Diaphorina citri psyllid: psy4120

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MCDNNNAGGCKIDKEELKKRLTPMQYHVTQEKGTERYIGSNLLLLITNPDMVRTEVTCSKCDAHLGHVFNDGPAPTRRRFCINSASVDFVPDHPQ
cccccccccccccHHHHHHHccHHHHHHHcccccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccEEEcccccc
***************ELKKRLTPMQYHVTQEKGTERYIGSNLLLLITNPDMVRTEVTCSKCDAHLGHVFNDGPAPTRRRFCINSASV*FV*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCDNNNAGGCKIDKEELKKRLTPMQYHVTQEKGTERYIGSNLLLLITNPDMVRTEVTCSKCDAHLGHVFNDGPAPTRRRFCINSASVDFVPDHPQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide methionine sulfoxide reductase MsrB confidentQ4K8U5
Peptide methionine sulfoxide reductase MsrB confidentC3K735
Peptide methionine sulfoxide reductase MsrB confidentQ4ZQC6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005506 [MF]iron ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0033743 [MF]peptide-methionine (R)-S-oxide reductase activityprobableGO:0003824, GO:0016671, GO:0003674, GO:0016667, GO:0016491
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0030091 [BP]protein repairprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.8.-.-Acting on a sulfur group of donors.probable
1.8.4.-With a disulfide as acceptor.probable
1.8.4.12Peptide-methionine (R)-S-oxide reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K8D, chain A
Confidence level:very confident
Coverage over the Query: 9-93
View the alignment between query and template
View the model in PyMOL