Diaphorina citri psyllid: psy4086


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MTMQLYHRVSNATSPANTHSSSSSNTGSQNGGTHPITTNNVQHNGSPGTPTGPEQLSKTNLYIRGLTQDTTDKDLINMCSQYGPIISTKAILDKTTNKCRGYGFVDFESGGYALAAVKALQDKGIHAQMARQQEQDPTNLYIANLPLNFKECDLESLLAKYVTVVSTRILRDNNNTSKGVGFARLESKDKCDQMIQLFNGSTLPGSKEPLLVKFADSGLKKRGAGAGGPNIYRGPGAEVRLWGRDSADSQLAYEHPMTPIPATIQYQRFTAGPGGTGHIPAGYTPWVPTQYVMPAPHMSQVEVLK
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEEccccccccEEEEEcccHHHHHHHHHHHHccccEEEEcccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcccccccCEEEEEcccHHHHHHHHHHHcccccccccccEEEEEccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***********************************************************NLYIRGLTQDTTDKDLINMCSQYGPIISTKAILDKTTNKCRGYGFVDFESGGYALAAVKALQDKGIHA**********TNLYIANLPLNFKECDLESLLAKYVTVVSTRILRDNNNTSKGVGFARLESKDKCDQMIQLFNGSTLPGSKEPLLVKFA**************NIYRGPGAEVRLWGRDSADSQLAYEHPMTPIPATIQYQRFTAGPGGTGHIPAGYTPWVPTQYVM************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTMQLYHRVSNATSPANTHSSSSSNTGSQNGGTHPITTNNVQHNGSPGTPTGPEQLSKTNLYIRGLTQDTTDKDLINMCSQYGPIISTKAILDKTTNKCRGYGFVDFESGGYALAAVKALQDKGIHAQMARQQEQDPTNLYIANLPLNFKECDLESLLAKYVTVVSTRILRDNNNTSKGVGFARLESKDKCDQMIQLFNGSTLPGSKEPLLVKFADSGLKKRGAGAGGPNIYRGPGAEVRLWGRDSADSQLAYEHPMTPIPATIQYQRFTAGPGGTGHIPAGYTPWVPTQYVMPAPHMSQVEVLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA-binding motif, single-stranded-interacting protein 1 Single-stranded DNA binding protein that interacts with the region upstream of the MYC gene. Binds specifically to the DNA sequence motif 5'-[AT]CT[AT][AT]T-3'. Probably has a role in DNA replication.confidentQ5PQP1
RNA-binding motif, single-stranded-interacting protein 1 Single-stranded DNA binding protein that interacts with the region upstream of the C-myc gene. Binds specifically to the DNA sequence motif 5'-[AT]CT[AT][AT]T-3'. Probably has a role in DNA replication.confidentQ3ZBP3
Protein alan shepard Has a role in the perception of gravity.confidentQ8MSV2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008187 [MF]poly-pyrimidine tract bindingprobableGO:0097159, GO:0003727, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0003730 [MF]mRNA 3'-UTR bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003729, GO:1901363, GO:0003723
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0017091 [MF]AU-rich element bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 58-221
View the alignment between query and template
View the model in PyMOL