Diaphorina citri psyllid: psy4115


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MKSSKEKSMSQATTPDLNAMTCAKIFIQRDYTDGTMVRFQTHFPQELEGKIERQVYEYTINQMNVYFQEAESVSCKSYCEGCMACLTAYFVYLCAETHYEKCLKKVAKFIAEQNENVFLPRALMLVNPAERGLRVIEIAILDQPIVPRN
cccccccccccccccccccccccEEEEcccccccccEEEcccccHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccEEEEEEEEcccccccc
*******************MTCAKIFIQRDYTDGTMVRFQTHFPQELEGKIERQVYEYTINQMNVYFQEAESVSCKSYCEGCMACLTAYFVYLCAETHYEKCLKKVAKFIAEQNENVFLPRALMLVNPAERGLRVIEIAILDQP*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSSKEKSMSQATTPDLNAMTCAKIFIQRDYTDGTMVRFQTHFPQELEGKIERQVYEYTINQMNVYFQEAESVSCKSYCEGCMACLTAYFVYLCAETHYEKCLKKVAKFIAEQNENVFLPRALMLVNPAERGLRVIEIAILDQPIVPRN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Golgin subfamily A member 7B May be involved in protein transport from Golgi to cell surface.confidentQ2TAP0
Golgin subfamily A member 7B May be involved in protein transport from Golgi to cell surface.confidentQ9D428
Golgin subfamily A member 7 May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.confidentQ91W53

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006893 [BP]Golgi to plasma membrane transportprobableGO:0006892, GO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted