Diaphorina citri psyllid: psy4131

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MSPSVTLSLFHSKHEPKMKYNTGGLTGWEQSYCSKIKLICLGIKLGSEVLSLLEATNVSVSTQGEDRLIRAHGQTLYEVFSLRQTGLKRIPDVVVWPVYITFGKYSEHSDTQISEKFDPAGNQTQISNVPIRRVNSILWLDEDNLVACIEAGIIGQDLERELNSRGYTSGHEPDSYEFSSLGGWVATRASGMKKNLYGNIEDLLVQVTMVTARGTLERPCRGPRVSSGPDFNHVILGSEAD
cccccccccccccccccccccccccccccccccccHHHHcccccccHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHccccccccccEEEccccccEEEEECcccCECcccccccccccEEEEEEcccccccEEECccccEEEEEccccHHHHHHHHHHcccccccccccccccccHHHHHHccccccccccccHHcEEEEEEEEcccCEEEcccccccccccccccccEEccccc
*********FHSKHEPKMKYNTGGLTGWEQSYCSKIKLICLGIKLGSEVLSLLEATNVSVSTQGEDRLIRAHGQTLYEVFSLRQTGLKRIPDVVVWPVYITFGKYSEHSDTQISEKFDPAGNQTQISNVPIRRVNSILWLDEDNLVACIEAGIIGQDLERELNSRGYTSGHEPDSYEFSSLGGWVATRASGMKKNLYGNIEDLLVQVTMVTARGTLERPCRGPRVSSGPDFNHVILGSEA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPSVTLSLFHSKHEPKMKYNTGGLTGWEQSYCSKIKLICLGIKLGSEVLSLLEATNVSVSTQGEDRLIRAHGQTLYEVFSLRQTGLKRIPDVVVWPVYITFGKYSEHSDTQISEKFDPAGNQTQISNVPIRRVNSILWLDEDNLVACIEAGIIGQDLERELNSRGYTSGHEPDSYEFSSLGGWVATRASGMKKNLYGNIEDLLVQVTMVTARGTLERPCRGPRVSSGPDFNHVILGSEAD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alkyldihydroxyacetonephosphate synthase confidentQ9V778

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003674 [MF]molecular_functionprobable
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4BBY, chain A
Confidence level:very confident
Coverage over the Query: 43-241
View the alignment between query and template
View the model in PyMOL