Identities=17%  Similarity=0.776  Sum_probs=14.2

Q ss_pred             eecccccccCCChHHHhhhhhCCcceecccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIK   59 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~   59 (86)
                      |+|..||..+...         ..++.|+.||.
T Consensus         2 ~~C~~CGy~y~~~---------~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGE---------EAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCC---------cCCCcCcCCCC
Confidence            5677777554332         24667777764


No 49 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=95.20  E-value=0.016  Score=26.81  Aligned_cols=21  Identities=19%  Similarity=0.461  Sum_probs=17.3

Q ss_pred             CcchhhhccChHHHHhhHHHH
Q psy4084           1 MSECMGKFTEYQVIRKHIRTF   21 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~   21 (86)
                      |..|++.|.+...|..|++.+
T Consensus        53 C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   53 CPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             BSSSS-EESSHHHHHHHHHHT
T ss_pred             CCccCCCCcCHHHHHHHHcCc
Confidence            778999999999999999864


No 50 
>KOG1146|consensus
Probab=94.97  E-value=0.014  Score=38.64  Aligned_cols=25  Identities=20%  Similarity=0.557  Sum_probs=21.7

Q ss_pred             CcceecccccccccCHHHHHHHHHh
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      .++|.|..|...+....+|.+|+..
T Consensus       516 ~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  516 GKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CCcccceeeeeeeecchHHHHHHHH
Confidence            3688999999999999999999875


No 51 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=94.82  E-value=0.03  Score=28.93  Aligned_cols=11  Identities=9%  Similarity=0.126  Sum_probs=5.5

Q ss_pred             CCccCCCCcCC
Q psy4084          76 QTFDLKSKLCT   86 (86)
Q Consensus        76 ~~~~~~c~~C~   86 (86)
                      ++.|..|++|+
T Consensus       146 ge~P~~CPiCg  156 (166)
T COG1592         146 GEAPEVCPICG  156 (166)
T ss_pred             CCCCCcCCCCC
Confidence            34555555553


No 52 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=94.38  E-value=0.058  Score=20.58  Aligned_cols=33  Identities=24%  Similarity=0.533  Sum_probs=21.4

Q ss_pred             eecccccccCCChHHHhhhhhCCcceecccccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVF   61 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~   61 (86)
                      ..|+.|...|........-  .....+|+.|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~ip~--~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKIPP--KGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHHCCC--CCcEEECCCCCCEe
Confidence            4688888777766654321  13457888888766


No 53 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=94.28  E-value=0.026  Score=27.09  Aligned_cols=30  Identities=23%  Similarity=0.537  Sum_probs=18.5

Q ss_pred             eecccccccCCChHHHhhhhhCCcceecccccccccCH
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPSQ   64 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~~   64 (86)
                      ..|+.||..|.-..        ..|..|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYDLn--------k~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDLN--------KDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccCC--------CCCccCCCCCCccCcc
Confidence            36777776665432        3466777777776544


No 54 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=93.97  E-value=0.078  Score=22.60  Aligned_cols=10  Identities=20%  Similarity=0.690  Sum_probs=5.0

Q ss_pred             Ccceeccccc
Q psy4084          49 DRQFACHMCI   58 (86)
Q Consensus        49 ~~~~~C~~C~   58 (86)
                      ..+|.|+.||
T Consensus        48 g~~Y~Cp~CG   57 (61)
T COG2888          48 GNPYRCPKCG   57 (61)
T ss_pred             CCceECCCcC
Confidence            3455555554


No 55 
>KOG2893|consensus
Probab=93.85  E-value=0.01  Score=32.37  Aligned_cols=41  Identities=32%  Similarity=0.661  Sum_probs=31.7

Q ss_pred             cccccccCCChHHHhhhhhCCcceecccccccccCHHHHHHH
Q psy4084          29 CHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPSQDKLRMH   70 (86)
Q Consensus        29 c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~~~~l~~h   70 (86)
                      |..|++.|..-..|..|++ .+.|+|-+|-+...+...|..|
T Consensus        13 cwycnrefddekiliqhqk-akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK-AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhh-hccceeeeehhhhccCCCceee
Confidence            6778888888888888877 4678888887776666666665


No 56 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=93.75  E-value=0.084  Score=20.23  Aligned_cols=34  Identities=26%  Similarity=0.511  Sum_probs=21.2

Q ss_pred             eecccccccCCChHHHhhhhhCCcceeccccccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFP   62 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~   62 (86)
                      ..|+.|+..|.....-..  .......|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~l~--~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDKLP--AGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHHcc--cCCcEEECCCCCcEee
Confidence            467888877776654221  1144678888887663


No 57 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=93.69  E-value=0.049  Score=20.82  Aligned_cols=34  Identities=21%  Similarity=0.353  Sum_probs=19.6

Q ss_pred             eecccccccCCChHHHhhhhhCCcceeccccccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFP   62 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~   62 (86)
                      +.|+.|+..|..........  ...+.|+.|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~~~~--~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLGAN--GGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHcCCC--CCEEECCCCCCEEE
Confidence            56777877766554432211  22467888877653


No 58 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.65  E-value=0.033  Score=23.39  Aligned_cols=23  Identities=22%  Similarity=0.371  Sum_probs=12.9

Q ss_pred             ceecccccccccCHHHHHHHHHh
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      -+.|+.|+..|.......+|...
T Consensus        17 ~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          17 FLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             eeeCCchhHHHHHhHHHHHHhhH
Confidence            34566666666655555555543


No 59 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=93.60  E-value=0.025  Score=30.42  Aligned_cols=40  Identities=15%  Similarity=0.317  Sum_probs=25.6

Q ss_pred             CceecccccccCCChHHHhhhhhC-------------C-----cceecccccccccCH
Q psy4084          25 RQFACHMCIKVFPSQDKLRMHMLS-------------D-----RQFACHMCIKVFPSQ   64 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~h~~~-------------~-----~~~~C~~C~~~~~~~   64 (86)
                      +...|+.|++.|..........+.             .     ..+.|+.||.++...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            456788888888766544433321             1     235799999987643


No 60 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=93.55  E-value=0.045  Score=19.35  Aligned_cols=10  Identities=30%  Similarity=0.510  Sum_probs=7.0

Q ss_pred             eccccccccc
Q psy4084          53 ACHMCIKVFP   62 (86)
Q Consensus        53 ~C~~C~~~~~   62 (86)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5777777764


No 61 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=93.23  E-value=0.1  Score=22.23  Aligned_cols=9  Identities=22%  Similarity=0.807  Sum_probs=4.2

Q ss_pred             cceeccccc
Q psy4084          50 RQFACHMCI   58 (86)
Q Consensus        50 ~~~~C~~C~   58 (86)
                      .+|.|+.||
T Consensus        47 ~~Y~CP~CG   55 (59)
T PRK14890         47 NPYTCPKCG   55 (59)
T ss_pred             CceECCCCC
Confidence            344444444


No 62 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=93.20  E-value=0.18  Score=25.54  Aligned_cols=38  Identities=16%  Similarity=0.414  Sum_probs=23.5

Q ss_pred             CCCceecccccccCCChHHHhhhhhCCcceecccccccc
Q psy4084          23 SDRQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVF   61 (86)
Q Consensus        23 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~   61 (86)
                      ....|.|+.|+..|.....+..- .....|.|+.||...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~~-d~~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQLL-DMDGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHhc-CCCCcEECCCCCCEE
Confidence            34568888888877765543321 112338888888765


No 63 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=92.88  E-value=0.14  Score=18.06  Aligned_cols=20  Identities=15%  Similarity=0.567  Sum_probs=14.4

Q ss_pred             eecccccccccCHHHHHHHHH
Q psy4084          52 FACHMCIKVFPSQDKLRMHML   72 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~   72 (86)
                      ..|+.|++.+ ....++.|+.
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3588888887 5567777765


No 64 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=92.48  E-value=0.11  Score=26.65  Aligned_cols=16  Identities=19%  Similarity=0.393  Sum_probs=8.2

Q ss_pred             eecccccccccCHHHH
Q psy4084          52 FACHMCIKVFPSQDKL   67 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l   67 (86)
                      |.|+.|+..|.....+
T Consensus       110 Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       110 FICPNMCVRFTFNEAM  125 (158)
T ss_pred             EECCCCCcEeeHHHHH
Confidence            4555555555544444


No 65 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.45  E-value=0.12  Score=19.42  Aligned_cols=25  Identities=16%  Similarity=0.545  Sum_probs=15.0

Q ss_pred             ceecccccccCCChHHHhhhhhCCcceecccccc
Q psy4084          26 QFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIK   59 (86)
Q Consensus        26 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~   59 (86)
                      .|.|..||..+...         +.|..|+.||.
T Consensus         2 ~~~C~~CG~i~~g~---------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE---------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC---------cCCCcCcCCCC
Confidence            36777777554321         24567887775


No 66 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=92.43  E-value=0.19  Score=20.50  Aligned_cols=23  Identities=26%  Similarity=0.489  Sum_probs=16.8

Q ss_pred             eecccccccccCH-----HHHHHHHH-hC
Q psy4084          52 FACHMCIKVFPSQ-----DKLRMHML-SG   74 (86)
Q Consensus        52 ~~C~~C~~~~~~~-----~~l~~h~~-~~   74 (86)
                      ..|..|++.+...     ++|.+|+. .|
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            5688888877554     68888888 44


No 67 
>PHA00626 hypothetical protein
Probab=92.32  E-value=0.064  Score=22.57  Aligned_cols=14  Identities=14%  Similarity=0.280  Sum_probs=8.8

Q ss_pred             cceecccccccccC
Q psy4084          50 RQFACHMCIKVFPS   63 (86)
Q Consensus        50 ~~~~C~~C~~~~~~   63 (86)
                      ..|.|+.||+.|..
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            45677777766543


No 68 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.08  E-value=0.2  Score=23.97  Aligned_cols=27  Identities=19%  Similarity=0.332  Sum_probs=23.8

Q ss_pred             cceec----ccccccccCHHHHHHHHHhCCC
Q psy4084          50 RQFAC----HMCIKVFPSQDKLRMHMLSGLQ   76 (86)
Q Consensus        50 ~~~~C----~~C~~~~~~~~~l~~h~~~~~~   76 (86)
                      .-|.|    ..|++...+...+..|++.+++
T Consensus        79 ~G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   79 DGYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            45899    9999999999999999998764


No 69 
>KOG4167|consensus
Probab=92.06  E-value=0.028  Score=35.29  Aligned_cols=25  Identities=32%  Similarity=0.462  Sum_probs=23.0

Q ss_pred             ceecccccccccCHHHHHHHHHhCC
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLSGL   75 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~~~   75 (86)
                      -|.|..|++.|.-...++.||++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4899999999999999999999985


No 70 
>KOG2785|consensus
Probab=92.03  E-value=0.39  Score=28.20  Aligned_cols=69  Identities=20%  Similarity=0.205  Sum_probs=39.2

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC--Ccceeccccc---ccccCHHHHHHHHHh
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS--DRQFACHMCI---KVFPSQDKLRMHMLS   73 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~--~~~~~C~~C~---~~~~~~~~l~~h~~~   73 (86)
                      |-.|++.+.+-.....||..++|--.  ...  ........|...+.-  ..-+.|..|+   +.|.+....+.||..
T Consensus       169 CLfC~~~~k~~e~~~~HM~~~HgffI--Pdr--eYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  169 CLFCDKKSKSLEENLKHMFKEHGFFI--PDR--EYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             eeecCCCcccHHHHHHHHhhccCCcC--Cch--HhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            44566666666666666666555211  000  112222233333221  4567888887   889999999999874


No 71 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=91.87  E-value=0.14  Score=26.87  Aligned_cols=17  Identities=24%  Similarity=0.507  Sum_probs=9.2

Q ss_pred             ceecccccccccCHHHH
Q psy4084          51 QFACHMCIKVFPSQDKL   67 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l   67 (86)
                      -|.|+.|+..|.....+
T Consensus       117 ~Y~Cp~C~~rytf~eA~  133 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAM  133 (178)
T ss_pred             EEECCCCCcEEeHHHHh
Confidence            35566666555555443


No 72 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=91.66  E-value=0.33  Score=19.13  Aligned_cols=24  Identities=25%  Similarity=0.537  Sum_probs=14.3

Q ss_pred             cceecccccccccC----HHHHHHHHHh
Q psy4084          50 RQFACHMCIKVFPS----QDKLRMHMLS   73 (86)
Q Consensus        50 ~~~~C~~C~~~~~~----~~~l~~h~~~   73 (86)
                      ....|..|++.+..    .++|..|++.
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            44678888777665    3778888743


No 73 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=91.43  E-value=0.13  Score=20.60  Aligned_cols=29  Identities=14%  Similarity=0.400  Sum_probs=17.7

Q ss_pred             ceecccccccCCChHHHhhhhhCCcceecccccccc
Q psy4084          26 QFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVF   61 (86)
Q Consensus        26 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~   61 (86)
                      .|.|+.||..+.....       ...+.|+.||..+
T Consensus         3 ~y~C~~CG~~~~~~~~-------~~~~~Cp~CG~~~   31 (46)
T PRK00398          3 EYKCARCGREVELDEY-------GTGVRCPYCGYRI   31 (46)
T ss_pred             EEECCCCCCEEEECCC-------CCceECCCCCCeE
Confidence            4778888766544321       1256788887654


No 74 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=90.40  E-value=0.072  Score=20.58  Aligned_cols=29  Identities=24%  Similarity=0.500  Sum_probs=16.4

Q ss_pred             eecccccccCCChHHHhhhhhCCcceecccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIK   59 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~   59 (86)
                      |.|..|+..|........    .....|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~~----~~~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKISD----DPLATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEecCC----CCCCCCCCCCC
Confidence            677777776654332211    23446777775


No 75 
>KOG2893|consensus
Probab=90.39  E-value=0.17  Score=27.89  Aligned_cols=33  Identities=24%  Similarity=0.599  Sum_probs=25.9

Q ss_pred             CcceecccccccccCHHHHHHHHHhCCCCccCCCCcCC
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~C~   86 (86)
                      .++| |=+|++.|.....|.+|.+.    +.|+|.+|.
T Consensus         9 ~kpw-cwycnrefddekiliqhqka----khfkchich   41 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQKA----KHFKCHICH   41 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhhh----ccceeeeeh
Confidence            4565 67899999999999888764    448998883


No 76 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.24  E-value=0.19  Score=24.90  Aligned_cols=30  Identities=17%  Similarity=0.166  Sum_probs=19.0

Q ss_pred             eecccccccCCChHHHhhhhhCCcceecccccccccCH
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPSQ   64 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~~   64 (86)
                      ..|+.|+..|.-..        ..|..|+.||..|.-.
T Consensus        10 r~Cp~cg~kFYDLn--------k~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDLN--------RRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccccC--------CCCccCCCcCCccCcc
Confidence            36777777665432        3567777787776544


No 77 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=90.11  E-value=0.12  Score=23.06  Aligned_cols=14  Identities=29%  Similarity=0.705  Sum_probs=7.1

Q ss_pred             Ccceecc--ccccccc
Q psy4084          49 DRQFACH--MCIKVFP   62 (86)
Q Consensus        49 ~~~~~C~--~C~~~~~   62 (86)
                      ++.++|.  .||..|.
T Consensus        25 ~~Y~qC~N~eCg~tF~   40 (72)
T PRK09678         25 ERYHQCQNVNCSATFI   40 (72)
T ss_pred             eeeeecCCCCCCCEEE
Confidence            3445555  5555554


No 78 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=90.04  E-value=0.093  Score=30.31  Aligned_cols=55  Identities=24%  Similarity=0.491  Sum_probs=30.0

Q ss_pred             ceecccccccCCChHHHhhhhh--C---C--cceecc--cccccccCHHHHHHHHHhCCCCccC
Q psy4084          26 QFACHMCIKVFPSQDKLRMHML--S---D--RQFACH--MCIKVFPSQDKLRMHMLSGLQTFDL   80 (86)
Q Consensus        26 ~~~c~~c~~~~~~~~~l~~h~~--~---~--~~~~C~--~C~~~~~~~~~l~~h~~~~~~~~~~   80 (86)
                      ++.+..|...+.....+..|..  .   +  +++.|+  .|++.|.+...+..|...|....+.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPA  352 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcc
Confidence            3445555555555555555544  2   3  556666  4666666666666666655554443


No 79 
>KOG2231|consensus
Probab=89.85  E-value=0.81  Score=29.02  Aligned_cols=64  Identities=22%  Similarity=0.526  Sum_probs=33.9

Q ss_pred             cChHHHHhhHHHHhCCCceeccccc---------ccCCChHHHhhhhhC-------Cc-ceecccccccccCHHHHHHHH
Q psy4084           9 TEYQVIRKHIRTFHSDRQFACHMCI---------KVFPSQDKLRMHMLS-------DR-QFACHMCIKVFPSQDKLRMHM   71 (86)
Q Consensus         9 ~~~~~l~~h~~~~~~~~~~~c~~c~---------~~~~~~~~l~~h~~~-------~~-~~~C~~C~~~~~~~~~l~~h~   71 (86)
                      .....|+.|++..++.  +-|..|.         ........|..|+..       .+ ...|..|...|.....|..|+
T Consensus       125 ~s~~~Lk~H~~~~H~~--~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~  202 (669)
T KOG2231|consen  125 KSVENLKNHMRDQHKL--HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHL  202 (669)
T ss_pred             hHHHHHHHHHHHhhhh--hccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhh
Confidence            3667788888643331  1222211         122344555556543       11 135677777777777777777


Q ss_pred             HhC
Q psy4084          72 LSG   74 (86)
Q Consensus        72 ~~~   74 (86)
                      +.+
T Consensus       203 ~~~  205 (669)
T KOG2231|consen  203 RFD  205 (669)
T ss_pred             ccc
Confidence            654


No 80 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=89.79  E-value=0.72  Score=18.46  Aligned_cols=39  Identities=21%  Similarity=0.549  Sum_probs=19.8

Q ss_pred             HhhHHHHhCCCceecccccccCCChHHHhhhhhCCcceecccccc
Q psy4084          15 RKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIK   59 (86)
Q Consensus        15 ~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~   59 (86)
                      ..++....-...+.|+.|+..  ....+.    ....|.|..|++
T Consensus         7 ~~~l~~~RW~~g~~CP~Cg~~--~~~~~~----~~~~~~C~~C~~   45 (46)
T PF12760_consen    7 REYLEEIRWPDGFVCPHCGST--KHYRLK----TRGRYRCKACRK   45 (46)
T ss_pred             HHHHHHhcCCCCCCCCCCCCe--eeEEeC----CCCeEECCCCCC
Confidence            344443333334678888754  111111    135677877765


No 81 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=89.68  E-value=0.075  Score=20.97  Aligned_cols=29  Identities=21%  Similarity=0.526  Sum_probs=17.4

Q ss_pred             eecccccccCCChHHHhhhhhCCcceecccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIK   59 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~   59 (86)
                      |.|..||..|.....+..    ..+..|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~~----~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSISE----DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEcCC----CCCCcCCCCCC
Confidence            677778776655443222    24456777776


No 82 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=89.52  E-value=0.3  Score=19.56  Aligned_cols=26  Identities=19%  Similarity=0.382  Sum_probs=17.0

Q ss_pred             eecccccccCCChHHHhhhhhCCcceeccccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKV   60 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~   60 (86)
                      |.|..||..+...        ..-+..|+.||..
T Consensus         3 Y~C~~Cg~~~~~~--------~~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK--------SKDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC--------CCCceECCCCCce
Confidence            6778887766543        1345788888754


No 83 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=89.50  E-value=0.33  Score=24.28  Aligned_cols=28  Identities=18%  Similarity=0.246  Sum_probs=17.0

Q ss_pred             CcceecccccccccCHHHHHHHHHhCCCCcc
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLSGLQTFD   79 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~   79 (86)
                      .....|-+||+.|...   .+|+..|++-.+
T Consensus        70 ~d~i~clecGk~~k~L---krHL~~~~gltp   97 (132)
T PF05443_consen   70 PDYIICLECGKKFKTL---KRHLRTHHGLTP   97 (132)
T ss_dssp             SS-EE-TBT--EESBH---HHHHHHTT-S-H
T ss_pred             cCeeEEccCCcccchH---HHHHHHccCCCH
Confidence            3457899999998765   889999876443


No 84 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=89.39  E-value=0.1  Score=21.41  Aligned_cols=29  Identities=24%  Similarity=0.495  Sum_probs=16.4

Q ss_pred             eecccccccCCChHHHhhhhhCCcceecccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIK   59 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~   59 (86)
                      |.|..|+..|.....+..    ..+..|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~~----~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMSD----DPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEecCC----CCCCCCCCCCC
Confidence            667777776654432211    23446777775


No 85 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=89.36  E-value=0.61  Score=22.68  Aligned_cols=46  Identities=20%  Similarity=0.438  Sum_probs=26.4

Q ss_pred             cccccccCCChHHHhhh-hhCCcceecccccccccCHHHHHHHHHhC
Q psy4084          29 CHMCIKVFPSQDKLRMH-MLSDRQFACHMCIKVFPSQDKLRMHMLSG   74 (86)
Q Consensus        29 c~~c~~~~~~~~~l~~h-~~~~~~~~C~~C~~~~~~~~~l~~h~~~~   74 (86)
                      |-.|...|........- +.....|.|+.|...|-..-.+-.|...|
T Consensus        58 C~~C~~~f~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        58 CFGCQGPFPKPPVSPFDELKDSHRYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             ccCcCCCCCCcccccccccccccceeCCCCCCccccccchhhhhhcc
Confidence            66666666543211100 11134578888888887776666676665


No 86 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=88.40  E-value=0.088  Score=30.40  Aligned_cols=48  Identities=27%  Similarity=0.668  Sum_probs=40.4

Q ss_pred             CcchhhhccChHHHHhhHH--HHhCC--Cceecc--cccccCCChHHHhhhhhC
Q psy4084           1 MSECMGKFTEYQVIRKHIR--TFHSD--RQFACH--MCIKVFPSQDKLRMHMLS   48 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~--~~~~~--~~~~c~--~c~~~~~~~~~l~~h~~~   48 (86)
                      |..|...|.....+..|.+  .|.++  +++.|+  .|++.|.....+..|...
T Consensus       292 ~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~  345 (467)
T COG5048         292 SKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILL  345 (467)
T ss_pred             CccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccc
Confidence            3567788888999999999  79999  899999  799999988888777653


No 87 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=87.71  E-value=0.45  Score=19.58  Aligned_cols=29  Identities=17%  Similarity=0.465  Sum_probs=17.2

Q ss_pred             CceecccccccCCChHHHhhhhhCCcceeccccccc
Q psy4084          25 RQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKV   60 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~   60 (86)
                      ..|.|..|++.+....       ......|+.||..
T Consensus         5 ~~Y~C~~Cg~~~~~~~-------~~~~irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVELDQ-------ETRGIRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeehhh-------ccCceeCCCCCcE
Confidence            3477888887762211       1345678888754


No 88 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=86.89  E-value=0.22  Score=25.53  Aligned_cols=12  Identities=33%  Similarity=0.625  Sum_probs=5.5

Q ss_pred             eecccccccCCC
Q psy4084          27 FACHMCIKVFPS   38 (86)
Q Consensus        27 ~~c~~c~~~~~~   38 (86)
                      ++|+.||..|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            444444444443


No 89 
>KOG2186|consensus
Probab=86.83  E-value=0.52  Score=26.22  Aligned_cols=13  Identities=38%  Similarity=0.748  Sum_probs=6.5

Q ss_pred             ceecccccccCCC
Q psy4084          26 QFACHMCIKVFPS   38 (86)
Q Consensus        26 ~~~c~~c~~~~~~   38 (86)
                      -|.|..|+..|..
T Consensus        29 ~fSCIDC~k~F~~   41 (276)
T KOG2186|consen   29 YFSCIDCGKTFER   41 (276)
T ss_pred             eeEEeeccccccc
Confidence            3455555555544


No 90 
>KOG2785|consensus
Probab=86.44  E-value=1.3  Score=26.13  Aligned_cols=73  Identities=16%  Similarity=0.200  Sum_probs=43.0

Q ss_pred             CcchhhhccChHHHHhhHHHHhCC-----Cce-ecccccccCCChHHHhhhhh------CCcceecccccccccCHHHHH
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSD-----RQF-ACHMCIKVFPSQDKLRMHML------SDRQFACHMCIKVFPSQDKLR   68 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~-----~~~-~c~~c~~~~~~~~~l~~h~~------~~~~~~C~~C~~~~~~~~~l~   68 (86)
                      |..|...|.....-+.|+.+-+-.     +.. ..++....|........-..      ..-++.|..|.+.|.....-.
T Consensus         6 C~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~a~~   85 (390)
T KOG2785|consen    6 CNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPKAHE   85 (390)
T ss_pred             eeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChhhHH
Confidence            677888888887777787764321     111 11233333332211111111      145688999999999998888


Q ss_pred             HHHHh
Q psy4084          69 MHMLS   73 (86)
Q Consensus        69 ~h~~~   73 (86)
                      .|+..
T Consensus        86 ~hl~S   90 (390)
T KOG2785|consen   86 NHLKS   90 (390)
T ss_pred             HHHHH
Confidence            88864


No 91 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=86.02  E-value=0.48  Score=16.43  Aligned_cols=9  Identities=33%  Similarity=0.752  Sum_probs=5.5

Q ss_pred             cceeccccc
Q psy4084          50 RQFACHMCI   58 (86)
Q Consensus        50 ~~~~C~~C~   58 (86)
                      .+|.|+.||
T Consensus        15 v~f~CPnCG   23 (24)
T PF07754_consen   15 VPFPCPNCG   23 (24)
T ss_pred             ceEeCCCCC
Confidence            456666665


No 92 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=85.81  E-value=0.72  Score=25.08  Aligned_cols=27  Identities=22%  Similarity=0.637  Sum_probs=20.6

Q ss_pred             CcceecccccccccCHHHHHHHHHhCC
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLSGL   75 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~~~   75 (86)
                      +..|.|+.|++.|....-+..|+.+.|
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcC
Confidence            346899999999999999999998644


No 93 
>KOG2231|consensus
Probab=85.72  E-value=1.9  Score=27.52  Aligned_cols=46  Identities=30%  Similarity=0.635  Sum_probs=22.8

Q ss_pred             ecccccccCCChHHHhhhhhCCcceecccc------cccccCHHHHHHHHHhC
Q psy4084          28 ACHMCIKVFPSQDKLRMHMLSDRQFACHMC------IKVFPSQDKLRMHMLSG   74 (86)
Q Consensus        28 ~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C------~~~~~~~~~l~~h~~~~   74 (86)
                      .|..|...|-....+.+|+..+ -+.|..|      +.-|.....|..|.+.+
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~-h~~chfC~~~~~~neyy~~~~dLe~HfR~~  235 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFD-HEFCHFCDYKTGQNEYYNDYDDLEEHFRKG  235 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccc-eeheeecCcccccchhcccchHHHHHhhhc
Confidence            4555666666666666665531 2233333      22344555555555543


No 94 
>KOG4173|consensus
Probab=84.45  E-value=0.5  Score=25.53  Aligned_cols=67  Identities=27%  Similarity=0.641  Sum_probs=47.7

Q ss_pred             hhhhccChHHHHhhHHHHhCCCceecccccccCCChHHHhhhhhC----------Cc---ceecc--cccccccCHHHHH
Q psy4084           4 CMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLS----------DR---QFACH--MCIKVFPSQDKLR   68 (86)
Q Consensus         4 C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~----------~~---~~~C~--~C~~~~~~~~~l~   68 (86)
                      |-+.|.....+..|..+.++   -.|..|.+.|.+.--|..|+..          ++   -|+|.  .|+..|.+.....
T Consensus        87 c~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~Rk  163 (253)
T KOG4173|consen   87 CCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRK  163 (253)
T ss_pred             hHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhh
Confidence            45666666667777655444   3788999999988888888752          22   26674  4888898888888


Q ss_pred             HHHHh
Q psy4084          69 MHMLS   73 (86)
Q Consensus        69 ~h~~~   73 (86)
                      .|+-.
T Consensus       164 dH~I~  168 (253)
T KOG4173|consen  164 DHMIR  168 (253)
T ss_pred             hHHHH
Confidence            88754


No 95 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=84.17  E-value=0.68  Score=17.21  Aligned_cols=9  Identities=22%  Similarity=0.601  Sum_probs=4.8

Q ss_pred             ceecccccc
Q psy4084          51 QFACHMCIK   59 (86)
Q Consensus        51 ~~~C~~C~~   59 (86)
                      +..|+.||.
T Consensus        17 ~irC~~CG~   25 (32)
T PF03604_consen   17 PIRCPECGH   25 (32)
T ss_dssp             TSSBSSSS-
T ss_pred             cEECCcCCC
Confidence            456666664


No 96 
>KOG1146|consensus
Probab=84.09  E-value=0.54  Score=31.98  Aligned_cols=49  Identities=22%  Similarity=0.519  Sum_probs=34.6

Q ss_pred             CCceecccccccCCChHHHhhhhhC--------------------CcceecccccccccCHHHHHHHHHh
Q psy4084          24 DRQFACHMCIKVFPSQDKLRMHMLS--------------------DRQFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        24 ~~~~~c~~c~~~~~~~~~l~~h~~~--------------------~~~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      +.+|.|..|...|.....+..|...                    -.++ |..|...|.....|..||+.
T Consensus      1282 ~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c~~~~~~~~alqihm~~ 1350 (1406)
T KOG1146|consen 1282 THRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLACEVLLSGREALQIHMRS 1350 (1406)
T ss_pred             chhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHHHhhcchhHHHHHHHHH
Confidence            3456666666666666666555421                    2345 99999999999999999986


No 97 
>KOG2593|consensus
Probab=83.50  E-value=0.72  Score=27.61  Aligned_cols=34  Identities=24%  Similarity=0.476  Sum_probs=22.5

Q ss_pred             cceecccccccccCHHHHHHHHHhCCCCccCCCCcCC
Q psy4084          50 RQFACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~C~   86 (86)
                      ..|.|+.|.+.|.....++   ......-.|.|..|+
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCG  160 (436)
T ss_pred             ccccCCccccchhhhHHHH---hhcccCceEEEecCC
Confidence            5688888888887776654   223334457777775


No 98 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=83.03  E-value=0.85  Score=21.13  Aligned_cols=33  Identities=15%  Similarity=0.470  Sum_probs=20.8

Q ss_pred             CceecccccccCCChHHHhhhhhCCcceecccccccccCH
Q psy4084          25 RQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPSQ   64 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~~   64 (86)
                      ..+.|+.|++.--..      . ..--|.|..||..|+-.
T Consensus        34 ~~~~Cp~C~~~~VkR------~-a~GIW~C~kCg~~fAGg   66 (89)
T COG1997          34 AKHVCPFCGRTTVKR------I-ATGIWKCRKCGAKFAGG   66 (89)
T ss_pred             cCCcCCCCCCcceee------e-ccCeEEcCCCCCeeccc
Confidence            468899998651110      0 13468899999888643


No 99 
>KOG2593|consensus
Probab=82.53  E-value=2.3  Score=25.66  Aligned_cols=40  Identities=20%  Similarity=0.380  Sum_probs=26.9

Q ss_pred             HhCCCceecccccccCCChHHHhhhhhCCcceeccccccc
Q psy4084          21 FHSDRQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKV   60 (86)
Q Consensus        21 ~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~   60 (86)
                      .+...-|.|+.|.+.|.....+..=....-.|.|..|+-.
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTSLEALQLLDNETGEFHCENCGGE  162 (436)
T ss_pred             ccccccccCCccccchhhhHHHHhhcccCceEEEecCCCc
Confidence            3345679999999999887765432111346889888654


No 100
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=81.97  E-value=1.7  Score=17.50  Aligned_cols=22  Identities=23%  Similarity=0.406  Sum_probs=17.6

Q ss_pred             eecccccccccCHHHHHHHHHh
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      |+|-+|..+....+.|-.||+-
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            5788888888888888888864


No 101
>PRK04023 DNA polymerase II large subunit; Validated
Probab=81.85  E-value=2.1  Score=28.80  Aligned_cols=7  Identities=43%  Similarity=0.895  Sum_probs=3.2

Q ss_pred             ecccccc
Q psy4084          28 ACHMCIK   34 (86)
Q Consensus        28 ~c~~c~~   34 (86)
                      .|+.||.
T Consensus       628 fCpsCG~  634 (1121)
T PRK04023        628 KCPSCGK  634 (1121)
T ss_pred             cCCCCCC
Confidence            4444443


No 102
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=81.62  E-value=0.44  Score=19.22  Aligned_cols=34  Identities=18%  Similarity=0.351  Sum_probs=16.2

Q ss_pred             cccccccCCChHHHhhhhhC-Ccceeccc--cccccc
Q psy4084          29 CHMCIKVFPSQDKLRMHMLS-DRQFACHM--CIKVFP   62 (86)
Q Consensus        29 c~~c~~~~~~~~~l~~h~~~-~~~~~C~~--C~~~~~   62 (86)
                      |+.||.......+...+... +..++|..  ||..|.
T Consensus         2 CP~Cg~~a~ir~S~~~s~~~~~~Y~qC~N~~Cg~tfv   38 (47)
T PF04606_consen    2 CPHCGSKARIRTSRQLSPLTRELYCQCTNPECGHTFV   38 (47)
T ss_pred             cCCCCCeeEEEEchhhCcceEEEEEEECCCcCCCEEE
Confidence            56666544333332222222 44566654  776664


No 103
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=81.06  E-value=1.3  Score=28.51  Aligned_cols=30  Identities=27%  Similarity=0.588  Sum_probs=12.6

Q ss_pred             ecccccccCCC---hHHHhhhhhCCcceeccccc
Q psy4084          28 ACHMCIKVFPS---QDKLRMHMLSDRQFACHMCI   58 (86)
Q Consensus        28 ~c~~c~~~~~~---~~~l~~h~~~~~~~~C~~C~   58 (86)
                      .|..||..+.-   ...|.-|+.. ....|.+||
T Consensus       437 ~C~~Cg~v~~Cp~Cd~~lt~H~~~-~~L~CH~Cg  469 (730)
T COG1198         437 LCRDCGYIAECPNCDSPLTLHKAT-GQLRCHYCG  469 (730)
T ss_pred             ecccCCCcccCCCCCcceEEecCC-CeeEeCCCC
Confidence            35555544322   1334444432 334455554


No 104
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=80.88  E-value=4.8  Score=23.82  Aligned_cols=71  Identities=27%  Similarity=0.496  Sum_probs=38.5

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceeccc----ccccCCChHHHhhhhhCCcceeccc--c----cccccCHHHHHHH
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHM----CIKVFPSQDKLRMHMLSDRQFACHM--C----IKVFPSQDKLRMH   70 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~----c~~~~~~~~~l~~h~~~~~~~~C~~--C----~~~~~~~~~l~~h   70 (86)
                      |..|...|.....|..|+|..+.. -+.|..    ..+.|..-..|..|... ..|.|..  |    -..|.....|..|
T Consensus       223 C~FC~~~FYdDDEL~~HcR~~HE~-ChICD~v~p~~~QYFK~Y~~Le~HF~~-~hy~ct~qtc~~~k~~vf~~~~el~~h  300 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCRLRHEA-CHICDMVGPIRYQYFKSYEDLEAHFRN-AHYCCTFQTCRVGKCYVFPYHTELLEH  300 (493)
T ss_pred             hhhccceecChHHHHHHHHhhhhh-hhhhhccCccchhhhhCHHHHHHHhhc-CceEEEEEEEecCcEEEeccHHHHHHH
Confidence            556777777777788887764432 122222    12345555666666553 2233321  2    1346777777777


Q ss_pred             HHh
Q psy4084          71 MLS   73 (86)
Q Consensus        71 ~~~   73 (86)
                      +..
T Consensus       301 ~~~  303 (493)
T COG5236         301 LTR  303 (493)
T ss_pred             HHH
Confidence            654


No 105
>KOG2482|consensus
Probab=80.29  E-value=1.4  Score=25.86  Aligned_cols=23  Identities=30%  Similarity=0.735  Sum_probs=21.3

Q ss_pred             ceecccccccccCHHHHHHHHHh
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      .+.|..|.+.|.....|..||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            47899999999999999999986


No 106
>KOG3408|consensus
Probab=80.18  E-value=1.3  Score=21.90  Aligned_cols=23  Identities=30%  Similarity=0.652  Sum_probs=12.0

Q ss_pred             ceecccccccCCChHHHhhhhhC
Q psy4084          26 QFACHMCIKVFPSQDKLRMHMLS   48 (86)
Q Consensus        26 ~~~c~~c~~~~~~~~~l~~h~~~   48 (86)
                      .|.|..|.+.|.....+..|.++
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            35555555555555555555443


No 107
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=80.06  E-value=3.1  Score=19.92  Aligned_cols=29  Identities=21%  Similarity=0.346  Sum_probs=12.2

Q ss_pred             hhhccChHHHHhhHHHHhCCCceecccccc
Q psy4084           5 MGKFTEYQVIRKHIRTFHSDRQFACHMCIK   34 (86)
Q Consensus         5 ~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   34 (86)
                      |..|.+...+...+.. -..+.|.|...|+
T Consensus        10 ~EiF~dYe~Y~~R~~~-y~~~vwtC~~TGk   38 (102)
T PF10537_consen   10 GEIFRDYEEYLKRMIL-YNQRVWTCEITGK   38 (102)
T ss_pred             CcccCCHHHHHHHHHH-HhCCeeEEecCCC
Confidence            3444444443333222 2234455555554


No 108
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=78.85  E-value=3.2  Score=16.26  Aligned_cols=22  Identities=9%  Similarity=0.111  Sum_probs=13.5

Q ss_pred             Ccchhhhcc--ChHHHHhhHHHHh
Q psy4084           1 MSECMGKFT--EYQVIRKHIRTFH   22 (86)
Q Consensus         1 c~~C~~~~~--~~~~l~~h~~~~~   22 (86)
                      |+.||-.|.  ...+-..|.+.|.
T Consensus        16 C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   16 CPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             CCCCCCEECCCCHHHHHHHHHHHh
Confidence            667776664  4455666766553


No 109
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=78.80  E-value=2.6  Score=17.49  Aligned_cols=17  Identities=12%  Similarity=0.303  Sum_probs=11.7

Q ss_pred             cceecccccccccCHHH
Q psy4084          50 RQFACHMCIKVFPSQDK   66 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~~~   66 (86)
                      .-+.|+.||..+.....
T Consensus        27 v~W~C~~Cgh~w~~~v~   43 (55)
T PF14311_consen   27 VWWKCPKCGHEWKASVN   43 (55)
T ss_pred             EEEECCCCCCeeEccHh
Confidence            34788888877765544


No 110
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=78.33  E-value=1.1  Score=20.92  Aligned_cols=13  Identities=23%  Similarity=0.411  Sum_probs=6.7

Q ss_pred             ceecccccccCCC
Q psy4084          26 QFACHMCIKVFPS   38 (86)
Q Consensus        26 ~~~c~~c~~~~~~   38 (86)
                      |-.|..||..|..
T Consensus        58 Pa~CkkCGfef~~   70 (97)
T COG3357          58 PARCKKCGFEFRD   70 (97)
T ss_pred             ChhhcccCccccc
Confidence            4455555555443


No 111
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=78.15  E-value=1.5  Score=18.30  Aligned_cols=40  Identities=23%  Similarity=0.499  Sum_probs=19.3

Q ss_pred             CCceeccc-ccccCCChHHHhhhhhC---Ccceeccc----ccccccC
Q psy4084          24 DRQFACHM-CIKVFPSQDKLRMHMLS---DRQFACHM----CIKVFPS   63 (86)
Q Consensus        24 ~~~~~c~~-c~~~~~~~~~l~~h~~~---~~~~~C~~----C~~~~~~   63 (86)
                      ..+..|+. |+........|..|...   .++..|+.    |+..+..
T Consensus         7 ~~~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    7 FRPVPCPNGCCNEMIPRKELDDHLENECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             TSEEE-TT--S-BEEECCCHHHHHHTTSTTSEEE-SS----S--EEEH
T ss_pred             CCEeeCCCCCcccceeHHHHHHHHHccCCCCcEECCCCCCCCCCccch
Confidence            34556766 33332334566777773   55677777    7766543


No 112
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=78.13  E-value=1.1  Score=21.67  Aligned_cols=28  Identities=14%  Similarity=0.040  Sum_probs=16.2

Q ss_pred             ecccccccCCChHHHhhhhhCCcceecccccccccC
Q psy4084          28 ACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPS   63 (86)
Q Consensus        28 ~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~   63 (86)
                      .|+.|++.|....        ..|..|++||++|+.
T Consensus        11 idPetg~KFYDLN--------rdPiVsPytG~s~P~   38 (129)
T COG4530          11 IDPETGKKFYDLN--------RDPIVSPYTGKSYPR   38 (129)
T ss_pred             cCccccchhhccC--------CCccccCcccccchH
Confidence            4555655553322        356777778877743


No 113
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=77.61  E-value=1.3  Score=16.25  Aligned_cols=11  Identities=18%  Similarity=0.456  Sum_probs=6.2

Q ss_pred             cceeccccccc
Q psy4084          50 RQFACHMCIKV   60 (86)
Q Consensus        50 ~~~~C~~C~~~   60 (86)
                      ..+.|+.|+..
T Consensus        18 ~~~vCp~C~~e   28 (30)
T PF08274_consen   18 ELLVCPECGHE   28 (30)
T ss_dssp             SSEEETTTTEE
T ss_pred             CEEeCCccccc
Confidence            34566666643


No 114
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=77.07  E-value=0.28  Score=31.10  Aligned_cols=57  Identities=25%  Similarity=0.455  Sum_probs=28.8

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCce-ecccccccCCChHHHhhhhhCCcceecccccccc
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQF-ACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVF   61 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~-~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~   61 (86)
                      |-.||-+|+--..|-.- |.++..+.| -|+.|.+.|.....-+-|   -+|..|+.||...
T Consensus       126 CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nRRfH---AQp~aCp~CGP~~  183 (750)
T COG0068         126 CTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNRRFH---AQPIACPKCGPHL  183 (750)
T ss_pred             cCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCccccccc---cccccCcccCCCe
Confidence            44455555444433221 223333333 366666666555544444   4566777777643


No 115
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=76.41  E-value=1.1  Score=22.45  Aligned_cols=10  Identities=20%  Similarity=0.700  Sum_probs=4.6

Q ss_pred             eecccccccc
Q psy4084          52 FACHMCIKVF   61 (86)
Q Consensus        52 ~~C~~C~~~~   61 (86)
                      +.|..||..|
T Consensus        71 ~~C~~CG~~~   80 (135)
T PRK03824         71 LKCRNCGNEW   80 (135)
T ss_pred             EECCCCCCEE
Confidence            4444444444


No 116
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=75.43  E-value=1.8  Score=16.74  Aligned_cols=14  Identities=29%  Similarity=0.762  Sum_probs=11.1

Q ss_pred             ceecccccccccCH
Q psy4084          51 QFACHMCIKVFPSQ   64 (86)
Q Consensus        51 ~~~C~~C~~~~~~~   64 (86)
                      |+.|..|+..|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78899999887544


No 117
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=75.39  E-value=2.2  Score=20.47  Aligned_cols=16  Identities=25%  Similarity=0.586  Sum_probs=10.4

Q ss_pred             ceecccccccCCChHH
Q psy4084          26 QFACHMCIKVFPSQDK   41 (86)
Q Consensus        26 ~~~c~~c~~~~~~~~~   41 (86)
                      |.+|..||..|...+.
T Consensus         2 pH~CtrCG~vf~~g~~   17 (112)
T COG3364           2 PHQCTRCGEVFDDGSE   17 (112)
T ss_pred             CceecccccccccccH
Confidence            4567777777776543


No 118
>PF12907 zf-met2:  Zinc-binding
Probab=75.04  E-value=2.5  Score=16.63  Aligned_cols=25  Identities=20%  Similarity=0.558  Sum_probs=15.6

Q ss_pred             eecccccccc---cCHHHHHHHHHh-CCC
Q psy4084          52 FACHMCIKVF---PSQDKLRMHMLS-GLQ   76 (86)
Q Consensus        52 ~~C~~C~~~~---~~~~~l~~h~~~-~~~   76 (86)
                      +.|.+|..+|   .....|..|... |.+
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK   30 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPK   30 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCC
Confidence            4577776443   455678888775 444


No 119
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=74.27  E-value=1.7  Score=18.29  Aligned_cols=30  Identities=17%  Similarity=0.341  Sum_probs=15.2

Q ss_pred             eecccccccCCChHHHhhhhhCCcceecccccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVF   61 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~   61 (86)
                      +.|+.|+..+.......     .-...|+.||..+
T Consensus         3 ~~CP~CG~~iev~~~~~-----GeiV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENPEL-----GELVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCCcc-----CCEEeCCCCCCEE
Confidence            46777776554333211     1234666666543


No 120
>KOG4167|consensus
Probab=74.15  E-value=1.2  Score=28.71  Aligned_cols=24  Identities=21%  Similarity=0.366  Sum_probs=20.3

Q ss_pred             CcchhhhccChHHHHhhHHHHhCC
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSD   24 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~   24 (86)
                      |.+|++.|..--++..||.+|.-.
T Consensus       795 CreC~kvF~KiKSrNAHMK~Hr~q  818 (907)
T KOG4167|consen  795 CRECGKVFFKIKSRNAHMKTHRQQ  818 (907)
T ss_pred             hHHHHHHHHHHhhhhHHHHHHHHH
Confidence            678999999888888999988753


No 121
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=73.98  E-value=5.1  Score=23.74  Aligned_cols=19  Identities=37%  Similarity=0.670  Sum_probs=10.0

Q ss_pred             cccccccCCChHHHhhhhh
Q psy4084          29 CHMCIKVFPSQDKLRMHML   47 (86)
Q Consensus        29 c~~c~~~~~~~~~l~~h~~   47 (86)
                      |..|...|...+.|..|++
T Consensus       223 C~FC~~~FYdDDEL~~HcR  241 (493)
T COG5236         223 CIFCKIYFYDDDELRRHCR  241 (493)
T ss_pred             hhhccceecChHHHHHHHH
Confidence            4445555555555555554


No 122
>PRK14873 primosome assembly protein PriA; Provisional
Probab=73.97  E-value=1.4  Score=28.10  Aligned_cols=9  Identities=22%  Similarity=0.730  Sum_probs=4.5

Q ss_pred             ceecccccc
Q psy4084          51 QFACHMCIK   59 (86)
Q Consensus        51 ~~~C~~C~~   59 (86)
                      |+.|+.||.
T Consensus       422 p~~Cp~Cgs  430 (665)
T PRK14873        422 DWRCPRCGS  430 (665)
T ss_pred             CccCCCCcC
Confidence            445555544


No 123
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=72.25  E-value=6.4  Score=22.99  Aligned_cols=26  Identities=19%  Similarity=0.446  Sum_probs=21.2

Q ss_pred             CcceecccccccccCHHHHHHHHHhC
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLSG   74 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~~   74 (86)
                      .-.|+|+.|...|-..-+.-.|...|
T Consensus       386 s~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         386 SGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ccceechhhhhhhhhhhHHHHHHHHh
Confidence            45689999999998888887787776


No 124
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=72.06  E-value=1.3  Score=18.32  Aligned_cols=11  Identities=18%  Similarity=0.184  Sum_probs=5.0

Q ss_pred             CcchhhhccCh
Q psy4084           1 MSECMGKFTEY   11 (86)
Q Consensus         1 c~~C~~~~~~~   11 (86)
                      ||.|++.|...
T Consensus        23 CPlC~r~l~~e   33 (54)
T PF04423_consen   23 CPLCGRPLDEE   33 (54)
T ss_dssp             -TTT--EE-HH
T ss_pred             CCCCCCCCCHH
Confidence            77888887654


No 125
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=72.00  E-value=1.3  Score=22.05  Aligned_cols=35  Identities=17%  Similarity=0.357  Sum_probs=18.8

Q ss_pred             eecccccccCCChHHHhhhhhCCcceecccccccccC
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPS   63 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~   63 (86)
                      ..|+.|+...  .............|.|..|++.|..
T Consensus        31 ~~cP~C~s~~--~~k~g~~~~~~qRyrC~~C~~tf~~   65 (129)
T COG3677          31 VNCPRCKSSN--VVKIGGIRRGHQRYKCKSCGSTFTV   65 (129)
T ss_pred             CcCCCCCccc--eeeECCccccccccccCCcCcceee
Confidence            4577776443  1111111112456889999888753


No 126
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=71.91  E-value=4.4  Score=24.86  Aligned_cols=23  Identities=26%  Similarity=0.482  Sum_probs=19.9

Q ss_pred             ceecccccccccCHHHHHHHHHh
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      =+.|+.|.+.|.....+..|+..
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHH
Confidence            36899999999999999999875


No 127
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=71.75  E-value=1.9  Score=16.99  Aligned_cols=15  Identities=33%  Similarity=0.611  Sum_probs=9.2

Q ss_pred             cceecccccccccCH
Q psy4084          50 RQFACHMCIKVFPSQ   64 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~   64 (86)
                      .|+.|+.|+..|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            478899999888544


No 128
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=71.58  E-value=2.3  Score=17.50  Aligned_cols=18  Identities=22%  Similarity=0.460  Sum_probs=13.5

Q ss_pred             CcceecccccccccCHHH
Q psy4084          49 DRQFACHMCIKVFPSQDK   66 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~   66 (86)
                      ++++.|..||..|.....
T Consensus         2 Dk~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             CeeEEcccCCCeEEEehh
Confidence            467889999998865543


No 129
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=70.90  E-value=0.9  Score=27.83  Aligned_cols=9  Identities=22%  Similarity=0.504  Sum_probs=5.3

Q ss_pred             ceecccccc
Q psy4084          51 QFACHMCIK   59 (86)
Q Consensus        51 ~~~C~~C~~   59 (86)
                      |..|+.|+.
T Consensus       253 ~~~Cp~C~s  261 (505)
T TIGR00595       253 PKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCC
Confidence            455666654


No 130
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=70.06  E-value=1.5  Score=21.06  Aligned_cols=10  Identities=20%  Similarity=0.627  Sum_probs=6.1

Q ss_pred             Cceecccccc
Q psy4084          25 RQFACHMCIK   34 (86)
Q Consensus        25 ~~~~c~~c~~   34 (86)
                      +|..|+.|+.
T Consensus         1 ~p~~CpYCg~   10 (102)
T PF11672_consen    1 KPIICPYCGG   10 (102)
T ss_pred             CCcccCCCCC
Confidence            3556777764


No 131
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=69.52  E-value=1.9  Score=24.21  Aligned_cols=30  Identities=23%  Similarity=0.509  Sum_probs=21.1

Q ss_pred             CcceecccccccccCHHHHHHHHHhCCCCccCCCCcC
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKLC   85 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~C   85 (86)
                      +..-.||.||....-...|       ++-..|+|+.|
T Consensus       218 e~~r~CP~Cg~~W~L~~pl-------h~iFdFKCD~C  247 (258)
T PF10071_consen  218 EQARKCPSCGGDWRLKEPL-------HDIFDFKCDPC  247 (258)
T ss_pred             hhCCCCCCCCCccccCCch-------hhceeccCCcc
Confidence            3445799999877666554       45566899887


No 132
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=69.32  E-value=5.4  Score=20.24  Aligned_cols=25  Identities=20%  Similarity=0.208  Sum_probs=19.1

Q ss_pred             eecccccccccCHHHHHHHHHhCCCCcc
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLSGLQTFD   79 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~   79 (86)
                      ..|.++|+.|.   .|.+|+.+|.+-.|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCCH
Confidence            56888898874   57899999876544


No 133
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=68.29  E-value=3.3  Score=20.12  Aligned_cols=10  Identities=30%  Similarity=0.551  Sum_probs=4.9

Q ss_pred             eecccccccc
Q psy4084          52 FACHMCIKVF   61 (86)
Q Consensus        52 ~~C~~C~~~~   61 (86)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            4455555443


No 134
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=68.12  E-value=2.8  Score=20.44  Aligned_cols=11  Identities=18%  Similarity=0.534  Sum_probs=5.8

Q ss_pred             eeccccccccc
Q psy4084          52 FACHMCIKVFP   62 (86)
Q Consensus        52 ~~C~~C~~~~~   62 (86)
                      +.|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            45555655443


No 135
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=68.05  E-value=9.2  Score=16.48  Aligned_cols=33  Identities=21%  Similarity=0.278  Sum_probs=20.4

Q ss_pred             eecccccccCCChHHHhhhhhCCcceecccccccccCHHH
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPSQDK   66 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~~~~   66 (86)
                      -.|+.||.....       ....+.+.|+.||.......+
T Consensus        29 q~C~~CG~~~~~-------~~~~r~~~C~~Cg~~~~rD~n   61 (69)
T PF07282_consen   29 QTCPRCGHRNKK-------RRSGRVFTCPNCGFEMDRDVN   61 (69)
T ss_pred             cCccCccccccc-------ccccceEEcCCCCCEECcHHH
Confidence            346677655433       112567899999988665543


No 136
>COG1773 Rubredoxin [Energy production and conversion]
Probab=67.54  E-value=2.9  Score=17.70  Aligned_cols=12  Identities=25%  Similarity=0.836  Sum_probs=8.9

Q ss_pred             ceeccccccccc
Q psy4084          51 QFACHMCIKVFP   62 (86)
Q Consensus        51 ~~~C~~C~~~~~   62 (86)
                      .|+|..||..|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            577888887764


No 137
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=67.47  E-value=4.9  Score=20.42  Aligned_cols=43  Identities=19%  Similarity=0.299  Sum_probs=26.3

Q ss_pred             eecccccccCCChHHHh--hhhhC------CcceecccccccccCHHHHHH
Q psy4084          27 FACHMCIKVFPSQDKLR--MHMLS------DRQFACHMCIKVFPSQDKLRM   69 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~--~h~~~------~~~~~C~~C~~~~~~~~~l~~   69 (86)
                      -.|..|+..+.....-.  .-+..      +.=+.|+.||+.|...+.+..
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHHH
Confidence            57899987654432211  11111      345789999999988766553


No 138
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=67.45  E-value=7.6  Score=20.65  Aligned_cols=43  Identities=12%  Similarity=0.455  Sum_probs=26.6

Q ss_pred             HHHhhHHHHhCCCceecccccccCCChHHHhhhhhCCcceecccccccc
Q psy4084          13 VIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVF   61 (86)
Q Consensus        13 ~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~   61 (86)
                      .|+.-+..-....-|.|+.|...++.....      +..|.|+.||...
T Consensus       100 ~Lk~~le~~~~~~~y~C~~~~~r~sfdeA~------~~~F~Cp~Cg~~L  142 (176)
T COG1675         100 KLKRKLEKETENNYYVCPNCHVKYSFDEAM------ELGFTCPKCGEDL  142 (176)
T ss_pred             HHHHHHHhhccCCceeCCCCCCcccHHHHH------HhCCCCCCCCchh
Confidence            344444445556678898777665554433      2348899998764


No 139
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=67.35  E-value=4.7  Score=16.04  Aligned_cols=15  Identities=27%  Similarity=0.609  Sum_probs=9.8

Q ss_pred             ecccccccccCHHHH
Q psy4084          53 ACHMCIKVFPSQDKL   67 (86)
Q Consensus        53 ~C~~C~~~~~~~~~l   67 (86)
                      .|..|++.|...-..
T Consensus        10 ~C~~C~rpf~WRKKW   24 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKW   24 (42)
T ss_pred             cCcccCCcchHHHHH
Confidence            577788777655443


No 140
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=67.29  E-value=3.5  Score=19.99  Aligned_cols=14  Identities=21%  Similarity=0.638  Sum_probs=8.8

Q ss_pred             ceecccccccccCH
Q psy4084          51 QFACHMCIKVFPSQ   64 (86)
Q Consensus        51 ~~~C~~C~~~~~~~   64 (86)
                      .|.|+.|+..++..
T Consensus        19 ~~iCpeC~~EW~~~   32 (109)
T TIGR00686        19 QLICPSCLYEWNEN   32 (109)
T ss_pred             eeECcccccccccc
Confidence            46777777766533


No 141
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=66.69  E-value=0.91  Score=17.24  Aligned_cols=10  Identities=20%  Similarity=0.687  Sum_probs=3.5

Q ss_pred             eecccccccc
Q psy4084          52 FACHMCIKVF   61 (86)
Q Consensus        52 ~~C~~C~~~~   61 (86)
                      ..|..||..+
T Consensus        22 isC~~CGPr~   31 (35)
T PF07503_consen   22 ISCTNCGPRY   31 (35)
T ss_dssp             --BTTCC-SC
T ss_pred             ccCCCCCCCE
Confidence            3455555443


No 142
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=66.44  E-value=2.3  Score=16.50  Aligned_cols=12  Identities=17%  Similarity=0.703  Sum_probs=6.4

Q ss_pred             Ccceeccccccc
Q psy4084          49 DRQFACHMCIKV   60 (86)
Q Consensus        49 ~~~~~C~~C~~~   60 (86)
                      .+.|.|..|+..
T Consensus        22 ~~~w~C~~C~~~   33 (40)
T PF04810_consen   22 GKTWICNFCGTK   33 (40)
T ss_dssp             TTEEEETTT--E
T ss_pred             CCEEECcCCCCc
Confidence            356777777654


No 143
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=64.59  E-value=3.4  Score=19.35  Aligned_cols=32  Identities=19%  Similarity=0.445  Sum_probs=19.5

Q ss_pred             CceecccccccCCChHHHhhhhhCCcceecccccccccC
Q psy4084          25 RQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPS   63 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~   63 (86)
                      ..|.|+.|++.--...       ..-.|.|..|++.|+-
T Consensus        35 a~y~CpfCgk~~vkR~-------a~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         35 AKYFCPFCGKHAVKRQ-------AVGIWRCKGCKKTVAG   66 (90)
T ss_pred             CCccCCCCCCCceeee-------eeEEEEcCCCCCEEeC
Confidence            4588999974311100       0235889999888753


No 144
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=63.04  E-value=3.5  Score=16.87  Aligned_cols=7  Identities=29%  Similarity=1.179  Sum_probs=2.1

Q ss_pred             eeccccc
Q psy4084          27 FACHMCI   33 (86)
Q Consensus        27 ~~c~~c~   33 (86)
                      |.|+.|+
T Consensus        42 W~CPiC~   48 (50)
T PF02891_consen   42 WKCPICN   48 (50)
T ss_dssp             -B-TTT-
T ss_pred             eECcCCc
Confidence            5555554


No 145
>KOG0978|consensus
Probab=62.97  E-value=4.5  Score=26.13  Aligned_cols=21  Identities=38%  Similarity=0.678  Sum_probs=15.1

Q ss_pred             cceecccccccccCHHHHHHH
Q psy4084          50 RQFACHMCIKVFPSQDKLRMH   70 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~~~l~~h   70 (86)
                      +.-.||.|+.+|...+-+..|
T Consensus       677 RqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             hcCCCCCCCCCCCcccccccC
Confidence            445899999999877655443


No 146
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=62.04  E-value=6.2  Score=16.70  Aligned_cols=12  Identities=25%  Similarity=0.462  Sum_probs=6.4

Q ss_pred             CCceeccccccc
Q psy4084          24 DRQFACHMCIKV   35 (86)
Q Consensus        24 ~~~~~c~~c~~~   35 (86)
                      ...|+|+.||-.
T Consensus        12 ~v~~~Cp~cGip   23 (55)
T PF13824_consen   12 HVNFECPDCGIP   23 (55)
T ss_pred             ccCCcCCCCCCc
Confidence            344566666543


No 147
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=62.00  E-value=8.8  Score=14.36  Aligned_cols=21  Identities=14%  Similarity=0.380  Sum_probs=11.1

Q ss_pred             ceecccccccccCHHHHHHHHH
Q psy4084          51 QFACHMCIKVFPSQDKLRMHML   72 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~   72 (86)
                      .+.|+.|++..... -+..|+.
T Consensus         4 ~~~C~nC~R~v~a~-RfA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVAAS-RFAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEEGG-GHHHHHH
T ss_pred             eEECCCCcCCcchh-hhHHHHH
Confidence            35677777765433 3455554


No 148
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=60.63  E-value=3.7  Score=16.82  Aligned_cols=15  Identities=27%  Similarity=0.673  Sum_probs=10.3

Q ss_pred             ecccccccccCHHHH
Q psy4084          53 ACHMCIKVFPSQDKL   67 (86)
Q Consensus        53 ~C~~C~~~~~~~~~l   67 (86)
                      .|+.|++.|.+....
T Consensus        14 ICpvCqRPFsWRkKW   28 (54)
T COG4338          14 ICPVCQRPFSWRKKW   28 (54)
T ss_pred             hhhhhcCchHHHHHH
Confidence            578888888765443


No 149
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=60.46  E-value=2.9  Score=22.88  Aligned_cols=31  Identities=19%  Similarity=0.337  Sum_probs=0.0

Q ss_pred             cceecccccccccCHHHHHHHHHhCCCCccCC
Q psy4084          50 RQFACHMCIKVFPSQDKLRMHMLSGLQTFDLK   81 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~   81 (86)
                      ....|+.||...+.. .+..||++...+..|+
T Consensus       167 ~~~~cPitGe~IP~~-e~~eHmRi~LlDP~wk  197 (229)
T PF12230_consen  167 KMIICPITGEMIPAD-EMDEHMRIELLDPRWK  197 (229)
T ss_dssp             --------------------------------
T ss_pred             ccccccccccccccc-cccccccccccccccc
Confidence            346899999886644 6889999887776664


No 150
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=60.46  E-value=4.4  Score=15.91  Aligned_cols=12  Identities=17%  Similarity=0.540  Sum_probs=9.0

Q ss_pred             cceecccccccc
Q psy4084          50 RQFACHMCIKVF   61 (86)
Q Consensus        50 ~~~~C~~C~~~~   61 (86)
                      .+..|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            457888888765


No 151
>KOG1842|consensus
Probab=60.43  E-value=6.5  Score=24.09  Aligned_cols=25  Identities=24%  Similarity=0.513  Sum_probs=16.5

Q ss_pred             ceecccccccccCHHHHHHHHHhCC
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLSGL   75 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~~~   75 (86)
                      .|.|+.|...|.....|..|....|
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhc
Confidence            4667777777777777777766543


No 152
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=59.98  E-value=2.3  Score=16.04  Aligned_cols=8  Identities=25%  Similarity=0.646  Sum_probs=4.1

Q ss_pred             eecccccc
Q psy4084          52 FACHMCIK   59 (86)
Q Consensus        52 ~~C~~C~~   59 (86)
                      +.|+.||.
T Consensus        23 ~vC~~Cg~   30 (34)
T PF14803_consen   23 LVCPACGF   30 (34)
T ss_dssp             EEETTTTE
T ss_pred             eECCCCCC
Confidence            44555554


No 153
>KOG1994|consensus
Probab=59.58  E-value=7.7  Score=21.57  Aligned_cols=25  Identities=16%  Similarity=0.410  Sum_probs=21.2

Q ss_pred             cceecccccccccCHHHHHHHHHhC
Q psy4084          50 RQFACHMCIKVFPSQDKLRMHMLSG   74 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~~~l~~h~~~~   74 (86)
                      -.|.|-+||..|.+...|..|-...
T Consensus       238 eh~YC~fCG~~y~~~edl~ehCPGv  262 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEHCPGV  262 (268)
T ss_pred             cceEEEEeccccCCHHHHHHhCCCC
Confidence            4588999999999999999887643


No 154
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=59.27  E-value=3.2  Score=17.50  Aligned_cols=10  Identities=40%  Similarity=0.883  Sum_probs=5.8

Q ss_pred             ecccccccCC
Q psy4084          28 ACHMCIKVFP   37 (86)
Q Consensus        28 ~c~~c~~~~~   37 (86)
                      .|..|++.|.
T Consensus         7 ~C~~Cg~~~~   16 (54)
T PF14446_consen    7 KCPVCGKKFK   16 (54)
T ss_pred             cChhhCCccc
Confidence            4666666554


No 155
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=58.91  E-value=6.2  Score=16.68  Aligned_cols=32  Identities=9%  Similarity=0.164  Sum_probs=16.4

Q ss_pred             CcceecccccccccCHHHHHHHHHhCCCCccCCCCc
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKL   84 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~   84 (86)
                      +.|+....|+..|.....+ .++   ......+|+.
T Consensus        22 ~~PV~s~~C~H~fek~aI~-~~i---~~~~~~~CPv   53 (57)
T PF11789_consen   22 EDPVKSKKCGHTFEKEAIL-QYI---QRNGSKRCPV   53 (57)
T ss_dssp             SSEEEESSS--EEEHHHHH-HHC---TTTS-EE-SC
T ss_pred             hCCcCcCCCCCeecHHHHH-HHH---HhcCCCCCCC
Confidence            4577777888887655443 344   2344566665


No 156
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=58.82  E-value=1.5  Score=15.77  Aligned_cols=8  Identities=50%  Similarity=0.970  Sum_probs=3.7

Q ss_pred             cccccccC
Q psy4084          29 CHMCIKVF   36 (86)
Q Consensus        29 c~~c~~~~   36 (86)
                      |..|++.|
T Consensus         3 CiDC~~~F   10 (28)
T PF08790_consen    3 CIDCSKDF   10 (28)
T ss_dssp             ETTTTEEE
T ss_pred             eecCCCCc
Confidence            44444444


No 157
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=58.76  E-value=5.4  Score=16.23  Aligned_cols=12  Identities=25%  Similarity=0.833  Sum_probs=8.9

Q ss_pred             eecccccccccC
Q psy4084          52 FACHMCIKVFPS   63 (86)
Q Consensus        52 ~~C~~C~~~~~~   63 (86)
                      |+|..|+..+.-
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            678888877643


No 158
>KOG0717|consensus
Probab=57.31  E-value=9.4  Score=23.60  Aligned_cols=22  Identities=36%  Similarity=0.634  Sum_probs=19.0

Q ss_pred             eecccccccccCHHHHHHHHHh
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      +.|..|.+.|.+.-.+..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7799999999999999888764


No 159
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=56.79  E-value=5.1  Score=19.44  Aligned_cols=11  Identities=27%  Similarity=0.558  Sum_probs=5.1

Q ss_pred             eeccccccccc
Q psy4084          52 FACHMCIKVFP   62 (86)
Q Consensus        52 ~~C~~C~~~~~   62 (86)
                      +.|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            44555555544


No 160
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=56.04  E-value=6.5  Score=19.26  Aligned_cols=9  Identities=33%  Similarity=0.918  Sum_probs=4.0

Q ss_pred             eeccccccc
Q psy4084          52 FACHMCIKV   60 (86)
Q Consensus        52 ~~C~~C~~~   60 (86)
                      +.|..||..
T Consensus        72 ~~C~~Cg~~   80 (117)
T PRK00564         72 LECKDCSHV   80 (117)
T ss_pred             EEhhhCCCc
Confidence            344444433


No 161
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=55.12  E-value=7.5  Score=23.63  Aligned_cols=13  Identities=23%  Similarity=0.467  Sum_probs=7.2

Q ss_pred             ceecccccccccC
Q psy4084          51 QFACHMCIKVFPS   63 (86)
Q Consensus        51 ~~~C~~C~~~~~~   63 (86)
                      -|.|+.||..+..
T Consensus       367 g~rC~kCg~~~~~  379 (421)
T COG1571         367 GFRCKKCGTRARE  379 (421)
T ss_pred             CcccccccccCCc
Confidence            5566666655443


No 162
>PRK10220 hypothetical protein; Provisional
Probab=54.68  E-value=10  Score=18.51  Aligned_cols=13  Identities=15%  Similarity=0.623  Sum_probs=7.6

Q ss_pred             ceecccccccccC
Q psy4084          51 QFACHMCIKVFPS   63 (86)
Q Consensus        51 ~~~C~~C~~~~~~   63 (86)
                      .|.|+.|+.-+..
T Consensus        20 ~~vCpeC~hEW~~   32 (111)
T PRK10220         20 MYICPECAHEWND   32 (111)
T ss_pred             eEECCcccCcCCc
Confidence            4566666665543


No 163
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=54.56  E-value=3  Score=19.93  Aligned_cols=38  Identities=18%  Similarity=0.273  Sum_probs=20.1

Q ss_pred             CCceecccccccCCChHHHhhhhhCCcceeccccccccc
Q psy4084          24 DRQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFP   62 (86)
Q Consensus        24 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~   62 (86)
                      .+.|.|+.|+..-...-.+..-.. .-...|..||..|.
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk~~~-~g~~~Cg~CGls~e   57 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKKTVN-IGTAVCGNCGLSFE   57 (104)
T ss_pred             CceEecCccCCeeeeEEEEEecCc-eeEEEcccCcceEE
Confidence            456899999865433222211100 12356777776653


No 164
>PF12773 DZR:  Double zinc ribbon
Probab=54.32  E-value=7.5  Score=15.55  Aligned_cols=25  Identities=20%  Similarity=0.381  Sum_probs=13.1

Q ss_pred             ecccccccCCChHHHhhhhhCCcceeccccccc
Q psy4084          28 ACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKV   60 (86)
Q Consensus        28 ~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~   60 (86)
                      .|+.||..+.        ........|+.|+..
T Consensus        14 fC~~CG~~l~--------~~~~~~~~C~~Cg~~   38 (50)
T PF12773_consen   14 FCPHCGTPLP--------PPDQSKKICPNCGAE   38 (50)
T ss_pred             CChhhcCChh--------hccCCCCCCcCCcCC
Confidence            4666665544        111334567777764


No 165
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=53.98  E-value=9.8  Score=19.76  Aligned_cols=32  Identities=16%  Similarity=0.338  Sum_probs=18.2

Q ss_pred             cceecccccccccCHHHHHHHHHhCCCCccCCCCcCC
Q psy4084          50 RQFACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~C~   86 (86)
                      -+|.|. |+..+.+.   ++|-..-.++ .|.|-.|+
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~  147 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCG  147 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-eEEeccCC
Confidence            367788 87765544   2233333344 67777774


No 166
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=53.75  E-value=7.5  Score=18.95  Aligned_cols=10  Identities=20%  Similarity=0.567  Sum_probs=5.5

Q ss_pred             eecccccccC
Q psy4084          27 FACHMCIKVF   36 (86)
Q Consensus        27 ~~c~~c~~~~   36 (86)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            4566666443


No 167
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=53.42  E-value=3.2  Score=16.13  Aligned_cols=10  Identities=20%  Similarity=0.806  Sum_probs=6.5

Q ss_pred             eecccccccc
Q psy4084          52 FACHMCIKVF   61 (86)
Q Consensus        52 ~~C~~C~~~~   61 (86)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            6677777654


No 168
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=52.90  E-value=5.9  Score=16.35  Aligned_cols=12  Identities=17%  Similarity=0.902  Sum_probs=9.4

Q ss_pred             eecccccccccC
Q psy4084          52 FACHMCIKVFPS   63 (86)
Q Consensus        52 ~~C~~C~~~~~~   63 (86)
                      |+|..||..+.-
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            678899988763


No 169
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=52.66  E-value=2.4  Score=17.64  Aligned_cols=17  Identities=18%  Similarity=0.497  Sum_probs=5.7

Q ss_pred             ceecccccccccCHHHH
Q psy4084          51 QFACHMCIKVFPSQDKL   67 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l   67 (86)
                      .|.|+.|+..|-..-.+
T Consensus        21 ~y~C~~C~~~FC~dCD~   37 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDV   37 (51)
T ss_dssp             EE--TTTT--B-HHHHH
T ss_pred             eEECCCCCCccccCcCh
Confidence            45555555555444333


No 170
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=52.44  E-value=12  Score=21.12  Aligned_cols=14  Identities=29%  Similarity=0.674  Sum_probs=9.4

Q ss_pred             ceecccccccccCH
Q psy4084          51 QFACHMCIKVFPSQ   64 (86)
Q Consensus        51 ~~~C~~C~~~~~~~   64 (86)
                      .|.|+.|+..|...
T Consensus       155 ef~C~~C~h~F~G~  168 (278)
T PF15135_consen  155 EFHCPKCRHNFRGF  168 (278)
T ss_pred             eeecccccccchhh
Confidence            46777777777543


No 171
>PLN02294 cytochrome c oxidase subunit Vb
Probab=52.15  E-value=8.1  Score=20.45  Aligned_cols=14  Identities=29%  Similarity=0.895  Sum_probs=10.1

Q ss_pred             CceecccccccCCC
Q psy4084          25 RQFACHMCIKVFPS   38 (86)
Q Consensus        25 ~~~~c~~c~~~~~~   38 (86)
                      ++.+|+.||..|..
T Consensus       140 kp~RCpeCG~~fkL  153 (174)
T PLN02294        140 KSFECPVCTQYFEL  153 (174)
T ss_pred             CceeCCCCCCEEEE
Confidence            57778888877654


No 172
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=52.11  E-value=18  Score=15.00  Aligned_cols=32  Identities=22%  Similarity=0.482  Sum_probs=15.4

Q ss_pred             ecccccccCCChHHHhhhhhCCcceeccccccc
Q psy4084          28 ACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKV   60 (86)
Q Consensus        28 ~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~   60 (86)
                      .|..|.-..+....... ...+....|+.||+.
T Consensus        24 ~C~gC~~~l~~~~~~~i-~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   24 TCSGCHMELPPQELNEI-RKGDEIVFCPNCGRI   55 (56)
T ss_pred             ccCCCCEEcCHHHHHHH-HcCCCeEECcCCCcc
Confidence            46666544433322221 111345678887763


No 173
>COG2879 Uncharacterized small protein [Function unknown]
Probab=51.99  E-value=22  Score=15.56  Aligned_cols=18  Identities=28%  Similarity=0.582  Sum_probs=14.1

Q ss_pred             cChHHHHhhHHHHhCCCc
Q psy4084           9 TEYQVIRKHIRTFHSDRQ   26 (86)
Q Consensus         9 ~~~~~l~~h~~~~~~~~~   26 (86)
                      +..+++..|++.++..+|
T Consensus        23 pdYdnYVehmr~~hPd~p   40 (65)
T COG2879          23 PDYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             CcHHHHHHHHHHhCcCCC
Confidence            566788889998887766


No 174
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=51.96  E-value=13  Score=15.98  Aligned_cols=10  Identities=40%  Similarity=0.942  Sum_probs=3.3

Q ss_pred             ecccccccCC
Q psy4084          28 ACHMCIKVFP   37 (86)
Q Consensus        28 ~c~~c~~~~~   37 (86)
                      .|..|++.|.
T Consensus        11 ~C~~C~~~F~   20 (69)
T PF01363_consen   11 NCMICGKKFS   20 (69)
T ss_dssp             B-TTT--B-B
T ss_pred             cCcCcCCcCC
Confidence            4556666653


No 175
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=51.65  E-value=3.1  Score=21.30  Aligned_cols=30  Identities=17%  Similarity=0.332  Sum_probs=18.0

Q ss_pred             CceecccccccCCChHHHhhhhhCCcceecccccccc
Q psy4084          25 RQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVF   61 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~   61 (86)
                      ..+.|..||.......       +..--.|+.|+...
T Consensus       111 G~l~C~~Cg~~~~~~~-------~~~l~~Cp~C~~~~  140 (146)
T PF07295_consen  111 GTLVCENCGHEVELTH-------PERLPPCPKCGHTE  140 (146)
T ss_pred             ceEecccCCCEEEecC-------CCcCCCCCCCCCCe
Confidence            4588999986533211       12334788887653


No 176
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=51.34  E-value=13  Score=15.32  Aligned_cols=12  Identities=17%  Similarity=0.382  Sum_probs=7.1

Q ss_pred             cceecccccccc
Q psy4084          50 RQFACHMCIKVF   61 (86)
Q Consensus        50 ~~~~C~~C~~~~   61 (86)
                      ..+.|..||..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            345676666553


No 177
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=50.64  E-value=6.8  Score=19.75  Aligned_cols=13  Identities=31%  Similarity=0.733  Sum_probs=7.0

Q ss_pred             eecccccccccCH
Q psy4084          52 FACHMCIKVFPSQ   64 (86)
Q Consensus        52 ~~C~~C~~~~~~~   64 (86)
                      .+|..||+.|...
T Consensus         2 H~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    2 HQCTKCGRVFEDG   14 (131)
T ss_pred             cccCcCCCCcCCC
Confidence            3555566665543


No 178
>PF14353 CpXC:  CpXC protein
Probab=50.19  E-value=9.4  Score=18.79  Aligned_cols=15  Identities=27%  Similarity=0.561  Sum_probs=11.2

Q ss_pred             cceecccccccccCH
Q psy4084          50 RQFACHMCIKVFPSQ   64 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~   64 (86)
                      ..+.|+.||..+.-.
T Consensus        37 ~~~~CP~Cg~~~~~~   51 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLE   51 (128)
T ss_pred             CEEECCCCCCceecC
Confidence            358899999887543


No 179
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=48.47  E-value=8.5  Score=18.66  Aligned_cols=24  Identities=25%  Similarity=0.416  Sum_probs=18.4

Q ss_pred             CceecccccccCCChHHHhhhhhC
Q psy4084          25 RQFACHMCIKVFPSQDKLRMHMLS   48 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~h~~~   48 (86)
                      ..+.|..|.+.|.+...|..|.++
T Consensus        54 GqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhcc
Confidence            347788888888888888887754


No 180
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=48.23  E-value=26  Score=19.11  Aligned_cols=37  Identities=16%  Similarity=0.313  Sum_probs=20.1

Q ss_pred             ceecccccccCCChHHHhhhhhCCcceecccccccccC
Q psy4084          26 QFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPS   63 (86)
Q Consensus        26 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~   63 (86)
                      -++|+.|+.. ...-.+..-...+..+.|..||..++.
T Consensus         6 y~~Cp~Cg~e-ev~hEVik~~g~~~lvrC~eCG~V~~~   42 (201)
T COG1326           6 YIECPSCGSE-EVSHEVIKERGREPLVRCEECGTVHPA   42 (201)
T ss_pred             EEECCCCCcc-hhhHHHHHhcCCceEEEccCCCcEeec
Confidence            4689999821 111122211111445789999988744


No 181
>KOG2071|consensus
Probab=47.82  E-value=12  Score=23.79  Aligned_cols=23  Identities=17%  Similarity=0.324  Sum_probs=17.8

Q ss_pred             CcchhhhccChHHHHhhHHHHhC
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHS   23 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~   23 (86)
                      |..||.+|........|+..|..
T Consensus       421 C~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  421 CKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             hcccccccccchhhhhHhhhhhh
Confidence            77899999988777777666554


No 182
>PTZ00448 hypothetical protein; Provisional
Probab=47.34  E-value=19  Score=21.64  Aligned_cols=24  Identities=17%  Similarity=0.382  Sum_probs=20.7

Q ss_pred             ceecccccccccCHHHHHHHHHhC
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLSG   74 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~~   74 (86)
                      .+.|..|+-.|.+....+.|+++.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            577999999999888889998873


No 183
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=46.77  E-value=11  Score=22.47  Aligned_cols=20  Identities=20%  Similarity=0.448  Sum_probs=16.4

Q ss_pred             CcchhhhccChHHHHhhHHH
Q psy4084           1 MSECMGKFTEYQVIRKHIRT   20 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~   20 (86)
                      |+.|++.|.....+..|...
T Consensus       241 C~~C~r~f~~~~VFe~Hl~g  260 (470)
T COG5188         241 CVKCGREFSRSKVFEYHLEG  260 (470)
T ss_pred             eHhhhhHhhhhHHHHHHHhh
Confidence            78899999988888888653


No 184
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=46.63  E-value=13  Score=17.46  Aligned_cols=15  Identities=13%  Similarity=0.405  Sum_probs=9.0

Q ss_pred             CcchhhhccChHHHH
Q psy4084           1 MSECMGKFTEYQVIR   15 (86)
Q Consensus         1 c~~C~~~~~~~~~l~   15 (86)
                      |+.||..|.+.+-+.
T Consensus        38 C~~CGe~y~~dev~~   52 (89)
T TIGR03829        38 CSHCGMEYQDDTTVK   52 (89)
T ss_pred             ccCCCcEeecHHHHH
Confidence            566776666555443


No 185
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=46.43  E-value=10  Score=14.43  Aligned_cols=11  Identities=18%  Similarity=0.661  Sum_probs=8.0

Q ss_pred             eeccccccccc
Q psy4084          52 FACHMCIKVFP   62 (86)
Q Consensus        52 ~~C~~C~~~~~   62 (86)
                      +.|+.||..|.
T Consensus         2 r~C~~Cg~~Yh   12 (36)
T PF05191_consen    2 RICPKCGRIYH   12 (36)
T ss_dssp             EEETTTTEEEE
T ss_pred             cCcCCCCCccc
Confidence            46788888875


No 186
>KOG2636|consensus
Probab=45.54  E-value=45  Score=20.81  Aligned_cols=24  Identities=21%  Similarity=0.592  Sum_probs=16.5

Q ss_pred             Ccceeccccc-ccccCHHHHHHHHH
Q psy4084          49 DRQFACHMCI-KVFPSQDKLRMHML   72 (86)
Q Consensus        49 ~~~~~C~~C~-~~~~~~~~l~~h~~   72 (86)
                      ...|.|.+|| +++.-...+.+|..
T Consensus       399 ~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  399 DIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             CcccceeeccCccccCcHHHHHHhH
Confidence            5667777776 66666667776654


No 187
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=45.52  E-value=12  Score=17.84  Aligned_cols=14  Identities=29%  Similarity=0.532  Sum_probs=10.0

Q ss_pred             CceecccccccCCC
Q psy4084          25 RQFACHMCIKVFPS   38 (86)
Q Consensus        25 ~~~~c~~c~~~~~~   38 (86)
                      ++..|..||..|..
T Consensus        78 ~~~rC~eCG~~fkL   91 (97)
T cd00924          78 KPKRCPECGHVFKL   91 (97)
T ss_pred             CceeCCCCCcEEEE
Confidence            57788888877654


No 188
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=45.47  E-value=32  Score=19.64  Aligned_cols=22  Identities=23%  Similarity=0.389  Sum_probs=15.1

Q ss_pred             CcceecccccccccCHHHHHHH
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMH   70 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h   70 (86)
                      .+.+.|+.||..+....+-...
T Consensus       320 ~r~~~C~~cg~~~~rD~naa~N  341 (364)
T COG0675         320 GRLFKCPRCGFVHDRDVNAALN  341 (364)
T ss_pred             ceeEECCCCCCeehhhHHHHHH
Confidence            5678999999886655444333


No 189
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=45.20  E-value=1.8  Score=16.56  Aligned_cols=8  Identities=25%  Similarity=1.169  Sum_probs=4.5

Q ss_pred             cceecccc
Q psy4084          50 RQFACHMC   57 (86)
Q Consensus        50 ~~~~C~~C   57 (86)
                      ..|.|..|
T Consensus        28 qryrC~~C   35 (36)
T PF03811_consen   28 QRYRCKDC   35 (36)
T ss_pred             EeEecCcC
Confidence            44666655


No 190
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=44.12  E-value=23  Score=13.60  Aligned_cols=16  Identities=19%  Similarity=0.368  Sum_probs=8.7

Q ss_pred             CcchhhhccChHHHHh
Q psy4084           1 MSECMGKFTEYQVIRK   16 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~   16 (86)
                      |+.|+..+.....|.+
T Consensus        22 C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   22 CPSCGGIWFDAGELEK   37 (41)
T ss_pred             CCCCCeEEccHHHHHH
Confidence            4556655555555543


No 191
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.10  E-value=4.5  Score=17.50  Aligned_cols=45  Identities=13%  Similarity=0.145  Sum_probs=25.6

Q ss_pred             hHHHHhCCCceecccccccCCChHHHhhhhhCCcceeccccccccc
Q psy4084          17 HIRTFHSDRQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFP   62 (86)
Q Consensus        17 h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~   62 (86)
                      |...+.+..++.|+.-+..+.....+. .+..+.-..|++|+..|.
T Consensus        15 ~~~I~~~~~~l~C~g~~~p~~HPrV~L-~mg~~gev~CPYC~t~y~   59 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPPNDHPRVFL-DMGDEGEVVCPYCSTRYR   59 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCCCCCCEEEE-EcCCCCcEecCccccEEE
Confidence            444555667788876655543333221 112244568999988774


No 192
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=44.09  E-value=7.6  Score=14.68  Aligned_cols=6  Identities=50%  Similarity=0.938  Sum_probs=1.6

Q ss_pred             chhhhc
Q psy4084           3 ECMGKF    8 (86)
Q Consensus         3 ~C~~~~    8 (86)
                      +|++.|
T Consensus         8 eC~~~f   13 (34)
T PF01286_consen    8 ECGKPF   13 (34)
T ss_dssp             TT--EE
T ss_pred             HhCCHH
Confidence            344433


No 193
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=43.77  E-value=33  Score=19.94  Aligned_cols=25  Identities=20%  Similarity=0.590  Sum_probs=22.3

Q ss_pred             CcceecccccccccCHHHHHHHHHh
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      ..-|.|+.|-+-|.+...+.+|+..
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHh
Confidence            5679999999999999999999874


No 194
>KOG2907|consensus
Probab=43.58  E-value=16  Score=17.98  Aligned_cols=11  Identities=27%  Similarity=0.830  Sum_probs=6.3

Q ss_pred             eeccccccccc
Q psy4084          52 FACHMCIKVFP   62 (86)
Q Consensus        52 ~~C~~C~~~~~   62 (86)
                      |.|+.|++.|.
T Consensus       103 YTC~kC~~k~~  113 (116)
T KOG2907|consen  103 YTCPKCKYKFT  113 (116)
T ss_pred             EEcCccceeee
Confidence            55666665543


No 195
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=43.49  E-value=1.7  Score=28.01  Aligned_cols=11  Identities=27%  Similarity=0.570  Sum_probs=6.2

Q ss_pred             ceecccccccc
Q psy4084          51 QFACHMCIKVF   61 (86)
Q Consensus        51 ~~~C~~C~~~~   61 (86)
                      +..|..||...
T Consensus       140 ~~~C~~Cgp~l  150 (711)
T TIGR00143       140 PIACPRCGPQL  150 (711)
T ss_pred             CccCCCCCcEE
Confidence            44566666543


No 196
>KOG3507|consensus
Probab=43.17  E-value=19  Score=15.53  Aligned_cols=28  Identities=14%  Similarity=0.256  Sum_probs=16.3

Q ss_pred             ceecccccccCCChHHHhhhhhCCcceecccccccc
Q psy4084          26 QFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVF   61 (86)
Q Consensus        26 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~   61 (86)
                      .|.|-.|+..-..        ...-.+.|.+||...
T Consensus        20 iYiCgdC~~en~l--------k~~D~irCReCG~RI   47 (62)
T KOG3507|consen   20 IYICGDCGQENTL--------KRGDVIRCRECGYRI   47 (62)
T ss_pred             EEEeccccccccc--------cCCCcEehhhcchHH
Confidence            3677777643211        113467888888653


No 197
>PRK05580 primosome assembly protein PriA; Validated
Probab=43.13  E-value=27  Score=22.76  Aligned_cols=9  Identities=33%  Similarity=0.534  Sum_probs=4.6

Q ss_pred             ceecccccc
Q psy4084          51 QFACHMCIK   59 (86)
Q Consensus        51 ~~~C~~C~~   59 (86)
                      |..|+.||.
T Consensus       421 ~~~Cp~Cg~  429 (679)
T PRK05580        421 PKACPECGS  429 (679)
T ss_pred             CCCCCCCcC
Confidence            445555544


No 198
>PF14369 zf-RING_3:  zinc-finger
Probab=43.07  E-value=9.6  Score=14.36  Aligned_cols=8  Identities=38%  Similarity=0.941  Sum_probs=3.8

Q ss_pred             Ccchhhhc
Q psy4084           1 MSECMGKF    8 (86)
Q Consensus         1 c~~C~~~~    8 (86)
                      |+.|+..|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            44455444


No 199
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=42.96  E-value=19  Score=14.67  Aligned_cols=9  Identities=33%  Similarity=1.069  Sum_probs=3.9

Q ss_pred             ecccccccc
Q psy4084          53 ACHMCIKVF   61 (86)
Q Consensus        53 ~C~~C~~~~   61 (86)
                      .|..||..|
T Consensus        20 ~Cr~Cg~~~   28 (57)
T cd00065          20 HCRNCGRIF   28 (57)
T ss_pred             ccCcCcCCc
Confidence            344444443


No 200
>KOG0782|consensus
Probab=42.06  E-value=4.3  Score=25.79  Aligned_cols=51  Identities=14%  Similarity=0.231  Sum_probs=31.0

Q ss_pred             HHHhhHHHHhCCCceecccccccCCChHHHhhhhhCCcceecccccccccCHH
Q psy4084          13 VIRKHIRTFHSDRQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPSQD   65 (86)
Q Consensus        13 ~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~~~   65 (86)
                      .+.+|-=.|.....=.|..|+++|..+-.+.  .+.-....|.+|..+|-.+.
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQKf~Fh--sKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQKFFFH--SKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhhheeec--cccEEEEEehHHHHHhhcch
Confidence            4555544454444557999999987765432  22224567888887775543


No 201
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=41.67  E-value=11  Score=15.68  Aligned_cols=9  Identities=22%  Similarity=0.645  Sum_probs=6.0

Q ss_pred             ecccccccc
Q psy4084          53 ACHMCIKVF   61 (86)
Q Consensus        53 ~C~~C~~~~   61 (86)
                      .|++||..+
T Consensus         2 ~CPyCge~~   10 (52)
T PF14255_consen    2 QCPYCGEPI   10 (52)
T ss_pred             CCCCCCCee
Confidence            577777654


No 202
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=41.04  E-value=21  Score=20.57  Aligned_cols=10  Identities=20%  Similarity=0.438  Sum_probs=5.0

Q ss_pred             eecccccccc
Q psy4084          52 FACHMCIKVF   61 (86)
Q Consensus        52 ~~C~~C~~~~   61 (86)
                      +.|+.|++-|
T Consensus        46 ~vc~~c~~h~   55 (285)
T TIGR00515        46 EVCPKCDHHM   55 (285)
T ss_pred             CCCCCCCCcC
Confidence            3455555544


No 203
>PLN02748 tRNA dimethylallyltransferase
Probab=40.78  E-value=28  Score=21.71  Aligned_cols=24  Identities=21%  Similarity=0.488  Sum_probs=20.0

Q ss_pred             cceecccccc-cccCHHHHHHHHHh
Q psy4084          50 RQFACHMCIK-VFPSQDKLRMHMLS   73 (86)
Q Consensus        50 ~~~~C~~C~~-~~~~~~~l~~h~~~   73 (86)
                      +.|.|..|+. .+.....+..|++.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            4578999997 78888889999875


No 204
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=40.74  E-value=20  Score=20.90  Aligned_cols=9  Identities=22%  Similarity=0.431  Sum_probs=5.9

Q ss_pred             eeccccccc
Q psy4084          27 FACHMCIKV   35 (86)
Q Consensus        27 ~~c~~c~~~   35 (86)
                      -.|++||..
T Consensus       185 ~~CPvCGs~  193 (305)
T TIGR01562       185 TLCPACGSP  193 (305)
T ss_pred             CcCCCCCCh
Confidence            367777754


No 205
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=40.50  E-value=12  Score=16.24  Aligned_cols=14  Identities=21%  Similarity=0.797  Sum_probs=10.2

Q ss_pred             Ccceeccccccccc
Q psy4084          49 DRQFACHMCIKVFP   62 (86)
Q Consensus        49 ~~~~~C~~C~~~~~   62 (86)
                      +-...|+.|++.|+
T Consensus        51 eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   51 EGELICPECGREYP   64 (68)
T ss_dssp             TTEEEETTTTEEEE
T ss_pred             CCEEEcCCCCCEEe
Confidence            44578888888775


No 206
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=40.21  E-value=16  Score=14.02  Aligned_cols=10  Identities=20%  Similarity=0.786  Sum_probs=4.7

Q ss_pred             ceeccccccc
Q psy4084          51 QFACHMCIKV   60 (86)
Q Consensus        51 ~~~C~~C~~~   60 (86)
                      -|.|..||-.
T Consensus         6 ~YkC~~CGni   15 (36)
T PF06397_consen    6 FYKCEHCGNI   15 (36)
T ss_dssp             EEE-TTT--E
T ss_pred             EEEccCCCCE
Confidence            4778777754


No 207
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=40.15  E-value=4.4  Score=20.74  Aligned_cols=11  Identities=27%  Similarity=0.911  Sum_probs=6.2

Q ss_pred             ceecccccccc
Q psy4084          51 QFACHMCIKVF   61 (86)
Q Consensus        51 ~~~C~~C~~~~   61 (86)
                      .|.|..|...|
T Consensus       130 ~~~c~~c~epf  140 (146)
T TIGR02159       130 LYRCRACKEPF  140 (146)
T ss_pred             HhhhhhhCCcH
Confidence            45566665554


No 208
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=40.04  E-value=14  Score=22.77  Aligned_cols=13  Identities=15%  Similarity=0.731  Sum_probs=7.7

Q ss_pred             CceecccccccCC
Q psy4084          25 RQFACHMCIKVFP   37 (86)
Q Consensus        25 ~~~~c~~c~~~~~   37 (86)
                      ..|+|..|+..+.
T Consensus       424 ~~~~c~~c~~~yd  436 (479)
T PRK05452        424 PRMQCSVCQWIYD  436 (479)
T ss_pred             CeEEECCCCeEEC
Confidence            3466666665554


No 209
>KOG2807|consensus
Probab=39.97  E-value=40  Score=20.10  Aligned_cols=24  Identities=21%  Similarity=0.412  Sum_probs=16.8

Q ss_pred             ceecccccccccCHHHHHHHHHhC
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLSG   74 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~~   74 (86)
                      .|.|+.|.-.|-..-+.-.|...|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhh
Confidence            467777777777766666676665


No 210
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=39.49  E-value=28  Score=18.43  Aligned_cols=46  Identities=13%  Similarity=0.294  Sum_probs=26.8

Q ss_pred             eecccccccCCChH--HHhhhhh------CCcceecccccccccCHHHHHHHHH
Q psy4084          27 FACHMCIKVFPSQD--KLRMHML------SDRQFACHMCIKVFPSQDKLRMHML   72 (86)
Q Consensus        27 ~~c~~c~~~~~~~~--~l~~h~~------~~~~~~C~~C~~~~~~~~~l~~h~~   72 (86)
                      -.|+.|+......+  .......      ...-+.|+.||+.|.-.+.+..-.+
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiYW~GsHw~~m~~  151 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIYWKGSHWRRMVE  151 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCcccccCchHHHHHHH
Confidence            46888886543322  2111111      1334679999999988877654433


No 211
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=39.43  E-value=24  Score=25.00  Aligned_cols=6  Identities=33%  Similarity=0.911  Sum_probs=3.1

Q ss_pred             eccccc
Q psy4084          53 ACHMCI   58 (86)
Q Consensus        53 ~C~~C~   58 (86)
                      .|+.|+
T Consensus       711 ~CP~CG  716 (1337)
T PRK14714        711 ECPRCD  716 (1337)
T ss_pred             cCCCCC
Confidence            355554


No 212
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=39.40  E-value=28  Score=14.44  Aligned_cols=10  Identities=30%  Similarity=0.703  Sum_probs=6.0

Q ss_pred             ceeccccccc
Q psy4084          51 QFACHMCIKV   60 (86)
Q Consensus        51 ~~~C~~C~~~   60 (86)
                      .+.|..||.+
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            4566666654


No 213
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=38.57  E-value=15  Score=14.12  Aligned_cols=11  Identities=18%  Similarity=0.624  Sum_probs=7.9

Q ss_pred             eeccccccccc
Q psy4084          52 FACHMCIKVFP   62 (86)
Q Consensus        52 ~~C~~C~~~~~   62 (86)
                      +.|+.||..+.
T Consensus        33 ~~C~~CGE~~~   43 (46)
T TIGR03831        33 LVCPQCGEEYL   43 (46)
T ss_pred             cccccCCCEee
Confidence            56888887654


No 214
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=38.49  E-value=22  Score=14.94  Aligned_cols=22  Identities=14%  Similarity=0.433  Sum_probs=15.5

Q ss_pred             CcceecccccccccCHHHHHHH
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMH   70 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h   70 (86)
                      .+-+-|-+||..|.+...|..+
T Consensus        25 ~~~~YC~~Cg~~Y~d~~dL~~~   46 (55)
T PF13821_consen   25 EEHNYCFWCGTKYDDEEDLERN   46 (55)
T ss_pred             hhCceeeeeCCccCCHHHHHhC
Confidence            3455688888888888777544


No 215
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=38.47  E-value=13  Score=18.67  Aligned_cols=17  Identities=29%  Similarity=0.606  Sum_probs=12.0

Q ss_pred             CcceecccccccccCHH
Q psy4084          49 DRQFACHMCIKVFPSQD   65 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~   65 (86)
                      +.|--|..||..|++..
T Consensus        66 e~psfchncgs~fpwte   82 (160)
T COG4306          66 EPPSFCHNCGSRFPWTE   82 (160)
T ss_pred             CCcchhhcCCCCCCcHH
Confidence            45666888888887653


No 216
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=38.38  E-value=9.8  Score=16.08  Aligned_cols=11  Identities=18%  Similarity=0.437  Sum_probs=6.2

Q ss_pred             cceeccccccc
Q psy4084          50 RQFACHMCIKV   60 (86)
Q Consensus        50 ~~~~C~~C~~~   60 (86)
                      -|+-|+.|...
T Consensus        27 fPlyCpKCK~E   37 (55)
T PF14205_consen   27 FPLYCPKCKQE   37 (55)
T ss_pred             ccccCCCCCce
Confidence            35566666543


No 217
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=37.95  E-value=19  Score=13.39  Aligned_cols=12  Identities=33%  Similarity=0.725  Sum_probs=7.9

Q ss_pred             ceeccccccccc
Q psy4084          51 QFACHMCIKVFP   62 (86)
Q Consensus        51 ~~~C~~C~~~~~   62 (86)
                      -+.|..|+..|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            456777877653


No 218
>PRK00420 hypothetical protein; Validated
Probab=37.32  E-value=27  Score=17.16  Aligned_cols=28  Identities=21%  Similarity=0.349  Sum_probs=15.8

Q ss_pred             eecccccccCCChHHHhhhhhCCcceeccccccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFP   62 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~   62 (86)
                      -.|+.||..+....        .-...|+.||....
T Consensus        24 ~~CP~Cg~pLf~lk--------~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         24 KHCPVCGLPLFELK--------DGEVVCPVHGKVYI   51 (112)
T ss_pred             CCCCCCCCcceecC--------CCceECCCCCCeee
Confidence            46888875432211        23456888877543


No 219
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=37.13  E-value=32  Score=13.78  Aligned_cols=28  Identities=25%  Similarity=0.558  Sum_probs=14.1

Q ss_pred             CceecccccccCCChHHHhhhhhCCcceeccccccc
Q psy4084          25 RQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKV   60 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~   60 (86)
                      +|-.|..|++....        .....+.|..|+..
T Consensus        10 ~~~~C~~C~~~i~g--------~~~~g~~C~~C~~~   37 (53)
T PF00130_consen   10 KPTYCDVCGKFIWG--------LGKQGYRCSWCGLV   37 (53)
T ss_dssp             STEB-TTSSSBECS--------SSSCEEEETTTT-E
T ss_pred             CCCCCcccCcccCC--------CCCCeEEECCCCCh
Confidence            45567777655411        11345777777654


No 220
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=36.46  E-value=7  Score=22.22  Aligned_cols=24  Identities=17%  Similarity=0.277  Sum_probs=13.0

Q ss_pred             CcceecccccccccCHHHHHHHHH
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHML   72 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~   72 (86)
                      .++++|+.||........|....+
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR  230 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTR  230 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeee
Confidence            356666666666555444443333


No 221
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=35.85  E-value=18  Score=16.55  Aligned_cols=9  Identities=33%  Similarity=1.058  Sum_probs=2.1

Q ss_pred             cceeccccc
Q psy4084          50 RQFACHMCI   58 (86)
Q Consensus        50 ~~~~C~~C~   58 (86)
                      +.|.|+.|+
T Consensus        21 ~~F~CPfC~   29 (81)
T PF05129_consen   21 KVFDCPFCN   29 (81)
T ss_dssp             S----TTT-
T ss_pred             ceEcCCcCC
Confidence            445555553


No 222
>PHA02998 RNA polymerase subunit; Provisional
Probab=35.70  E-value=13  Score=19.86  Aligned_cols=11  Identities=45%  Similarity=0.860  Sum_probs=7.9

Q ss_pred             eeccccccccc
Q psy4084          52 FACHMCIKVFP   62 (86)
Q Consensus        52 ~~C~~C~~~~~   62 (86)
                      |.|..||..|.
T Consensus       172 YkC~~CG~~wk  182 (195)
T PHA02998        172 HACRDCKKHFK  182 (195)
T ss_pred             EEcCCCCCccC
Confidence            67888877654


No 223
>KOG1280|consensus
Probab=35.54  E-value=50  Score=19.87  Aligned_cols=27  Identities=22%  Similarity=0.402  Sum_probs=19.1

Q ss_pred             cceecccccccccCHHHHHHHHHhCCC
Q psy4084          50 RQFACHMCIKVFPSQDKLRMHMLSGLQ   76 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~~~l~~h~~~~~~   76 (86)
                      .-|.|++|+..=.+...|..|....+-
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hp  104 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHP  104 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCc
Confidence            457788887777777777777766443


No 224
>PRK05978 hypothetical protein; Provisional
Probab=35.48  E-value=22  Score=18.38  Aligned_cols=30  Identities=20%  Similarity=0.221  Sum_probs=16.3

Q ss_pred             eecccccccCCChHHHhhhhhCCcceeccccccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFP   62 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~   62 (86)
                      -.|+.|++.--....|.      ..-.|+.||..|.
T Consensus        34 grCP~CG~G~LF~g~Lk------v~~~C~~CG~~~~   63 (148)
T PRK05978         34 GRCPACGEGKLFRAFLK------PVDHCAACGEDFT   63 (148)
T ss_pred             CcCCCCCCCcccccccc------cCCCccccCCccc
Confidence            36788876533333322      2235777776654


No 225
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=35.47  E-value=15  Score=23.75  Aligned_cols=12  Identities=17%  Similarity=0.221  Sum_probs=7.2

Q ss_pred             ecccccccccCH
Q psy4084          53 ACHMCIKVFPSQ   64 (86)
Q Consensus        53 ~C~~C~~~~~~~   64 (86)
                      -|+.||......
T Consensus        43 fC~~CG~~~~~~   54 (645)
T PRK14559         43 HCPNCGAETGTI   54 (645)
T ss_pred             cccccCCcccch
Confidence            477777665443


No 226
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=35.33  E-value=14  Score=17.42  Aligned_cols=25  Identities=16%  Similarity=0.290  Sum_probs=15.4

Q ss_pred             CcchhhhccChHHHHhhHHHHhCCCceecccccccCC
Q psy4084           1 MSECMGKFTEYQVIRKHIRTFHSDRQFACHMCIKVFP   37 (86)
Q Consensus         1 c~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   37 (86)
                      |+.||..+...            ...+.|+.|+....
T Consensus         3 C~~Cg~~l~~~------------~~~~~C~~C~~~~~   27 (104)
T TIGR01384         3 CPKCGSLMTPK------------NGVYVCPSCGYEKE   27 (104)
T ss_pred             CcccCcccccC------------CCeEECcCCCCccc
Confidence            67777665321            23578888886544


No 227
>PRK04351 hypothetical protein; Provisional
Probab=35.08  E-value=24  Score=18.25  Aligned_cols=28  Identities=14%  Similarity=0.352  Sum_probs=15.2

Q ss_pred             ceecccccccccCHHHHHHHHHhCCCCccCCCCcCC
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~C~   86 (86)
                      .|.|..|+..+.+.       +.+ ....|.|..|.
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~-n~~~yrCg~C~  139 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRI-NTKRYRCGKCR  139 (149)
T ss_pred             EEECCCCCCEeeee-------eec-CCCcEEeCCCC
Confidence            46777777655332       111 33557776663


No 228
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=35.08  E-value=30  Score=20.19  Aligned_cols=11  Identities=18%  Similarity=0.344  Sum_probs=4.8

Q ss_pred             eecccccccCC
Q psy4084          27 FACHMCIKVFP   37 (86)
Q Consensus        27 ~~c~~c~~~~~   37 (86)
                      +.|+.|+..|.
T Consensus        58 ~vcp~c~~h~r   68 (296)
T CHL00174         58 NICEQCGYHLK   68 (296)
T ss_pred             CCCCCCCCCcC
Confidence            34444444443


No 229
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=35.06  E-value=20  Score=13.98  Aligned_cols=10  Identities=20%  Similarity=0.328  Sum_probs=6.5

Q ss_pred             ceeccccccc
Q psy4084          51 QFACHMCIKV   60 (86)
Q Consensus        51 ~~~C~~C~~~   60 (86)
                      |..|+.||..
T Consensus         2 ~~~Cp~Cg~~   11 (47)
T PF14690_consen    2 PPRCPHCGSP   11 (47)
T ss_pred             CccCCCcCCC
Confidence            4567888743


No 230
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=34.85  E-value=39  Score=19.85  Aligned_cols=11  Identities=18%  Similarity=0.570  Sum_probs=7.6

Q ss_pred             Cceeccccccc
Q psy4084          25 RQFACHMCIKV   35 (86)
Q Consensus        25 ~~~~c~~c~~~   35 (86)
                      ..-.|++||..
T Consensus       186 ~~~~CPvCGs~  196 (309)
T PRK03564        186 QRQFCPVCGSM  196 (309)
T ss_pred             CCCCCCCCCCc
Confidence            34578888865


No 231
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=34.83  E-value=12  Score=18.98  Aligned_cols=11  Identities=18%  Similarity=0.754  Sum_probs=6.9

Q ss_pred             ceecccccccc
Q psy4084          51 QFACHMCIKVF   61 (86)
Q Consensus        51 ~~~C~~C~~~~   61 (86)
                      .|.|..|+..+
T Consensus       123 ~~~C~~C~~~~  133 (157)
T PF10263_consen  123 VYRCPSCGREY  133 (157)
T ss_pred             EEEcCCCCCEe
Confidence            35677777654


No 232
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=34.75  E-value=22  Score=13.82  Aligned_cols=9  Identities=22%  Similarity=0.549  Sum_probs=5.1

Q ss_pred             eeccccccc
Q psy4084          52 FACHMCIKV   60 (86)
Q Consensus        52 ~~C~~C~~~   60 (86)
                      +.|+.|+..
T Consensus         1 m~Cp~Cg~~    9 (43)
T PF08271_consen    1 MKCPNCGSK    9 (43)
T ss_dssp             ESBTTTSSS
T ss_pred             CCCcCCcCC
Confidence            346666654


No 233
>PF02701 zf-Dof:  Dof domain, zinc finger;  InterPro: IPR003851 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry consists of proteins containing a Dof domain, which is a zinc finger DNA-binding domain that shows resemblance to the Cys2 zinc finger, although it has a longer putative loop where an extra Cys residue is conserved []. AOBP, a DNA-binding protein in pumpkin (Cucurbita maxima), contains a 52 amino acid Dof domain, which is highly conserved in several DNA-binding proteins of higher plants. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent
Probab=34.64  E-value=1.9  Score=18.68  Aligned_cols=43  Identities=14%  Similarity=0.314  Sum_probs=19.9

Q ss_pred             CCceecccccccCCChHHHhhhhhCCcceecccccccccCHHH
Q psy4084          24 DRQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPSQDK   66 (86)
Q Consensus        24 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~~~~   66 (86)
                      +.+..|+.|+..-..--.+......+..+.|..|.+-+...+.
T Consensus         3 ~~~~~CPRC~S~nTKFcYyNNy~~~QPR~~Ck~C~rywT~GG~   45 (63)
T PF02701_consen    3 EQPLPCPRCDSTNTKFCYYNNYNLSQPRYFCKSCRRYWTHGGT   45 (63)
T ss_pred             ccCCCCCCcCCCCCEEEeecCCCCCCcchhhHHHHHHHHhcce
Confidence            3456777776432221222222222334566666655544433


No 234
>PRK01343 zinc-binding protein; Provisional
Probab=34.49  E-value=26  Score=15.02  Aligned_cols=10  Identities=30%  Similarity=0.371  Sum_probs=6.0

Q ss_pred             eecccccccc
Q psy4084          52 FACHMCIKVF   61 (86)
Q Consensus        52 ~~C~~C~~~~   61 (86)
                      ..|+.|++.+
T Consensus        10 ~~CP~C~k~~   19 (57)
T PRK01343         10 RPCPECGKPS   19 (57)
T ss_pred             CcCCCCCCcC
Confidence            4566666654


No 235
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=34.40  E-value=29  Score=13.28  Aligned_cols=9  Identities=22%  Similarity=0.682  Sum_probs=5.3

Q ss_pred             ceecccccc
Q psy4084          51 QFACHMCIK   59 (86)
Q Consensus        51 ~~~C~~C~~   59 (86)
                      .+.|..|+.
T Consensus        27 ~~~C~~C~~   35 (49)
T smart00109       27 GLRCSWCKV   35 (49)
T ss_pred             CcCCCCCCc
Confidence            456666654


No 236
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=33.95  E-value=23  Score=15.07  Aligned_cols=34  Identities=15%  Similarity=0.365  Sum_probs=17.3

Q ss_pred             eecccccccCCChHHHh--hhhhC--Ccceeccccccc
Q psy4084          27 FACHMCIKVFPSQDKLR--MHMLS--DRQFACHMCIKV   60 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~--~h~~~--~~~~~C~~C~~~   60 (86)
                      ..|..|++.+.-.....  ..++.  -..|.|..|...
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~R   40 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKER   40 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHH
Confidence            35777776654332211  11111  345888888643


No 238
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=33.89  E-value=31  Score=17.14  Aligned_cols=9  Identities=22%  Similarity=0.309  Sum_probs=4.1

Q ss_pred             eecccccccc
Q psy4084          52 FACHMCIKVF   61 (86)
Q Consensus        52 ~~C~~C~~~~   61 (86)
                      +.| .||..|
T Consensus        71 ~~C-~Cg~~~   79 (124)
T PRK00762         71 IEC-ECGYEG   79 (124)
T ss_pred             EEe-eCcCcc
Confidence            345 455443


No 239
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=33.85  E-value=30  Score=19.48  Aligned_cols=34  Identities=24%  Similarity=0.488  Sum_probs=17.2

Q ss_pred             ecccccccCCChHHHhhhhhCCcceeccccccccc
Q psy4084          28 ACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFP   62 (86)
Q Consensus        28 ~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~   62 (86)
                      .|..|....+......... ......||+||+...
T Consensus       199 ~C~GC~m~l~~~~~~~V~~-~d~iv~CP~CgRILy  232 (239)
T COG1579         199 VCGGCHMKLPSQTLSKVRK-KDEIVFCPYCGRILY  232 (239)
T ss_pred             cccCCeeeecHHHHHHHhc-CCCCccCCccchHHH
Confidence            4666654443332211111 244567899987643


No 240
>PRK12860 transcriptional activator FlhC; Provisional
Probab=33.74  E-value=42  Score=18.25  Aligned_cols=28  Identities=18%  Similarity=0.305  Sum_probs=15.7

Q ss_pred             ceecccccccccCHHHHHHHHHhCCCCccCCCCcCC
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~C~   86 (86)
                      ...|..||-.|....        +.-...|.|..|+
T Consensus       134 l~~C~~Cgg~fv~~~--------~e~~~~f~CplC~  161 (189)
T PRK12860        134 LARCCRCGGKFVTHA--------HDLRHNFVCGLCQ  161 (189)
T ss_pred             eccCCCCCCCeeccc--------cccCCCCcCCCCC
Confidence            346777776665321        2233457777774


No 241
>KOG2817|consensus
Probab=33.53  E-value=44  Score=20.37  Aligned_cols=35  Identities=20%  Similarity=0.295  Sum_probs=17.7

Q ss_pred             CcceecccccccccCHHHHHHHHHhCCCCccCCCCcCC
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~C~   86 (86)
                      +.|-.-..||..- +...+++-.+.  +...|+|+.|+
T Consensus       347 eNPPm~L~CGHVI-SkdAlnrLS~n--g~~sfKCPYCP  381 (394)
T KOG2817|consen  347 ENPPMMLICGHVI-SKDALNRLSKN--GSQSFKCPYCP  381 (394)
T ss_pred             CCCCeeeecccee-cHHHHHHHhhC--CCeeeeCCCCC
Confidence            4443334566653 34444433333  33368888774


No 242
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=33.39  E-value=18  Score=17.02  Aligned_cols=31  Identities=23%  Similarity=0.561  Sum_probs=19.0

Q ss_pred             CceecccccccCCChHHHhhhhhCCcceeccccccccc
Q psy4084          25 RQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFP   62 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~   62 (86)
                      ..|.|+.|++.--.     + . ..--|.|..|++.|+
T Consensus        34 ~ky~Cp~Cgk~~vk-----R-~-a~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   34 AKYTCPFCGKTSVK-----R-V-ATGIWKCKKCGKKFA   64 (90)
T ss_dssp             S-BEESSSSSSEEE-----E-E-ETTEEEETTTTEEEE
T ss_pred             CCCcCCCCCCceeE-----E-e-eeEEeecCCCCCEEe
Confidence            45899999864211     0 0 022489999998874


No 243
>PRK12722 transcriptional activator FlhC; Provisional
Probab=33.23  E-value=42  Score=18.19  Aligned_cols=27  Identities=19%  Similarity=0.324  Sum_probs=14.0

Q ss_pred             eecccccccccCHHHHHHHHHhCCCCccCCCCcCC
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~~~~~~~~~c~~C~   86 (86)
                      ..|..||-.|....        +.-...|.|..|+
T Consensus       135 ~~C~~Cgg~fv~~~--------~e~~~~f~CplC~  161 (187)
T PRK12722        135 SSCNCCGGHFVTHA--------HDPVGSFVCGLCQ  161 (187)
T ss_pred             ccCCCCCCCeeccc--------cccCCCCcCCCCC
Confidence            45666766654321        1223457777764


No 244
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=33.18  E-value=22  Score=15.21  Aligned_cols=12  Identities=25%  Similarity=0.481  Sum_probs=5.4

Q ss_pred             eecccccccccC
Q psy4084          52 FACHMCIKVFPS   63 (86)
Q Consensus        52 ~~C~~C~~~~~~   63 (86)
                      ..|+.|++.+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            468888777544


No 245
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=33.17  E-value=15  Score=19.16  Aligned_cols=19  Identities=26%  Similarity=0.567  Sum_probs=15.2

Q ss_pred             CcceecccccccccCHHHH
Q psy4084          49 DRQFACHMCIKVFPSQDKL   67 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l   67 (86)
                      +.|.-|..||+.|++....
T Consensus        66 ~~PsYC~~CGkpyPWt~~~   84 (158)
T PF10083_consen   66 EAPSYCHNCGKPYPWTENA   84 (158)
T ss_pred             CCChhHHhCCCCCchHHHH
Confidence            5788899999999876543


No 246
>KOG2747|consensus
Probab=32.86  E-value=31  Score=21.03  Aligned_cols=25  Identities=28%  Similarity=0.739  Sum_probs=22.1

Q ss_pred             CcceecccccccccCHHHHHHHHHh
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      ..-|.|+.|-+-+.+...|.+|+..
T Consensus       156 ~~lYiCEfCLkY~~s~~~l~rH~~k  180 (396)
T KOG2747|consen  156 DKLYICEFCLKYMKSRTSLQRHLKK  180 (396)
T ss_pred             CeEEEehHHHhHhchHHHHHHHHHh
Confidence            4568999999999999999999985


No 247
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.78  E-value=29  Score=15.85  Aligned_cols=30  Identities=23%  Similarity=0.479  Sum_probs=15.1

Q ss_pred             eecccccccCCChHHHhhhhhCCcceeccccccc
Q psy4084          27 FACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKV   60 (86)
Q Consensus        27 ~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~   60 (86)
                      |+|..|+..|.    +..++.....-.|+.|+-.
T Consensus        13 Y~c~~cg~~~d----vvq~~~ddplt~ce~c~a~   42 (82)
T COG2331          13 YECTECGNRFD----VVQAMTDDPLTTCEECGAR   42 (82)
T ss_pred             EeecccchHHH----HHHhcccCccccChhhChH
Confidence            67777776543    2233332222356666643


No 248
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=32.76  E-value=44  Score=20.83  Aligned_cols=25  Identities=24%  Similarity=0.721  Sum_probs=22.2

Q ss_pred             CcceecccccccccCHHHHHHHHHh
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      ..-|.|+.|-+-|.....|.+|+..
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~  220 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKK  220 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhc
Confidence            4578999999999999999999874


No 249
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=32.19  E-value=44  Score=19.43  Aligned_cols=10  Identities=20%  Similarity=0.441  Sum_probs=5.1

Q ss_pred             eecccccccc
Q psy4084          52 FACHMCIKVF   61 (86)
Q Consensus        52 ~~C~~C~~~~   61 (86)
                      +.|+.|++-|
T Consensus        47 ~vc~~c~~h~   56 (292)
T PRK05654         47 NVCPKCGHHM   56 (292)
T ss_pred             CCCCCCCCCe
Confidence            3455555544


No 250
>PLN03239 histone acetyltransferase; Provisional
Probab=32.11  E-value=49  Score=19.90  Aligned_cols=25  Identities=16%  Similarity=0.376  Sum_probs=21.7

Q ss_pred             CcceecccccccccCHHHHHHHHHh
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      ..-|.|+.|-+-|.+...|.+|+..
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHHh
Confidence            4578999999999999999999864


No 251
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=31.76  E-value=78  Score=16.57  Aligned_cols=13  Identities=23%  Similarity=0.654  Sum_probs=7.9

Q ss_pred             eecccccccccCH
Q psy4084          52 FACHMCIKVFPSQ   64 (86)
Q Consensus        52 ~~C~~C~~~~~~~   64 (86)
                      ..|..|++.+...
T Consensus       106 ~~C~~C~~~~~~~  118 (178)
T PF02146_consen  106 LRCSKCGKEYDRE  118 (178)
T ss_dssp             EEETTTSBEEEGH
T ss_pred             eeecCCCccccch
Confidence            4666676666544


No 252
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=31.44  E-value=21  Score=13.69  Aligned_cols=14  Identities=29%  Similarity=0.441  Sum_probs=7.8

Q ss_pred             ecccccccccCHHH
Q psy4084          53 ACHMCIKVFPSQDK   66 (86)
Q Consensus        53 ~C~~C~~~~~~~~~   66 (86)
                      .|+.|++.|-+.+.
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            47778777755543


No 253
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=31.43  E-value=43  Score=17.51  Aligned_cols=34  Identities=21%  Similarity=0.318  Sum_probs=14.0

Q ss_pred             Ccchhhhcc------ChHHHHhhHHHHh------------CCCceecccccc
Q psy4084           1 MSECMGKFT------EYQVIRKHIRTFH------------SDRQFACHMCIK   34 (86)
Q Consensus         1 c~~C~~~~~------~~~~l~~h~~~~~------------~~~~~~c~~c~~   34 (86)
                      |..|++.|-      ..+.+..|+....            ++..++|-.||.
T Consensus        17 C~~c~kWFCNg~~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~   68 (152)
T PF09416_consen   17 CNTCNKWFCNGRGNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGS   68 (152)
T ss_dssp             ETTTTEEEES--TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT--
T ss_pred             cCCCCcEeecCCCCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCC
Confidence            445666663      4455666655311            234577877764


No 254
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=31.36  E-value=23  Score=18.09  Aligned_cols=14  Identities=29%  Similarity=0.622  Sum_probs=11.6

Q ss_pred             Ccceeccccccccc
Q psy4084          49 DRQFACHMCIKVFP   62 (86)
Q Consensus        49 ~~~~~C~~C~~~~~   62 (86)
                      .++..|+.||..|.
T Consensus       110 g~~~RCpeCG~~fk  123 (136)
T PF01215_consen  110 GKPQRCPECGQVFK  123 (136)
T ss_dssp             TSEEEETTTEEEEE
T ss_pred             CCccCCCCCCeEEE
Confidence            56889999998774


No 255
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=30.51  E-value=40  Score=14.53  Aligned_cols=11  Identities=18%  Similarity=0.392  Sum_probs=6.4

Q ss_pred             Ccceecccccc
Q psy4084          49 DRQFACHMCIK   59 (86)
Q Consensus        49 ~~~~~C~~C~~   59 (86)
                      ++...|+.|.-
T Consensus        42 E~VArCPSCSL   52 (67)
T COG5216          42 EVVARCPSCSL   52 (67)
T ss_pred             ceEEEcCCceE
Confidence            55556766643


No 256
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=30.38  E-value=53  Score=19.58  Aligned_cols=10  Identities=20%  Similarity=0.590  Sum_probs=5.5

Q ss_pred             CCccCCCCcC
Q psy4084          76 QTFDLKSKLC   85 (86)
Q Consensus        76 ~~~~~~c~~C   85 (86)
                      |.-.|+|+.|
T Consensus       373 G~~~FKCPYC  382 (396)
T COG5109         373 GVLSFKCPYC  382 (396)
T ss_pred             CcEEeeCCCC
Confidence            3345666665


No 257
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=30.15  E-value=41  Score=17.87  Aligned_cols=19  Identities=21%  Similarity=0.480  Sum_probs=14.7

Q ss_pred             cceecccccccccCHHHHH
Q psy4084          50 RQFACHMCIKVFPSQDKLR   68 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~~~l~   68 (86)
                      ....|..||+.|.....+.
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             ccCcCcccCCccCcHhHHH
Confidence            4678999999998765554


No 258
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=29.95  E-value=16  Score=15.51  Aligned_cols=10  Identities=30%  Similarity=1.029  Sum_probs=2.9

Q ss_pred             cceecccccc
Q psy4084          50 RQFACHMCIK   59 (86)
Q Consensus        50 ~~~~C~~C~~   59 (86)
                      +.|.|+.||.
T Consensus        32 r~y~Cp~CgA   41 (55)
T PF05741_consen   32 RKYVCPICGA   41 (55)
T ss_dssp             GG---TTT--
T ss_pred             hcCcCCCCcC
Confidence            3456666664


No 259
>PTZ00064 histone acetyltransferase; Provisional
Probab=29.45  E-value=60  Score=20.72  Aligned_cols=25  Identities=28%  Similarity=0.563  Sum_probs=22.3

Q ss_pred             CcceecccccccccCHHHHHHHHHh
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      ..-|.|+.|-+-|.....|.+|+..
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhc
Confidence            4578999999999999999999874


No 260
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=29.39  E-value=21  Score=20.11  Aligned_cols=15  Identities=27%  Similarity=0.538  Sum_probs=10.2

Q ss_pred             CCceecccccccCCC
Q psy4084          24 DRQFACHMCIKVFPS   38 (86)
Q Consensus        24 ~~~~~c~~c~~~~~~   38 (86)
                      ..+|.|++++..|..
T Consensus       111 ~~~~~CPvt~~~~~~  125 (260)
T PF04641_consen  111 EGRFICPVTGKEFNG  125 (260)
T ss_pred             CceeECCCCCcccCC
Confidence            456888887776643


No 261
>PHA02942 putative transposase; Provisional
Probab=29.06  E-value=1.2e+02  Score=18.53  Aligned_cols=30  Identities=20%  Similarity=0.396  Sum_probs=18.8

Q ss_pred             ecccccccCCChHHHhhhhhCCcceecccccccccCHH
Q psy4084          28 ACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPSQD   65 (86)
Q Consensus        28 ~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~~~   65 (86)
                      .|+.||.....        ...+.|.|+.||.......
T Consensus       327 ~Cs~CG~~~~~--------l~~r~f~C~~CG~~~drD~  356 (383)
T PHA02942        327 SCPKCGHKMVE--------IAHRYFHCPSCGYENDRDV  356 (383)
T ss_pred             cCCCCCCccCc--------CCCCEEECCCCCCEeCcHH
Confidence            47777754321        1246789999998765553


No 262
>KOG2857|consensus
Probab=29.05  E-value=31  Score=17.80  Aligned_cols=23  Identities=17%  Similarity=0.404  Sum_probs=18.8

Q ss_pred             cceecccccccccCHHHHHHHHH
Q psy4084          50 RQFACHMCIKVFPSQDKLRMHML   72 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~~~l~~h~~   72 (86)
                      ..|+|+.|...+-+...++.|..
T Consensus        16 ~KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   16 IKYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hhccCCCCCCccccchhhhhccC
Confidence            35889999988888888888765


No 263
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=29.02  E-value=21  Score=12.19  Aligned_cols=7  Identities=29%  Similarity=0.596  Sum_probs=3.8

Q ss_pred             ecccccc
Q psy4084          28 ACHMCIK   34 (86)
Q Consensus        28 ~c~~c~~   34 (86)
                      .|+.|+.
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            4555654


No 264
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=28.97  E-value=78  Score=15.29  Aligned_cols=21  Identities=10%  Similarity=0.311  Sum_probs=13.9

Q ss_pred             cceecccccccccCHHHHHHH
Q psy4084          50 RQFACHMCIKVFPSQDKLRMH   70 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~~~l~~h   70 (86)
                      ..+.|+.||..+.........
T Consensus        30 ~~~~C~~CGe~~~~~e~~~~~   50 (127)
T TIGR03830        30 PGWYCPACGEELLDPEESKRN   50 (127)
T ss_pred             eeeECCCCCCEEEcHHHHHHH
Confidence            346788888887776655443


No 265
>KOG4727|consensus
Probab=28.85  E-value=46  Score=17.84  Aligned_cols=22  Identities=18%  Similarity=0.353  Sum_probs=19.0

Q ss_pred             ceecccccccccCHHHHHHHHH
Q psy4084          51 QFACHMCIKVFPSQDKLRMHML   72 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~   72 (86)
                      .|.|.+|.-++....++..|+.
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            4889999999999888888875


No 266
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=28.74  E-value=48  Score=12.69  Aligned_cols=10  Identities=30%  Similarity=0.936  Sum_probs=3.1

Q ss_pred             eecccccccc
Q psy4084          52 FACHMCIKVF   61 (86)
Q Consensus        52 ~~C~~C~~~~   61 (86)
                      |-|..|..-+
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            4566666655


No 267
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=28.70  E-value=34  Score=12.48  Aligned_cols=11  Identities=18%  Similarity=0.866  Sum_probs=7.0

Q ss_pred             ceecccccccc
Q psy4084          51 QFACHMCIKVF   61 (86)
Q Consensus        51 ~~~C~~C~~~~   61 (86)
                      -|+|..||-..
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            46777776543


No 268
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=28.66  E-value=50  Score=19.10  Aligned_cols=14  Identities=29%  Similarity=0.804  Sum_probs=9.4

Q ss_pred             Ccceeccccccccc
Q psy4084          49 DRQFACHMCIKVFP   62 (86)
Q Consensus        49 ~~~~~C~~C~~~~~   62 (86)
                      ...|.|+.|.-.|.
T Consensus       253 ~~GyvCs~Clsi~C  266 (279)
T TIGR00627       253 SIGFVCSVCLSVLC  266 (279)
T ss_pred             cceEECCCccCCcC
Confidence            44578888776654


No 269
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=28.62  E-value=22  Score=18.52  Aligned_cols=13  Identities=31%  Similarity=0.634  Sum_probs=8.8

Q ss_pred             CcchhhhccChHH
Q psy4084           1 MSECMGKFTEYQV   13 (86)
Q Consensus         1 c~~C~~~~~~~~~   13 (86)
                      |+.||..|+....
T Consensus        31 C~~C~~RFTTfE~   43 (156)
T COG1327          31 CLECGERFTTFER   43 (156)
T ss_pred             ccccccccchhhe
Confidence            6778877765543


No 270
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=28.55  E-value=31  Score=16.32  Aligned_cols=32  Identities=22%  Similarity=0.453  Sum_probs=20.1

Q ss_pred             CceecccccccCCChHHHhhhhhCCcceecccccccccC
Q psy4084          25 RQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPS   63 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~   63 (86)
                      ..|.|+.|++.--.     +  ...-.|.|..|++.|+-
T Consensus        34 a~y~CpfCgk~~vk-----R--~a~GIW~C~~C~~~~AG   65 (91)
T TIGR00280        34 AKYVCPFCGKKTVK-----R--GSTGIWTCRKCGAKFAG   65 (91)
T ss_pred             cCccCCCCCCCceE-----E--EeeEEEEcCCCCCEEeC
Confidence            45899999743110     0  01235899999998753


No 271
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=28.42  E-value=29  Score=19.49  Aligned_cols=17  Identities=18%  Similarity=0.411  Sum_probs=13.2

Q ss_pred             CCceecccccccCCChH
Q psy4084          24 DRQFACHMCIKVFPSQD   40 (86)
Q Consensus        24 ~~~~~c~~c~~~~~~~~   40 (86)
                      .++.+|+.||..|....
T Consensus       179 GkpqRCpECGqVFKLVr  195 (268)
T PTZ00043        179 GFLYRCGECDQIFMLVR  195 (268)
T ss_pred             CCCccCCCCCcEEEEEE
Confidence            45789999999887643


No 272
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=28.29  E-value=36  Score=12.40  Aligned_cols=11  Identities=18%  Similarity=0.839  Sum_probs=7.3

Q ss_pred             ceecccccccc
Q psy4084          51 QFACHMCIKVF   61 (86)
Q Consensus        51 ~~~C~~C~~~~   61 (86)
                      -|+|..||-..
T Consensus         7 ~ykC~~Cgniv   17 (34)
T TIGR00319         7 VYKCEVCGNIV   17 (34)
T ss_pred             EEEcCCCCcEE
Confidence            47787777553


No 273
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=28.27  E-value=30  Score=13.26  Aligned_cols=11  Identities=18%  Similarity=0.601  Sum_probs=7.6

Q ss_pred             ceecccccccc
Q psy4084          51 QFACHMCIKVF   61 (86)
Q Consensus        51 ~~~C~~C~~~~   61 (86)
                      -|.|..|+..|
T Consensus        28 fy~C~~C~~~w   38 (39)
T PF01096_consen   28 FYVCCNCGHRW   38 (39)
T ss_dssp             EEEESSSTEEE
T ss_pred             EEEeCCCCCee
Confidence            36788887654


No 274
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=27.71  E-value=10  Score=16.72  Aligned_cols=12  Identities=25%  Similarity=0.606  Sum_probs=4.9

Q ss_pred             ceeccccccccc
Q psy4084          51 QFACHMCIKVFP   62 (86)
Q Consensus        51 ~~~C~~C~~~~~   62 (86)
                      ...|..|+....
T Consensus        41 ~v~Cg~C~~~~~   52 (71)
T PF05495_consen   41 RVICGKCRTEQP   52 (71)
T ss_dssp             EEEETTT--EEE
T ss_pred             CeECCCCCCccC
Confidence            445555554443


No 275
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=27.62  E-value=28  Score=14.47  Aligned_cols=16  Identities=19%  Similarity=0.706  Sum_probs=9.7

Q ss_pred             CcceecccccccccCH
Q psy4084          49 DRQFACHMCIKVFPSQ   64 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~   64 (86)
                      ...+.|.+|++.+...
T Consensus        33 ~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   33 PIKLRCHYCERIITED   48 (52)
T ss_dssp             TCEEEETTT--EEEHH
T ss_pred             CCEEEeeCCCCEeccc
Confidence            3468899998876544


No 276
>PRK11827 hypothetical protein; Provisional
Probab=27.35  E-value=54  Score=14.18  Aligned_cols=16  Identities=25%  Similarity=0.571  Sum_probs=9.9

Q ss_pred             ceecccccccccCHHH
Q psy4084          51 QFACHMCIKVFPSQDK   66 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~   66 (86)
                      .+.|..|+..|+=...
T Consensus        26 ~Lic~~~~laYPI~dg   41 (60)
T PRK11827         26 ELICKLDNLAFPLRDG   41 (60)
T ss_pred             eEECCccCeeccccCC
Confidence            4667777777764433


No 277
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=27.19  E-value=35  Score=13.56  Aligned_cols=13  Identities=31%  Similarity=0.621  Sum_probs=9.2

Q ss_pred             ceecccccccccC
Q psy4084          51 QFACHMCIKVFPS   63 (86)
Q Consensus        51 ~~~C~~C~~~~~~   63 (86)
                      .+.|+.||..+.-
T Consensus        20 ~~vC~~Cg~~~~~   32 (52)
T smart00661       20 RFVCRKCGYEEPI   32 (52)
T ss_pred             EEECCcCCCeEEC
Confidence            5778888876543


No 278
>KOG1088|consensus
Probab=26.85  E-value=38  Score=16.88  Aligned_cols=19  Identities=21%  Similarity=0.347  Sum_probs=12.4

Q ss_pred             HhCCCceecccccccCCCh
Q psy4084          21 FHSDRQFACHMCIKVFPSQ   39 (86)
Q Consensus        21 ~~~~~~~~c~~c~~~~~~~   39 (86)
                      +..+...+|+.||..|.-.
T Consensus        93 ~v~EG~l~CpetG~vfpI~  111 (124)
T KOG1088|consen   93 DVIEGELVCPETGRVFPIS  111 (124)
T ss_pred             hhccceEecCCCCcEeecc
Confidence            3346667788887776544


No 279
>COG4640 Predicted membrane protein [Function unknown]
Probab=26.76  E-value=47  Score=20.45  Aligned_cols=20  Identities=20%  Similarity=0.401  Sum_probs=11.8

Q ss_pred             CceecccccccCCChHHHhh
Q psy4084          25 RQFACHMCIKVFPSQDKLRM   44 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~   44 (86)
                      ....|..||..+....+...
T Consensus        14 d~~qC~qCG~~~t~~~sqan   33 (465)
T COG4640          14 DDVQCTQCGHKFTSRQSQAN   33 (465)
T ss_pred             ccccccccCCcCCchhhhhh
Confidence            33447777777666555443


No 280
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=26.74  E-value=21  Score=14.86  Aligned_cols=10  Identities=20%  Similarity=0.786  Sum_probs=6.1

Q ss_pred             ceeccccccc
Q psy4084          51 QFACHMCIKV   60 (86)
Q Consensus        51 ~~~C~~C~~~   60 (86)
                      ..+|+.|+..
T Consensus        24 eIKCpRC~ti   33 (51)
T PF10122_consen   24 EIKCPRCKTI   33 (51)
T ss_pred             EEECCCCCcc
Confidence            4567777654


No 281
>cd00122 MBD MeCP2, MBD1, MBD2, MBD3, MBD4, CLLD8-like, and BAZ2A-like proteins constitute a family of proteins that share the methyl-CpG-binding domain (MBD). The MBD consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1. The MBDs present in putative chromatin remodelling subunit, BAZ2A, and putative histone methyltransferase, CLLD8, represent two phylogenetically distinct groups within the MBD protein family.
Probab=26.72  E-value=60  Score=13.78  Aligned_cols=18  Identities=11%  Similarity=0.224  Sum_probs=13.5

Q ss_pred             hhhhccChHHHHhhHHHH
Q psy4084           4 CMGKFTEYQVIRKHIRTF   21 (86)
Q Consensus         4 C~~~~~~~~~l~~h~~~~   21 (86)
                      ||+.|.+...+.+++..+
T Consensus        33 ~Gk~~Rs~~ev~~yL~~~   50 (62)
T cd00122          33 CGKKLRSKPEVARYLEKT   50 (62)
T ss_pred             CCceecCHHHHHHHHHhC
Confidence            677888888887776654


No 282
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=26.11  E-value=27  Score=12.24  Aligned_cols=6  Identities=33%  Similarity=0.634  Sum_probs=2.4

Q ss_pred             CCCCcC
Q psy4084          80 LKSKLC   85 (86)
Q Consensus        80 ~~c~~C   85 (86)
                      |.|..|
T Consensus         5 W~C~~C   10 (30)
T PF00641_consen    5 WKCPSC   10 (30)
T ss_dssp             EEETTT
T ss_pred             ccCCCC
Confidence            444433


No 283
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.10  E-value=37  Score=14.92  Aligned_cols=12  Identities=25%  Similarity=0.379  Sum_probs=8.9

Q ss_pred             eecccccccccC
Q psy4084          52 FACHMCIKVFPS   63 (86)
Q Consensus        52 ~~C~~C~~~~~~   63 (86)
                      .+|+.||+...+
T Consensus         8 v~CP~Cgkpv~w   19 (65)
T COG3024           8 VPCPTCGKPVVW   19 (65)
T ss_pred             ccCCCCCCcccc
Confidence            578888887655


No 284
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=26.06  E-value=94  Score=17.88  Aligned_cols=15  Identities=20%  Similarity=0.459  Sum_probs=9.3

Q ss_pred             ceecccccccccCHH
Q psy4084          51 QFACHMCIKVFPSQD   65 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~   65 (86)
                      ...|..|+..+....
T Consensus       137 ~~~C~~C~~~~~~~~  151 (271)
T PTZ00409        137 EARCCTCRKTIQLNK  151 (271)
T ss_pred             cceeCCCCCCcccCH
Confidence            356777877665443


No 285
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=26.03  E-value=34  Score=14.71  Aligned_cols=7  Identities=14%  Similarity=0.187  Sum_probs=2.9

Q ss_pred             Ccchhhh
Q psy4084           1 MSECMGK    7 (86)
Q Consensus         1 c~~C~~~    7 (86)
                      |+.||+.
T Consensus         6 C~~CG~~   12 (59)
T PF09889_consen    6 CPVCGKP   12 (59)
T ss_pred             CCcCCCc
Confidence            3444433


No 286
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=25.60  E-value=39  Score=12.38  Aligned_cols=6  Identities=33%  Similarity=1.093  Sum_probs=2.5

Q ss_pred             CCCCcC
Q psy4084          80 LKSKLC   85 (86)
Q Consensus        80 ~~c~~C   85 (86)
                      ++|..|
T Consensus        20 vrCs~C   25 (31)
T TIGR01053        20 VRCALC   25 (31)
T ss_pred             EECCCC
Confidence            444443


No 287
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=25.51  E-value=94  Score=17.11  Aligned_cols=14  Identities=14%  Similarity=0.292  Sum_probs=8.7

Q ss_pred             ceecccccccccCH
Q psy4084          51 QFACHMCIKVFPSQ   64 (86)
Q Consensus        51 ~~~C~~C~~~~~~~   64 (86)
                      ...|..|+..+...
T Consensus       113 ~~~C~~C~~~~~~~  126 (222)
T cd01413         113 TAYCVNCGSKYDLE  126 (222)
T ss_pred             cceECCCCCCcchh
Confidence            35677777766544


No 288
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=25.45  E-value=58  Score=17.20  Aligned_cols=19  Identities=21%  Similarity=0.553  Sum_probs=14.3

Q ss_pred             cceecccccccccCHHHHH
Q psy4084          50 RQFACHMCIKVFPSQDKLR   68 (86)
Q Consensus        50 ~~~~C~~C~~~~~~~~~l~   68 (86)
                      .++.|..||+.|.....+.
T Consensus       113 ~~~~C~~CG~~f~~~~~i~  131 (180)
T PRK12387        113 ALCNCRVCGRPFAVQKEID  131 (180)
T ss_pred             CcccchhhCCccccHHHHH
Confidence            4578999999998665443


No 289
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=25.44  E-value=30  Score=16.09  Aligned_cols=8  Identities=13%  Similarity=0.380  Sum_probs=3.8

Q ss_pred             Ccchhhhc
Q psy4084           1 MSECMGKF    8 (86)
Q Consensus         1 c~~C~~~~    8 (86)
                      |+.||..|
T Consensus        11 C~~CG~d~   18 (86)
T PF06170_consen   11 CPHCGLDY   18 (86)
T ss_pred             ccccCCcc
Confidence            44555444


No 290
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=25.31  E-value=39  Score=15.98  Aligned_cols=32  Identities=16%  Similarity=0.405  Sum_probs=19.8

Q ss_pred             CceecccccccCCChHHHhhhhhCCcceecccccccccC
Q psy4084          25 RQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVFPS   63 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~~~   63 (86)
                      ..|.|+.|++.--...       ..-.|.|..|++.|+-
T Consensus        35 a~y~CpfCgk~~vkR~-------a~GIW~C~~C~~~~AG   66 (90)
T PRK03976         35 AKHVCPVCGRPKVKRV-------GTGIWECRKCGAKFAG   66 (90)
T ss_pred             cCccCCCCCCCceEEE-------EEEEEEcCCCCCEEeC
Confidence            3588999964311100       1235899999988754


No 291
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=25.06  E-value=27  Score=18.09  Aligned_cols=14  Identities=29%  Similarity=0.622  Sum_probs=9.5

Q ss_pred             CcchhhhccChHHH
Q psy4084           1 MSECMGKFTEYQVI   14 (86)
Q Consensus         1 c~~C~~~~~~~~~l   14 (86)
                      |..||+.|+....+
T Consensus        31 C~~C~~RFTTyErv   44 (147)
T TIGR00244        31 CLECHERFTTFERA   44 (147)
T ss_pred             CCccCCccceeeec
Confidence            66788888766543


No 292
>smart00391 MBD Methyl-CpG binding domain. Methyl-CpG binding domain, also known as the TAM (TTF-IIP5, ARBP, MeCP1) domain
Probab=24.87  E-value=59  Score=14.69  Aligned_cols=19  Identities=11%  Similarity=0.177  Sum_probs=14.4

Q ss_pred             hhhhccChHHHHhhHHHHh
Q psy4084           4 CMGKFTEYQVIRKHIRTFH   22 (86)
Q Consensus         4 C~~~~~~~~~l~~h~~~~~   22 (86)
                      ||+.+.+...+..++..+.
T Consensus        36 ~GkklRs~~ev~~YL~~~~   54 (77)
T smart00391       36 CGKKLRSKSELARYLHKNG   54 (77)
T ss_pred             CCCeeeCHHHHHHHHHhCC
Confidence            7888888888888876543


No 293
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=24.78  E-value=8.4  Score=18.83  Aligned_cols=12  Identities=17%  Similarity=0.479  Sum_probs=9.6

Q ss_pred             ceeccccccccc
Q psy4084          51 QFACHMCIKVFP   62 (86)
Q Consensus        51 ~~~C~~C~~~~~   62 (86)
                      =|.|..||..|.
T Consensus       100 Fy~C~~Cg~~wr  111 (113)
T COG1594         100 FYKCTRCGYRWR  111 (113)
T ss_pred             EEEecccCCEee
Confidence            378999998764


No 294
>PF04988 AKAP95:  A-kinase anchoring protein 95 (AKAP95);  InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=24.20  E-value=65  Score=17.12  Aligned_cols=22  Identities=23%  Similarity=0.489  Sum_probs=16.5

Q ss_pred             eecccccccccCHHHHHHHHHh
Q psy4084          52 FACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        52 ~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      |.|..|.........+..|+.+
T Consensus         1 F~Cs~CKfrtf~~~ei~~HleS   22 (165)
T PF04988_consen    1 FTCSFCKFRTFEEKEIEKHLES   22 (165)
T ss_pred             CccceeeeecccHHHHHHHHcc
Confidence            4577888777777788888764


No 295
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=23.60  E-value=31  Score=13.23  Aligned_cols=9  Identities=11%  Similarity=-0.027  Sum_probs=1.9

Q ss_pred             Ccchhhhcc
Q psy4084           1 MSECMGKFT    9 (86)
Q Consensus         1 c~~C~~~~~    9 (86)
                      |..|++.+.
T Consensus         1 C~~C~~~~~    9 (47)
T PF01844_consen    1 CQYCGKPGS    9 (47)
T ss_dssp             -TTT--B--
T ss_pred             CCCCCCcCc
Confidence            344444443


No 296
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=23.58  E-value=21  Score=18.39  Aligned_cols=12  Identities=25%  Similarity=0.694  Sum_probs=7.3

Q ss_pred             cceecccccccc
Q psy4084          50 RQFACHMCIKVF   61 (86)
Q Consensus        50 ~~~~C~~C~~~~   61 (86)
                      ..|.|+.|+...
T Consensus        50 ~~~~C~~C~~~~   61 (166)
T cd04476          50 GTYRCEKCNKSV   61 (166)
T ss_pred             CcEECCCCCCcC
Confidence            346677776653


No 297
>KOG4118|consensus
Probab=23.49  E-value=49  Score=14.62  Aligned_cols=29  Identities=14%  Similarity=0.416  Sum_probs=20.1

Q ss_pred             ceecccccccccCHHHHHHHHHhCCCCcc
Q psy4084          51 QFACHMCIKVFPSQDKLRMHMLSGLQTFD   79 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~l~~h~~~~~~~~~   79 (86)
                      .+.|.+|--..+....+..|...-+...+
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHpk~~   66 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHPKEP   66 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCCCCC
Confidence            36788887777777778888776544333


No 298
>KOG0801|consensus
Probab=23.39  E-value=18  Score=19.13  Aligned_cols=17  Identities=24%  Similarity=0.620  Sum_probs=9.4

Q ss_pred             HHHHHHhCCCCccCCCCcCC
Q psy4084          67 LRMHMLSGLQTFDLKSKLCT   86 (86)
Q Consensus        67 l~~h~~~~~~~~~~~c~~C~   86 (86)
                      |..|+-.|.   .++|+.|+
T Consensus       129 lP~hi~~~~---g~KCPvC~  145 (205)
T KOG0801|consen  129 LPVHIMDHS---GMKCPVCH  145 (205)
T ss_pred             cceeeeccC---CccCCccc
Confidence            344444443   37888774


No 299
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=22.80  E-value=29  Score=15.47  Aligned_cols=7  Identities=43%  Similarity=1.089  Sum_probs=3.0

Q ss_pred             eccccccc
Q psy4084          53 ACHMCIKV   60 (86)
Q Consensus        53 ~C~~C~~~   60 (86)
                      .| .||+.
T Consensus        22 kC-~CG~~   28 (68)
T PF09082_consen   22 KC-VCGKT   28 (68)
T ss_dssp             EE-TTTEE
T ss_pred             Ee-cCCCe
Confidence            44 44443


No 300
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]
Probab=22.68  E-value=54  Score=19.82  Aligned_cols=25  Identities=32%  Similarity=0.615  Sum_probs=21.8

Q ss_pred             CcceecccccccccCHHHHHHHHHh
Q psy4084          49 DRQFACHMCIKVFPSQDKLRMHMLS   73 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~~~~l~~h~~~   73 (86)
                      ...|.|..|-+-+.+...|.+|...
T Consensus       156 d~vyICefClkY~~s~~~~~rH~~k  180 (395)
T COG5027         156 DIVYICEFCLKYYGSQTSLVRHRKK  180 (395)
T ss_pred             ceEEEhhhhHHHhcchhHHHHHHhc
Confidence            4568999999999999999999875


No 301
>KOG1940|consensus
Probab=22.60  E-value=1.3e+02  Score=17.62  Aligned_cols=8  Identities=38%  Similarity=1.310  Sum_probs=6.3

Q ss_pred             eecccccc
Q psy4084          27 FACHMCIK   34 (86)
Q Consensus        27 ~~c~~c~~   34 (86)
                      |.|++|.+
T Consensus       197 y~CP~C~~  204 (276)
T KOG1940|consen  197 YTCPICSK  204 (276)
T ss_pred             CCCCcccc
Confidence            78888776


No 302
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=22.29  E-value=1.3e+02  Score=16.47  Aligned_cols=6  Identities=33%  Similarity=0.949  Sum_probs=2.5

Q ss_pred             cccccc
Q psy4084          29 CHMCIK   34 (86)
Q Consensus        29 c~~c~~   34 (86)
                      |..|+.
T Consensus        98 C~~C~~  103 (206)
T cd01410          98 CKSCGP  103 (206)
T ss_pred             CCCCCC
Confidence            444443


No 303
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=22.24  E-value=52  Score=14.00  Aligned_cols=15  Identities=27%  Similarity=0.536  Sum_probs=9.9

Q ss_pred             CcceecccccccccC
Q psy4084          49 DRQFACHMCIKVFPS   63 (86)
Q Consensus        49 ~~~~~C~~C~~~~~~   63 (86)
                      ++--.|+.|+..|..
T Consensus        37 ~rYngCPfC~~~~~~   51 (55)
T PF14447_consen   37 ERYNGCPFCGTPFEF   51 (55)
T ss_pred             hhccCCCCCCCcccC
Confidence            344468888887754


No 304
>KOG2923|consensus
Probab=22.05  E-value=93  Score=13.73  Aligned_cols=10  Identities=20%  Similarity=0.557  Sum_probs=5.3

Q ss_pred             Ccceeccccc
Q psy4084          49 DRQFACHMCI   58 (86)
Q Consensus        49 ~~~~~C~~C~   58 (86)
                      +....|+.|.
T Consensus        42 e~Va~CpsCS   51 (67)
T KOG2923|consen   42 EDVARCPSCS   51 (67)
T ss_pred             CeeecCCCce
Confidence            3445566654


No 305
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=22.01  E-value=24  Score=19.29  Aligned_cols=14  Identities=14%  Similarity=0.135  Sum_probs=9.1

Q ss_pred             cceecccccccccC
Q psy4084          50 RQFACHMCIKVFPS   63 (86)
Q Consensus        50 ~~~~C~~C~~~~~~   63 (86)
                      ..+.|..||+.+..
T Consensus        42 ~t~~C~~CgYR~~D   55 (201)
T COG1779          42 STGVCERCGYRSTD   55 (201)
T ss_pred             EEEEccccCCcccc
Confidence            44677788876544


No 306
>KOG0402|consensus
Probab=21.96  E-value=51  Score=15.35  Aligned_cols=23  Identities=22%  Similarity=0.449  Sum_probs=13.8

Q ss_pred             ChHHHhhhhhC-----Ccceeccccccc
Q psy4084          38 SQDKLRMHMLS-----DRQFACHMCIKV   60 (86)
Q Consensus        38 ~~~~l~~h~~~-----~~~~~C~~C~~~   60 (86)
                      ..++|+.-+..     ...|.|+.||+.
T Consensus        18 YGaSLrk~vKkiei~Qhaky~CsfCGK~   45 (92)
T KOG0402|consen   18 YGASLRKMVKKIEIQQHAKYTCSFCGKK   45 (92)
T ss_pred             hhHHHHHHHHHHHHHHhhhhhhhhcchh
Confidence            34555544432     345888888875


No 307
>PF14149 YhfH:  YhfH-like protein
Probab=21.49  E-value=29  Score=13.43  Aligned_cols=7  Identities=29%  Similarity=0.586  Sum_probs=3.3

Q ss_pred             Ccchhhh
Q psy4084           1 MSECMGK    7 (86)
Q Consensus         1 c~~C~~~    7 (86)
                      |+.||+.
T Consensus        16 C~~CG~~   22 (37)
T PF14149_consen   16 CTECGKE   22 (37)
T ss_pred             cHHHHHH
Confidence            4455543


No 308
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=21.29  E-value=32  Score=18.79  Aligned_cols=14  Identities=14%  Similarity=0.237  Sum_probs=0.0

Q ss_pred             hCCCCccCCCCcCC
Q psy4084          73 SGLQTFDLKSKLCT   86 (86)
Q Consensus        73 ~~~~~~~~~c~~C~   86 (86)
                      .|--...|+|.+|+
T Consensus        95 LhGL~~ey~CEICG  108 (196)
T PF11931_consen   95 LHGLGVEYKCEICG  108 (196)
T ss_dssp             --------------
T ss_pred             HhCCCCeeeeEeCC
Confidence            34445567777775


No 309
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=21.27  E-value=1.3e+02  Score=16.93  Aligned_cols=16  Identities=25%  Similarity=0.615  Sum_probs=9.8

Q ss_pred             ceecccccccccCHHH
Q psy4084          51 QFACHMCIKVFPSQDK   66 (86)
Q Consensus        51 ~~~C~~C~~~~~~~~~   66 (86)
                      ...|..|++.+.....
T Consensus       119 ~~~C~~C~~~~~~~~~  134 (244)
T PRK14138        119 EYYCVRCGKRYTVEDV  134 (244)
T ss_pred             eeEECCCCCcccHHHH
Confidence            3567777777655433


No 310
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=21.09  E-value=46  Score=11.79  Aligned_cols=10  Identities=40%  Similarity=0.896  Sum_probs=5.4

Q ss_pred             eecccccccc
Q psy4084          52 FACHMCIKVF   61 (86)
Q Consensus        52 ~~C~~C~~~~   61 (86)
                      |.|..|+..+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            4555565543


No 311
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=21.05  E-value=53  Score=13.66  Aligned_cols=8  Identities=25%  Similarity=0.812  Sum_probs=4.8

Q ss_pred             eccccccc
Q psy4084          53 ACHMCIKV   60 (86)
Q Consensus        53 ~C~~C~~~   60 (86)
                      .|+.||..
T Consensus         5 PCPFCG~~   12 (61)
T PF14354_consen    5 PCPFCGSA   12 (61)
T ss_pred             CCCCCCCc
Confidence            56667644


No 312
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=20.95  E-value=39  Score=15.70  Aligned_cols=6  Identities=33%  Similarity=0.368  Sum_probs=2.3

Q ss_pred             cchhhh
Q psy4084           2 SECMGK    7 (86)
Q Consensus         2 ~~C~~~    7 (86)
                      +.|++.
T Consensus        82 ~vC~k~   87 (109)
T PF10367_consen   82 SVCGKP   87 (109)
T ss_pred             cCcCCc
Confidence            334433


No 313
>PRK11032 hypothetical protein; Provisional
Probab=20.84  E-value=47  Score=17.52  Aligned_cols=30  Identities=13%  Similarity=0.264  Sum_probs=17.6

Q ss_pred             CceecccccccCCChHHHhhhhhCCcceecccccccc
Q psy4084          25 RQFACHMCIKVFPSQDKLRMHMLSDRQFACHMCIKVF   61 (86)
Q Consensus        25 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~C~~C~~~~   61 (86)
                      ..+.|..|+.......       +..--.|+.|+...
T Consensus       123 G~LvC~~Cg~~~~~~~-------p~~i~pCp~C~~~~  152 (160)
T PRK11032        123 GNLVCEKCHHHLAFYT-------PEVLPLCPKCGHDQ  152 (160)
T ss_pred             ceEEecCCCCEEEecC-------CCcCCCCCCCCCCe
Confidence            4588998985532111       13334788888663


No 314
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=20.75  E-value=59  Score=14.21  Aligned_cols=11  Identities=27%  Similarity=0.549  Sum_probs=7.7

Q ss_pred             ceecccccccc
Q psy4084          51 QFACHMCIKVF   61 (86)
Q Consensus        51 ~~~C~~C~~~~   61 (86)
                      ...|+.|++..
T Consensus         6 ~v~CP~C~k~~   16 (62)
T PRK00418          6 TVNCPTCGKPV   16 (62)
T ss_pred             cccCCCCCCcc
Confidence            35688888764


No 315
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=20.65  E-value=93  Score=17.74  Aligned_cols=11  Identities=18%  Similarity=0.537  Sum_probs=5.2

Q ss_pred             eeccccccccc
Q psy4084          52 FACHMCIKVFP   62 (86)
Q Consensus        52 ~~C~~C~~~~~   62 (86)
                      +.|..|+..+.
T Consensus       123 ~~C~~C~~~~~  133 (250)
T COG0846         123 VRCSKCGNQYY  133 (250)
T ss_pred             eEeCCCcCccc
Confidence            44555544443


No 316
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=20.39  E-value=56  Score=16.17  Aligned_cols=13  Identities=31%  Similarity=0.391  Sum_probs=9.8

Q ss_pred             Ccceecccccccc
Q psy4084          49 DRQFACHMCIKVF   61 (86)
Q Consensus        49 ~~~~~C~~C~~~~   61 (86)
                      .....|+.|++..
T Consensus        67 av~V~CP~C~K~T   79 (114)
T PF11023_consen   67 AVQVECPNCGKQT   79 (114)
T ss_pred             ceeeECCCCCChH
Confidence            3567899998875


No 317
>KOG3352|consensus
Probab=20.22  E-value=43  Score=17.49  Aligned_cols=14  Identities=21%  Similarity=0.392  Sum_probs=8.7

Q ss_pred             CceecccccccCCC
Q psy4084          25 RQFACHMCIKVFPS   38 (86)
Q Consensus        25 ~~~~c~~c~~~~~~   38 (86)
                      +.++|+.||..|..
T Consensus       132 e~~rc~eCG~~fkL  145 (153)
T KOG3352|consen  132 ETQRCPECGHYFKL  145 (153)
T ss_pred             CcccCCcccceEEe
Confidence            34567777766643


No 318
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=20.11  E-value=58  Score=11.40  Aligned_cols=11  Identities=18%  Similarity=0.338  Sum_probs=4.4

Q ss_pred             cceeccccccc
Q psy4084          50 RQFACHMCIKV   60 (86)
Q Consensus        50 ~~~~C~~C~~~   60 (86)
                      ..|.|..|+..
T Consensus        14 ~~Y~C~~Cdf~   24 (30)
T PF07649_consen   14 WFYRCSECDFD   24 (30)
T ss_dssp             -EEE-TTT---
T ss_pred             ceEECccCCCc
Confidence            45777777654


No 319
>KOG4602|consensus
Probab=20.04  E-value=48  Score=19.07  Aligned_cols=11  Identities=27%  Similarity=0.896  Sum_probs=7.2

Q ss_pred             cceeccccccc
Q psy4084          50 RQFACHMCIKV   60 (86)
Q Consensus        50 ~~~~C~~C~~~   60 (86)
                      +.|.|++||-+
T Consensus       267 R~YVCPiCGAT  277 (318)
T KOG4602|consen  267 RSYVCPICGAT  277 (318)
T ss_pred             hhhcCcccccc
Confidence            45777777754


Done!