BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy4109
(77 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3BA6|A Chain A, Structure Of The Ca2e1p Phosphoenzyme Intermediate Of The
Serca Ca2+-Atpase
Length = 994
Score = 32.0 bits (71), Expect = 0.090, Method: Composition-based stats.
Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 4/48 (8%)
Query: 17 EGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYK 64
EG+++ +D P R+G FDG + ++ + LCN N K +Y+
Sbjct: 392 EGEVLKND----KPIRSGQFDGLVELATICALCNDSSLDFNETKGVYE 435
>pdb|2DQS|A Chain A, Crystal Structure Of The Calcium Pump With Amppcp In The
Absence Of Calcium
pdb|2EAR|A Chain A, P21 Crystal Of The Sr Ca2+-Atpase With Bound Tg
pdb|2EAT|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase With Bound Cpa And
Tg
pdb|2ZBF|A Chain A, Calcium Pump Crystal Structure With Bound Bef3 And Tg In
The Absence Of Calcium
pdb|2ZBG|A Chain A, Calcium Pump Crystal Structure With Bound Alf4 And Tg In
The Absence Of Calcium
pdb|3AR2|A Chain A, Calcium Pump Crystal Structure With Bound Amppcp And Ca2+
pdb|3AR3|A Chain A, Calcium Pump Crystal Structure With Bound Adp And Tg
pdb|3AR4|A Chain A, Calcium Pump Crystal Structure With Bound Atp And Tg In
The Absence Of Ca2+
pdb|3AR5|A Chain A, Calcium Pump Crystal Structure With Bound Tnp-Amp And Tg
pdb|3AR6|A Chain A, Calcium Pump Crystal Structure With Bound Tnp-Adp And Tg
In The Absence Of Calcium
pdb|3AR7|A Chain A, Calcium Pump Crystal Structure With Bound Tnp-Atp And Tg
In The Absence Of Ca2+
pdb|3AR8|A Chain A, Calcium Pump Crystal Structure With Bound Alf4, Tnp-Amp
And Tg
pdb|3AR9|A Chain A, Calcium Pump Crystal Structure With Bound Bef3, Tnp-Amp
And Tg In The Absence Of Calcium
pdb|2ZBE|A Chain A, Calcium Pump Crystal Structure With Bound Bef3 In The
Absence Of Calcium And Tg
pdb|2ZBE|B Chain B, Calcium Pump Crystal Structure With Bound Bef3 In The
Absence Of Calcium And Tg
pdb|2ZBD|A Chain A, Crystal Structure Of The Sr Calcium Pump With Bound
Aluminium Fluoride, Adp And Calcium
Length = 995
Score = 32.0 bits (71), Expect = 0.090, Method: Composition-based stats.
Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 4/48 (8%)
Query: 17 EGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYK 64
EG+++ +D P R+G FDG + ++ + LCN N K +Y+
Sbjct: 393 EGEVLKND----KPIRSGQFDGLVELATICALCNDSSLDFNETKGVYE 436
>pdb|1KJU|A Chain A, Ca2+-Atpase In The E2 State
pdb|1IWO|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase In The Absence Of
Ca2+
pdb|1IWO|B Chain B, Crystal Structure Of The Sr Ca2+-Atpase In The Absence Of
Ca2+
pdb|1SU4|A Chain A, Crystal Structure Of Calcium Atpase With Two Bound Calcium
Ions
pdb|1T5S|A Chain A, Structure Of The (sr)ca2+-atpase Ca2-e1-amppcp Form
pdb|1T5T|A Chain A, Structure Of The (Sr)ca2+-Atpase Ca2-E1-Adp:alf4- Form
pdb|1VFP|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase With Bound Amppcp
pdb|1VFP|B Chain B, Crystal Structure Of The Sr Ca2+-Atpase With Bound Amppcp
pdb|1WPG|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase With Mgf4
pdb|1WPG|B Chain B, Crystal Structure Of The Sr Ca2+-Atpase With Mgf4
pdb|1WPG|C Chain C, Crystal Structure Of The Sr Ca2+-Atpase With Mgf4
pdb|1WPG|D Chain D, Crystal Structure Of The Sr Ca2+-Atpase With Mgf4
pdb|1XP5|A Chain A, Structure Of The (Sr)ca2+-Atpase E2-Alf4- Form
pdb|2AGV|A Chain A, Crystal Structure Of The Sr Ca2+-atpase With Bhq And Tg
pdb|2AGV|B Chain B, Crystal Structure Of The Sr Ca2+-atpase With Bhq And Tg
pdb|2BY4|A Chain A, Sr Ca(2+)-Atpase In The Hne2 State Complexed With The
Thapsigargin Derivative Boc-12adt.
pdb|2C88|A Chain A, Crystal Structure Of (Sr) Calcium-Atpase E2(Tg):amppcp
Form
pdb|2C8K|A Chain A, Crystal Structure Of (Sr) Calcium-Atpase E2(Tg) With
Partially Occupied Amppcp Site
pdb|2C8L|A Chain A, Crystal Structure Of (Sr) Calcium-Atpase E2(Tg) Form
pdb|2C9M|A Chain A, Structure Of (Sr) Calcium-Atpase In The Ca2e1 State Solved
In A P1 Crystal Form.
pdb|2C9M|B Chain B, Structure Of (Sr) Calcium-Atpase In The Ca2e1 State Solved
In A P1 Crystal Form.
pdb|2O9J|A Chain A, Crystal Structure Of Calcium Atpase With Bound Magnesium
Fluoride And Cyclopiazonic Acid
pdb|2OA0|A Chain A, Crystal Structure Of Calcium Atpase With Bound Adp And
Cyclopiazonic Acid
pdb|3B9B|A Chain A, Structure Of The E2 Beryllium Fluoride Complex Of The
Serca Ca2+-Atpase
pdb|3B9R|A Chain A, Serca Ca2+-Atpase E2 Aluminium Fluoride Complex Without
Thapsigargin
pdb|3B9R|B Chain B, Serca Ca2+-Atpase E2 Aluminium Fluoride Complex Without
Thapsigargin
pdb|2EAS|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase With Bound Cpa
pdb|2EAU|A Chain A, Crystal Structure Of The Sr Ca2+-Atpase With Bound Cpa In
The Presence Of Curcumin
pdb|3FGO|A Chain A, Crystal Structure Of The E2 Magnesium Fluoride Complex Of
The (Sr) Ca2+-Atpase With Bound Cpa And Amppcp
pdb|3FGO|B Chain B, Crystal Structure Of The E2 Magnesium Fluoride Complex Of
The (Sr) Ca2+-Atpase With Bound Cpa And Amppcp
pdb|3FPB|A Chain A, The Structure Of Sarcoplasmic Reticulum Ca2+-Atpase Bound
To Cyclopiazonic Acid With Atp
pdb|3FPS|A Chain A, The Structure Of Sarcoplasmic Reticulum Ca2+-Atpase Bound
To Cyclopiazonic And Adp
pdb|3NAL|A Chain A, Sr Ca(2+)-Atpase In The Hne2 State Complexed With The
Thapsigargin Derivative Dtb
pdb|3NAM|A Chain A, Sr Ca(2+)-Atpase In The Hne2 State Complexed With The
Thapsigargin Derivative Dotg
pdb|3NAN|A Chain A, Sr Ca(2+)-Atpase In The Hne2 State Complexed With A
Thapsigargin Derivative Boc-(Phi)tg
pdb|3N5K|A Chain A, Structure Of The (sr)ca2+-atpase E2-alf4- Form
pdb|3N5K|B Chain B, Structure Of The (sr)ca2+-atpase E2-alf4- Form
pdb|3N8G|A Chain A, Structure Of The (sr)ca2+-atpase Ca2-e1-caamppcp Form
pdb|2YFY|A Chain A, Serca In The Hne2 State Complexed With Debutanoyl
Thapsigargin
Length = 994
Score = 32.0 bits (71), Expect = 0.090, Method: Composition-based stats.
Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 4/48 (8%)
Query: 17 EGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYK 64
EG+++ +D P R+G FDG + ++ + LCN N K +Y+
Sbjct: 392 EGEVLKND----KPIRSGQFDGLVELATICALCNDSSLDFNETKGVYE 435
>pdb|3TLM|A Chain A, Crystal Structure Of Endoplasmic Reticulum Ca2+-Atpase
(Serca) From Bovine Muscle
Length = 992
Score = 30.8 bits (68), Expect = 0.22, Method: Composition-based stats.
Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 4/48 (8%)
Query: 17 EGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYK 64
EG+++ +D P R+G +DG + ++ + LCN N K +Y+
Sbjct: 392 EGEVLKND----KPVRSGQYDGLVELATICALCNDSSLDFNETKGIYE 435
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.136 0.429
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,299,680
Number of Sequences: 62578
Number of extensions: 73314
Number of successful extensions: 161
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 157
Number of HSP's gapped (non-prelim): 4
length of query: 77
length of database: 14,973,337
effective HSP length: 46
effective length of query: 31
effective length of database: 12,094,749
effective search space: 374937219
effective search space used: 374937219
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)