Query         psy414
Match_columns 176
No_of_seqs    120 out of 145
Neff          4.8 
Searched_HMMs 46136
Date          Fri Aug 16 17:55:35 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy414.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/414hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05821 NDUF_B8:  NADH-ubiquin 100.0 2.9E-70 6.3E-75  448.3  12.9  155   16-174    13-167 (179)
  2 KOG4040|consensus              100.0   4E-62 8.7E-67  393.8  11.3  152   21-175    23-175 (186)
  3 PF00446 GnRH:  Gonadotropin-re  76.4     1.4 3.1E-05   20.6   0.8    9   29-37      2-10  (10)
  4 PF05821 NDUF_B8:  NADH-ubiquin  68.6     8.3 0.00018   32.1   4.2   47  124-173   121-179 (179)
  5 PF05920 Homeobox_KN:  Homeobox  67.4     4.2   9E-05   25.8   1.7   20   37-57      8-27  (40)
  6 PF06392 Asr:  Acid shock prote  52.6     8.1 0.00017   21.1   0.9   12   41-52      8-19  (19)
  7 PF13807 GNVR:  G-rich domain o  44.1      31 0.00066   24.3   3.2   25  123-147    52-76  (82)
  8 PF06166 DUF979:  Protein of un  35.8      38 0.00082   30.7   3.1   25   32-56     67-92  (308)
  9 COG3817 Predicted membrane pro  30.0      49  0.0011   29.7   2.8   25   32-56     71-96  (313)
 10 smart00389 HOX Homeodomain. DN  29.7      59  0.0013   20.4   2.5   21   37-58     22-42  (56)
 11 PF14147 Spore_YhaL:  Sporulati  27.5      75  0.0016   21.7   2.7   21  125-145     1-21  (52)
 12 PF01102 Glycophorin_A:  Glycop  26.8      61  0.0013   25.4   2.6   17  129-145    65-81  (122)
 13 COG3765 WzzB Chain length dete  24.4      98  0.0021   28.5   3.8   43  103-147   289-334 (347)
 14 PF09098 Dehyd-heme_bind:  Quin  24.0      57  0.0012   27.1   2.0   23   40-62     50-76  (167)
 15 COG4957 Predicted transcriptio  23.7      27 0.00058   28.4   0.0   30   46-78     90-119 (148)
 16 PF08628 Nexin_C:  Sorting nexi  23.1 1.8E+02   0.004   21.4   4.5   23   30-52     52-75  (113)
 17 TIGR00669 asnA aspartate--ammo  23.0      61  0.0013   29.6   2.2   17   38-54    176-194 (330)
 18 PF15183 MRAP:  Melanocortin-2   22.8 2.2E+02  0.0047   21.4   4.7   38  108-149    27-64  (90)
 19 KOG4075|consensus               22.8      70  0.0015   26.6   2.3   10   96-105    82-91  (167)
 20 PRK05425 asparagine synthetase  22.3      64  0.0014   29.5   2.2   17   38-54    178-196 (327)
 21 PF01282 Ribosomal_S24e:  Ribos  22.3      66  0.0014   23.4   1.9   24   35-58      7-31  (84)
 22 PF14990 DUF4516:  Domain of un  22.1 2.5E+02  0.0054   18.7   4.5   32  123-154     3-34  (47)
 23 PF11821 DUF3341:  Protein of u  22.1 1.2E+02  0.0026   25.0   3.6   34  102-143    37-70  (173)
 24 PHA02284 hypothetical protein   21.9      74  0.0016   27.4   2.3   43   10-60     89-133 (251)
 25 PTZ00213 asparagine synthetase  21.8      67  0.0014   29.6   2.2   17   38-54    179-197 (348)
 26 PF11293 DUF3094:  Protein of u  21.6 1.7E+02  0.0037   20.2   3.6   38  112-149    15-52  (55)
 27 cd00645 AsnA Asparagine synthe  21.0      72  0.0015   29.0   2.2   17   38-54    168-186 (309)
 28 PF13721 SecD-TM1:  SecD export  20.9 1.2E+02  0.0027   22.5   3.1   18  124-141     3-20  (101)

No 1  
>PF05821 NDUF_B8:  NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI or NDUFB8);  InterPro: IPR008699  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family consists of several eukaryotic NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI) proteins. NADH:ubiquinone oxidoreductase (complex I) is an extremely complicated multiprotein complex located in the inner mitochondrial membrane. Its main function is the transport of electrons from NADH to ubiquinone, which is accompanied by translocation of protons from the mitochondrial matrix to the intermembrane space. Human complex I appears to consist of 41 subunits [].; GO: 0003954 NADH dehydrogenase activity, 0008137 NADH dehydrogenase (ubiquinone) activity, 0005739 mitochondrion
Probab=100.00  E-value=2.9e-70  Score=448.30  Aligned_cols=155  Identities=35%  Similarity=0.548  Sum_probs=147.2

Q ss_pred             HHHHhhhhhhhcccCCCCCCCCCCCCCHHHHHHHHHHcCCCCCCcccCCCCCCCCCCCCCCCCCCcccCCCCCCCCCcCC
Q psy414           16 VLSLQQNSVRTAFVYTPDWLPGERPKTEEERRKAAKKYNLLPEEYEVQPDDGFATGDYPHLPHTHYDSRDPFYPWDYPMF   95 (176)
Q Consensus        16 ~~~~~~~~~r~~~~~~~d~~PgpyP~t~eer~aaAkKY~l~~edY~P~~ddg~~~GDYP~lP~~s~q~RDPy~~WDdpq~   95 (176)
                      ...++.++||+||+|||||+|||||||+|||+||||||||+||||+||+|||+++||||+||.+|+|+||||++|||||+
T Consensus        13 ~~~~~~~~~r~~~~~~kd~~PgpyP~t~eer~aaAkKY~l~pedY~P~pDDg~~~GDYP~lp~~s~q~RDPy~~WDdpq~   92 (179)
T PF05821_consen   13 NPAVLPLGARTASGWNKDWKPGPYPKTPEERAAAAKKYGLRPEDYEPYPDDGMGYGDYPKLPDISQQERDPYYDWDDPQE   92 (179)
T ss_pred             hhhhhhhhhhhhccCCccCCCCCCCCCHHHHHHHHHHcCCCHHHcCCCCCCCcccCCCCCCCccchhhcCCCCCcCChhh
Confidence            44456899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCccCccccCCCCCCCccccCHHHHHHHHHHHHHHHHHHHHHhhcccccCCCCCCCCCCCCCccccccc
Q psy414           96 RTNYGEPLPNDFAISHYGMGFNEQPVNQRISVWEQLAYMVGILGTISLVLKYFCWEKRYYYPKFDSPKYQKGVVHYGYH  174 (176)
Q Consensus        96 RRNfgEPvH~d~d~Dm~s~dr~d~~~~~~vs~~~~l~~~~g~l~g~~~~~~~l~~~y~~~~Pv~prqYP~~GL~Hytfe  174 (176)
                      |||||||||+  |+|||++||+|++ ++.++|.+++.+|++|+ ||+++++||++++++++||+|||||+|||.|+++.
T Consensus        93 RRNfgEPvH~--d~Dm~s~dr~d~~-~~~~~w~~~~~~l~~fl-g~~~~~~~~~~~~~~~~P~~pKqYP~~gL~~e~gg  167 (179)
T PF05821_consen   93 RRNFGEPVHE--DFDMYSPDRYDTS-PTPVSWQSMLKQLFGFL-GFMLFMFYLGEMYPPYRPVMPKQYPYNGLYLELGG  167 (179)
T ss_pred             hcCCCCCCcc--cccceeecccccC-CCcccHHHHHHHHHHHH-HHHHHHHHHhhhccCCCCCCcccCCCCCeecccCC
Confidence            9999999999  9999999999987 56778999999999999 99999999998999999999999999999998875


No 2  
>KOG4040|consensus
Probab=100.00  E-value=4e-62  Score=393.78  Aligned_cols=152  Identities=34%  Similarity=0.535  Sum_probs=142.8

Q ss_pred             hhhhhhcccCCCCCCCCCCCCCHHHHHHHHHHcCCCCCCcccCCCCCCCCCCCCCCCCCCcccCCCCCCCCCcCCCCCCC
Q psy414           21 QNSVRTAFVYTPDWLPGERPKTEEERRKAAKKYNLLPEEYEVQPDDGFATGDYPHLPHTHYDSRDPFYPWDYPMFRTNYG  100 (176)
Q Consensus        21 ~~~~r~~~~~~~d~~PgpyP~t~eer~aaAkKY~l~~edY~P~~ddg~~~GDYP~lP~~s~q~RDPy~~WDdpq~RRNfg  100 (176)
                      ..+.|++++|+||++|||||+|||||+||||||||+|||||||+|||+++||||+|+.+++++||||+.||+||+|||||
T Consensus        23 ~~g~rt~~gw~kD~kPgpyP~teeER~AAAkKY~lrpEdY~py~dDg~gyGDYPkLg~~~~~~kDpyy~Wd~p~~rrNwg  102 (186)
T KOG4040|consen   23 PRGPRTFDGWYKDHKPGPYPTTEEERRAAAKKYGLRPEDYQPYDDDGVGYGDYPKLGVITYDHKDPYYAWDDPQNRRNWG  102 (186)
T ss_pred             ccccccccccccccCCCCCCCCHHHHHHHHHHhCCCHhhcCcCCcCCcccCCCCcCcccccccCCCccccCChhhhcccC
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCccCccccCCCCCCC-ccccCHHHHHHHHHHHHHHHHHHHHHhhcccccCCCCCCCCCCCCCcccccccc
Q psy414          101 EPLPNDFAISHYGMGFNEQPV-NQRISVWEQLAYMVGILGTISLVLKYFCWEKRYYYPKFDSPKYQKGVVHYGYHQ  175 (176)
Q Consensus       101 EPvH~d~d~Dm~s~dr~d~~~-~~~vs~~~~l~~~~g~l~g~~~~~~~l~~~y~~~~Pv~prqYP~~GL~Hytfe~  175 (176)
                      ||||+  |+|+|+.||++..+ ++.++|..+|.+|+|+| .++++++|+...++.++||+|||||++|+.||+|+.
T Consensus       103 Epv~~--d~d~Y~~dR~t~~e~p~y~~w~~~~mcl~g~~-~~~l~~~y~~d~~p~ykPv~pKQYpy~~~~~y~f~d  175 (186)
T KOG4040|consen  103 EPVPI--DMDRYRGDRFTGLEAPDYTTWNSIVMCLRGLV-PMALLAWYFTDEHPRYKPVMPKQYPYDFYRAYPFDD  175 (186)
T ss_pred             CCcch--hHhhhccccccccCCCCcccHHHHHHHHHHHH-HHHHHHHHHcccccccccCCcccCCCCCeeeccCCC
Confidence            99999  99999999988643 66789999999999999 666667788889999999999999999999999984


No 3  
>PF00446 GnRH:  Gonadotropin-releasing hormone;  InterPro: IPR002012 The gonadotropin-releasing hormones (GnRH) (gonadoliberin) [] are a family of peptides that play a pivotal role in reproduction. The main function of GnRH is to act on the pituitary to stimulate the synthesis and secretion of luteinizing and follicle-stimulating hormones, but GnRH also acts on the brain, retina, sympathetic nervous system, gonads and placenta in certain species. There seems to be at least three forms of GnRH. The second form is expressed in midbrain and seems to be widespread. The third form has only been found so far in fish. GnRH is a C-terminal amidated decapeptide processed from a larger precursor protein. Four of the ten residues are perfectly conserved in all species where GnRH has been sequenced.; GO: 0005179 hormone activity, 0007275 multicellular organismal development, 0005576 extracellular region
Probab=76.43  E-value=1.4  Score=20.63  Aligned_cols=9  Identities=33%  Similarity=1.069  Sum_probs=8.0

Q ss_pred             cCCCCCCCC
Q psy414           29 VYTPDWLPG   37 (176)
Q Consensus        29 ~~~~d~~Pg   37 (176)
                      +|+.+|+||
T Consensus         2 HwS~~w~PG   10 (10)
T PF00446_consen    2 HWSHGWKPG   10 (10)
T ss_pred             ccccccCCC
Confidence            699999998


No 4  
>PF05821 NDUF_B8:  NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI or NDUFB8);  InterPro: IPR008699  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family consists of several eukaryotic NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI) proteins. NADH:ubiquinone oxidoreductase (complex I) is an extremely complicated multiprotein complex located in the inner mitochondrial membrane. Its main function is the transport of electrons from NADH to ubiquinone, which is accompanied by translocation of protons from the mitochondrial matrix to the intermembrane space. Human complex I appears to consist of 41 subunits [].; GO: 0003954 NADH dehydrogenase activity, 0008137 NADH dehydrogenase (ubiquinone) activity, 0005739 mitochondrion
Probab=68.61  E-value=8.3  Score=32.08  Aligned_cols=47  Identities=21%  Similarity=0.155  Sum_probs=28.3

Q ss_pred             ccCHHHHHHHHHHHHHHHHHHHHHhh--c-----cccc-----CCCCCCCCCCCCCcccccc
Q psy414          124 RISVWEQLAYMVGILGTISLVLKYFC--W-----EKRY-----YYPKFDSPKYQKGVVHYGY  173 (176)
Q Consensus       124 ~vs~~~~l~~~~g~l~g~~~~~~~l~--~-----~y~~-----~~Pv~prqYP~~GL~Hytf  173 (176)
                      ..+...+++.|+||+++++.++....  +     -|+.     +.---|+..|   ++||+|
T Consensus       121 w~~~~~~l~~flg~~~~~~~~~~~~~~~~P~~pKqYP~~gL~~e~ggdp~k~p---~~~y~~  179 (179)
T PF05821_consen  121 WQSMLKQLFGFLGFMLFMFYLGEMYPPYRPVMPKQYPYNGLYLELGGDPSKEP---VVHYEI  179 (179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhccCCCCCCcccCCCCCeecccCCCCccCC---cCCccC
Confidence            34566789999999977666653322  1     1211     1223455566   899997


No 5  
>PF05920 Homeobox_KN:  Homeobox KN domain;  InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 3K2A_B 2LK2_A 1X2N_A 2DMN_A.
Probab=67.43  E-value=4.2  Score=25.77  Aligned_cols=20  Identities=30%  Similarity=0.423  Sum_probs=14.3

Q ss_pred             CCCCCCHHHHHHHHHHcCCCC
Q psy414           37 GERPKTEEERRKAAKKYNLLP   57 (176)
Q Consensus        37 gpyP~t~eer~aaAkKY~l~~   57 (176)
                      -||| |+||+...|++-||..
T Consensus         8 nPYP-s~~ek~~L~~~tgls~   27 (40)
T PF05920_consen    8 NPYP-SKEEKEELAKQTGLSR   27 (40)
T ss_dssp             SGS---HHHHHHHHHHHTS-H
T ss_pred             CCCC-CHHHHHHHHHHcCCCH
Confidence            4786 6788999999999864


No 6  
>PF06392 Asr:  Acid shock protein repeat ;  InterPro: IPR009435 The Asr protein is synthesised as a precursor and the cleavage is essential for moderate to high acid tolerance []. Enterobacteria have developed numerous constitutive and inducible strategies to sense and adapt to external acidity. These molecular responses require many specific acid shock proteins (ASPs) [].; GO: 0010447 response to acidity, 0042597 periplasmic space
Probab=52.56  E-value=8.1  Score=21.15  Aligned_cols=12  Identities=50%  Similarity=0.661  Sum_probs=10.3

Q ss_pred             CCHHHHHHHHHH
Q psy414           41 KTEEERRKAAKK   52 (176)
Q Consensus        41 ~t~eer~aaAkK   52 (176)
                      +|.|+++.||||
T Consensus         8 ~~~eqkaqaakk   19 (19)
T PF06392_consen    8 KATEQKAQAAKK   19 (19)
T ss_pred             ccHHHHHHHhcC
Confidence            588999999986


No 7  
>PF13807 GNVR:  G-rich domain on putative tyrosine kinase
Probab=44.06  E-value=31  Score=24.29  Aligned_cols=25  Identities=16%  Similarity=0.194  Sum_probs=17.3

Q ss_pred             cccCHHHHHHHHHHHHHHHHHHHHH
Q psy414          123 QRISVWEQLAYMVGILGTISLVLKY  147 (176)
Q Consensus       123 ~~vs~~~~l~~~~g~l~g~~~~~~~  147 (176)
                      .++++.+.+...+|+++|+++.+.+
T Consensus        52 ~P~~P~~~lil~l~~~~Gl~lgi~~   76 (82)
T PF13807_consen   52 KPVSPKRALILALGLFLGLILGIGL   76 (82)
T ss_pred             CCCCCcHHHHHHHHHHHHHHHHHHH
Confidence            3677777777777777777765533


No 8  
>PF06166 DUF979:  Protein of unknown function (DUF979);  InterPro: IPR009323 This family consists of several putative bacterial membrane proteins. The function of this family is unclear.
Probab=35.84  E-value=38  Score=30.66  Aligned_cols=25  Identities=28%  Similarity=0.229  Sum_probs=19.3

Q ss_pred             CCCCCCCCCC-CHHHHHHHHHHcCCC
Q psy414           32 PDWLPGERPK-TEEERRKAAKKYNLL   56 (176)
Q Consensus        32 ~d~~PgpyP~-t~eer~aaAkKY~l~   56 (176)
                      +.-+.|.++. |+|||++.|||+|.+
T Consensus        67 ~~v~~g~~~~~s~e~r~~~a~rlGnk   92 (308)
T PF06166_consen   67 GQVGIGSYKEPSEEEREASAKRLGNK   92 (308)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHhcCe
Confidence            4456777776 688999999999854


No 9  
>COG3817 Predicted membrane protein [Function unknown]
Probab=30.01  E-value=49  Score=29.74  Aligned_cols=25  Identities=28%  Similarity=0.320  Sum_probs=20.4

Q ss_pred             CCCCCCCCCC-CHHHHHHHHHHcCCC
Q psy414           32 PDWLPGERPK-TEEERRKAAKKYNLL   56 (176)
Q Consensus        32 ~d~~PgpyP~-t~eer~aaAkKY~l~   56 (176)
                      +.-++|.+|+ ++|||++-|++||-+
T Consensus        71 ~~v~~G~~~~~~~e~re~~A~rlgnr   96 (313)
T COG3817          71 GQVKIGALPELSPEEREKSANRLGNR   96 (313)
T ss_pred             CCcccCCCCCCCHHHHHHHHHHhcCE
Confidence            4568899988 788999999999843


No 10 
>smart00389 HOX Homeodomain. DNA-binding factors that are involved in the transcriptional regulation of key developmental processes
Probab=29.72  E-value=59  Score=20.36  Aligned_cols=21  Identities=33%  Similarity=0.434  Sum_probs=16.9

Q ss_pred             CCCCCCHHHHHHHHHHcCCCCC
Q psy414           37 GERPKTEEERRKAAKKYNLLPE   58 (176)
Q Consensus        37 gpyP~t~eer~aaAkKY~l~~e   58 (176)
                      .+|| |.+++...|+..||..+
T Consensus        22 ~~~P-~~~~~~~la~~~~l~~~   42 (56)
T smart00389       22 NPYP-SREEREELAAKLGLSER   42 (56)
T ss_pred             CCCC-CHHHHHHHHHHHCcCHH
Confidence            3477 88999999999998743


No 11 
>PF14147 Spore_YhaL:  Sporulation protein YhaL
Probab=27.47  E-value=75  Score=21.66  Aligned_cols=21  Identities=19%  Similarity=0.139  Sum_probs=13.5

Q ss_pred             cCHHHHHHHHHHHHHHHHHHH
Q psy414          125 ISVWEQLAYMVGILGTISLVL  145 (176)
Q Consensus       125 vs~~~~l~~~~g~l~g~~~~~  145 (176)
                      ++||..+..++.++.|+|++-
T Consensus         1 ~PwWvY~vi~gI~~S~ym~v~   21 (52)
T PF14147_consen    1 IPWWVYFVIAGIIFSGYMAVK   21 (52)
T ss_pred             CcchHHHHHHHHHHHHHHHHH
Confidence            468877766666666666543


No 12 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=26.83  E-value=61  Score=25.41  Aligned_cols=17  Identities=6%  Similarity=0.354  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy414          129 EQLAYMVGILGTISLVL  145 (176)
Q Consensus       129 ~~l~~~~g~l~g~~~~~  145 (176)
                      .+..++||+|+|+.+.+
T Consensus        65 ~i~~Ii~gv~aGvIg~I   81 (122)
T PF01102_consen   65 AIIGIIFGVMAGVIGII   81 (122)
T ss_dssp             CHHHHHHHHHHHHHHHH
T ss_pred             ceeehhHHHHHHHHHHH
Confidence            35666677776666543


No 13 
>COG3765 WzzB Chain length determinant protein [Cell envelope biogenesis, outer membrane]
Probab=24.41  E-value=98  Score=28.52  Aligned_cols=43  Identities=16%  Similarity=-0.022  Sum_probs=26.9

Q ss_pred             CCCCCccCccccCCCCCC--Cc-cccCHHHHHHHHHHHHHHHHHHHHH
Q psy414          103 LPNDFAISHYGMGFNEQP--VN-QRISVWEQLAYMVGILGTISLVLKY  147 (176)
Q Consensus       103 vH~d~d~Dm~s~dr~d~~--~~-~~vs~~~~l~~~~g~l~g~~~~~~~  147 (176)
                      ++.  ..+-.+.-|++.+  .| .+.++.++|..++|+++|+|+.++.
T Consensus       289 l~v--~d~~~~~yRYl~~P~~Pvkrd~PrrA~ilil~~LiGgm~g~g~  334 (347)
T COG3765         289 LKV--LDERFSTYRYLQKPTLPVKRDSPRRAIILILGALIGGMLGAGV  334 (347)
T ss_pred             ccC--cccceeEEEecCCCCCCCcCCCcchHHHHHHHHHHHHHHHHHH
Confidence            455  4555566667643  12 2567778887777777777776644


No 14 
>PF09098 Dehyd-heme_bind:  Quinohemoprotein amine dehydrogenase A, alpha subunit, haem binding;  InterPro: IPR015182 Quinohemoprotein amine dehydrogenases (QHNDH) 1.4.99 from EC) are enzymes produced in the periplasmic space of certain Gram-negative bacteria, such as Paracoccus denitrificans and Pseudomonas putida, in response to primary amines, including n-butylamine and benzylamine. QHNDH catalyses the oxidative deamination of a wide range of aliphatic and aromatic amines through formation of a Schiff-base intermediate involving one of the quinone O atoms []. Catalysis requires the presence of a novel redox cofactor, cysteine tryptophylquinone (CTQ). CTQ is derived from the post-translational modification of specific residues, which involves the oxidation of the indole ring of a tryptophan residue to form tryptophylquinone, followed by covalent cross-linking with a cysteine residue []. There is one CTQ per subunit in QHNDH. In addition to CTQ, two haem c cofactors are present in QHNDH that mediate the transfer of the substrate-derived electrons from CTQ to an external electron acceptor, cytochrome c-550 [, ]. QHNDH is a heterotrimer of alpha, beta and gamma subunits. The alpha and beta subunits contain signal peptides necessary for the translocation of QHNDH to the periplasm. The alpha subunit is composed of four domains - domain 1 forming a dihaem cytochrome, and domains 2-4 forming antiparallel beta-barrel structures; the beta subunit is a 7-bladed beta-propeller that provides part of the active site; and the small, catalytic gamma subunit contains the novel cross-linked CTQ cofactor, in addition to additional thioester cross-links between Cys and Asp/Glu residues that encage CTQ. The gamma subunit assumes a globular secondary structure with two short alpha-helices having many turns and bends [].  This entry represents the dihaem cytochrome c domain of the QHNDH alpha subunit. The domain contain two cysteine residues that are involved in thioether linkages to haem []. ; PDB: 1PBY_A 1JJU_A 1JMZ_A 1JMX_A.
Probab=24.01  E-value=57  Score=27.12  Aligned_cols=23  Identities=39%  Similarity=0.508  Sum_probs=13.8

Q ss_pred             CCCHHHHHHH----HHHcCCCCCCccc
Q psy414           40 PKTEEERRKA----AKKYNLLPEEYEV   62 (176)
Q Consensus        40 P~t~eer~aa----AkKY~l~~edY~P   62 (176)
                      +-|++||+|+    |++|||-|+|-++
T Consensus        50 ~Is~eer~avVkYLAd~~GLap~Et~~   76 (167)
T PF09098_consen   50 PISPEERRAVVKYLADTQGLAPSETAP   76 (167)
T ss_dssp             ---HHHHHHHHHHHHHHT---CGGCTT
T ss_pred             CCCHHHHHHHHHHHHHccCCCchhhcc
Confidence            4588999886    6799999998654


No 15 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=23.69  E-value=27  Score=28.41  Aligned_cols=30  Identities=33%  Similarity=0.705  Sum_probs=20.6

Q ss_pred             HHHHHHHcCCCCCCcccCCCCCCCCCCCCCCCC
Q psy414           46 RRKAAKKYNLLPEEYEVQPDDGFATGDYPHLPH   78 (176)
Q Consensus        46 r~aaAkKY~l~~edY~P~~ddg~~~GDYP~lP~   78 (176)
                      ++-..-+|||.||||.-  .=|+ -.|||.+-+
T Consensus        90 KRHL~t~~gmTPd~YR~--KW~L-P~dYPMvAP  119 (148)
T COG4957          90 KRHLTTHYGLTPDEYRA--KWGL-PPDYPMVAP  119 (148)
T ss_pred             HHHHhcccCCCHHHHHH--hcCC-CCCCCccch
Confidence            44566789999999981  1122 379998754


No 16 
>PF08628 Nexin_C:  Sorting nexin C terminal;  InterPro: IPR013937  This region is found at the C terminus of proteins belonging to the nexin family. It is found on proteins which also contain IPR001683 from INTERPRO. 
Probab=23.12  E-value=1.8e+02  Score=21.37  Aligned_cols=23  Identities=22%  Similarity=0.400  Sum_probs=13.8

Q ss_pred             CCCC-CCCCCCCCCHHHHHHHHHH
Q psy414           30 YTPD-WLPGERPKTEEERRKAAKK   52 (176)
Q Consensus        30 ~~~d-~~PgpyP~t~eer~aaAkK   52 (176)
                      |.-. +.+.+-|+|+|||++.+++
T Consensus        52 wP~g~~~~~~~~Rt~~ek~~tr~~   75 (113)
T PF08628_consen   52 WPNGKLAEPPPPRTEEEKLRTRQE   75 (113)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHH
Confidence            5444 2233338999998776553


No 17 
>TIGR00669 asnA aspartate--ammonia ligase, AsnA-type. The fact that the protein from the H. influenzae is more than 70 % identical to that from the spirochete Treponema pallidum, but less than 65 % identical to that from the closely related E. coli, strongly suggests lateral transfer.
Probab=23.03  E-value=61  Score=29.62  Aligned_cols=17  Identities=18%  Similarity=0.325  Sum_probs=13.6

Q ss_pred             CCCC-CHHHHH-HHHHHcC
Q psy414           38 ERPK-TEEERR-KAAKKYN   54 (176)
Q Consensus        38 pyP~-t~eer~-aaAkKY~   54 (176)
                      .||. |++||+ ++||+||
T Consensus       176 ~YP~lt~keRE~~i~ke~g  194 (330)
T TIGR00669       176 RYPDLDSKGRERAICKELG  194 (330)
T ss_pred             HCCCCCHHHHHHHHHHHhC
Confidence            3554 899998 8889888


No 18 
>PF15183 MRAP:  Melanocortin-2 receptor accessory protein family
Probab=22.85  E-value=2.2e+02  Score=21.40  Aligned_cols=38  Identities=21%  Similarity=0.152  Sum_probs=23.7

Q ss_pred             ccCccccCCCCCCCccccCHHHHHHHHHHHHHHHHHHHHHhh
Q psy414          108 AISHYGMGFNEQPVNQRISVWEQLAYMVGILGTISLVLKYFC  149 (176)
Q Consensus       108 d~Dm~s~dr~d~~~~~~vs~~~~l~~~~g~l~g~~~~~~~l~  149 (176)
                      |+.-+...+++.    .|-.|..++.|.+|+|-++++|.+-+
T Consensus        27 d~~~Lka~kysI----VI~FWv~LA~FV~~lF~iL~~ms~sg   64 (90)
T PF15183_consen   27 DEEKLKANKYSI----VIAFWVSLAAFVVFLFLILLYMSWSG   64 (90)
T ss_pred             CHHHhcccceee----ehhHHHHHHHHHHHHHHHHHHHhccC
Confidence            334444544443    46778888888888876666665543


No 19 
>KOG4075|consensus
Probab=22.83  E-value=70  Score=26.62  Aligned_cols=10  Identities=30%  Similarity=0.786  Sum_probs=6.2

Q ss_pred             CCCCCCCCCC
Q psy414           96 RTNYGEPLPN  105 (176)
Q Consensus        96 RRNfgEPvH~  105 (176)
                      |=-|||+.-+
T Consensus        82 risF~et~ae   91 (167)
T KOG4075|consen   82 RISFGETFAE   91 (167)
T ss_pred             HHHhcccccc
Confidence            4457776665


No 20 
>PRK05425 asparagine synthetase AsnA; Provisional
Probab=22.33  E-value=64  Score=29.45  Aligned_cols=17  Identities=41%  Similarity=0.636  Sum_probs=13.7

Q ss_pred             CCCC-CHHHHH-HHHHHcC
Q psy414           38 ERPK-TEEERR-KAAKKYN   54 (176)
Q Consensus        38 pyP~-t~eer~-aaAkKY~   54 (176)
                      -||. |++||+ ++||+||
T Consensus       178 ~YP~l~~keRE~~i~ke~g  196 (327)
T PRK05425        178 RYPDLTPKEREDAIAKEYG  196 (327)
T ss_pred             HCCCCCHHHHHHHHHHHhC
Confidence            4564 899998 8889888


No 21 
>PF01282 Ribosomal_S24e:  Ribosomal protein S24e;  InterPro: IPR001976 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the S24e ribosomal proteins from eukaryotes and archaebacteria. These proteins have 101 to 148 amino acids.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2V94_B 1YWX_A 2G1D_A 3IZ6_U 1XN9_A 2XZM_P 2XZN_P 3U5G_Y 3J16_D 3IZB_U ....
Probab=22.31  E-value=66  Score=23.35  Aligned_cols=24  Identities=38%  Similarity=0.567  Sum_probs=18.0

Q ss_pred             CCC-CCCCCHHHHHHHHHHcCCCCC
Q psy414           35 LPG-ERPKTEEERRKAAKKYNLLPE   58 (176)
Q Consensus        35 ~Pg-pyP~t~eer~aaAkKY~l~~e   58 (176)
                      -|| +.|...|=|.+.|+.||..++
T Consensus         7 h~g~~Tpsr~ei~~klA~~~~~~~~   31 (84)
T PF01282_consen    7 HPGKPTPSRKEIREKLAAMLNVDPD   31 (84)
T ss_dssp             -SSSSS--HHHHHHHHHHHHTSTGC
T ss_pred             CCCCCCCCHHHHHHHHHHHhCCCCC
Confidence            367 889999999999999998554


No 22 
>PF14990 DUF4516:  Domain of unknown function (DUF4516)
Probab=22.08  E-value=2.5e+02  Score=18.69  Aligned_cols=32  Identities=13%  Similarity=-0.139  Sum_probs=17.2

Q ss_pred             cccCHHHHHHHHHHHHHHHHHHHHHhhccccc
Q psy414          123 QRISVWEQLAYMVGILGTISLVLKYFCWEKRY  154 (176)
Q Consensus       123 ~~vs~~~~l~~~~g~l~g~~~~~~~l~~~y~~  154 (176)
                      ..++|.+.++.+...++..++..-.+-..|++
T Consensus         3 ~Gv~~~~yl~~~~~s~~sM~aGA~vVH~~ykP   34 (47)
T PF14990_consen    3 AGVSWPSYLKSLVASLLSMLAGASVVHNIYKP   34 (47)
T ss_pred             CCCcHHHHHHHHHHHHHHHHhhhHHHHHHhCc
Confidence            35788877776665554444433333324444


No 23 
>PF11821 DUF3341:  Protein of unknown function (DUF3341);  InterPro: IPR021776  This family of proteins are functionally uncharacterised. This family is found in bacteria. Proteins in this family are about 170 amino acids in length. 
Probab=22.07  E-value=1.2e+02  Score=25.00  Aligned_cols=34  Identities=15%  Similarity=0.228  Sum_probs=20.6

Q ss_pred             CCCCCCccCccccCCCCCCCccccCHHHHHHHHHHHHHHHHH
Q psy414          102 PLPNDFAISHYGMGFNEQPVNQRISVWEQLAYMVGILGTISL  143 (176)
Q Consensus       102 PvH~d~d~Dm~s~dr~d~~~~~~vs~~~~l~~~~g~l~g~~~  143 (176)
                      |||.  =.+.++.      .+++++|..-+.-++|+++|+++
T Consensus        37 Pvhg--ld~alg~------~~s~l~~~~l~~Gl~G~~~~~~l   70 (173)
T PF11821_consen   37 PVHG--LDEALGL------KRSRLPWIALVGGLTGFATAFLL   70 (173)
T ss_pred             cCcC--HHHHhCC------CCCchHHHHHHHHHHHHHHHHHH
Confidence            6776  4455543      25688877666666666655554


No 24 
>PHA02284 hypothetical protein
Probab=21.89  E-value=74  Score=27.42  Aligned_cols=43  Identities=30%  Similarity=0.312  Sum_probs=30.7

Q ss_pred             ccchHHHHHHhhhhhhhcccCCCCCCCCCCCC-CHHHHHHHHHHcCCCC-CCc
Q psy414           10 VKSLGKVLSLQQNSVRTAFVYTPDWLPGERPK-TEEERRKAAKKYNLLP-EEY   60 (176)
Q Consensus        10 ~~~~~~~~~~~~~~~r~~~~~~~d~~PgpyP~-t~eer~aaAkKY~l~~-edY   60 (176)
                      |.+=||.-||+++++--        .|.|||+ |+|....|.+=||..- |||
T Consensus        89 VDs~~K~~SLL~Q~~EL--------~~~~~~~~~~~~~K~~T~YYNF~~f~D~  133 (251)
T PHA02284         89 VDSDRKYYSLLQQITEL--------SKDPFPKWVEDDAKGLTKYYNFQDFEDV  133 (251)
T ss_pred             eccchhHHHHHHHHHHh--------CcccchhhhHHHHhhhhhhcccccHHHh
Confidence            55678999999888754        4789998 5555556666677665 554


No 25 
>PTZ00213 asparagine synthetase A; Provisional
Probab=21.81  E-value=67  Score=29.58  Aligned_cols=17  Identities=35%  Similarity=0.601  Sum_probs=13.8

Q ss_pred             CCCC-CHHHHH-HHHHHcC
Q psy414           38 ERPK-TEEERR-KAAKKYN   54 (176)
Q Consensus        38 pyP~-t~eer~-aaAkKY~   54 (176)
                      .||. |++||+ ++||+||
T Consensus       179 ~YP~lt~keRE~~i~ke~g  197 (348)
T PTZ00213        179 MYPNLSPKEREREIVKKYG  197 (348)
T ss_pred             HCCCCCHHHHHHHHHHHhC
Confidence            4665 899998 8889887


No 26 
>PF11293 DUF3094:  Protein of unknown function (DUF3094);  InterPro: IPR021444  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=21.62  E-value=1.7e+02  Score=20.15  Aligned_cols=38  Identities=13%  Similarity=0.212  Sum_probs=24.8

Q ss_pred             cccCCCCCCCccccCHHHHHHHHHHHHHHHHHHHHHhh
Q psy414          112 YGMGFNEQPVNQRISVWEQLAYMVGILGTISLVLKYFC  149 (176)
Q Consensus       112 ~s~dr~d~~~~~~vs~~~~l~~~~g~l~g~~~~~~~l~  149 (176)
                      |..-..+..+..++-++..+..+++++.|+.++..+++
T Consensus        15 yL~a~~~~VER~PFrP~~Ll~~li~Vv~gl~llS~ll~   52 (55)
T PF11293_consen   15 YLQAGVNQVERKPFRPWRLLIVLIVVVIGLGLLSRLLS   52 (55)
T ss_pred             HHhCCCCccccCCcchHHHHHHHHHHHHHHHHHHHHHH
Confidence            33333444456677777777788888878777665555


No 27 
>cd00645 AsnA Asparagine synthetase (aspartate-ammonia ligase) (AsnA) catalyses the conversion of L-aspartate to L-asparagine in the presence of ATP and ammonia.  AsnA is a homodimeric enzyme which is structurally similiar to the catalytic core domain of class II aminoacyl-tRNA synthetases. Ammonia-dependent AsnA is not homologous to the glutamine-dependent asparagine synthetase AsnB.
Probab=21.02  E-value=72  Score=28.95  Aligned_cols=17  Identities=29%  Similarity=0.403  Sum_probs=13.7

Q ss_pred             CCCC-CHHHHH-HHHHHcC
Q psy414           38 ERPK-TEEERR-KAAKKYN   54 (176)
Q Consensus        38 pyP~-t~eer~-aaAkKY~   54 (176)
                      .||. |++||+ ++||+||
T Consensus       168 ~YP~l~~keRE~~i~ke~g  186 (309)
T cd00645         168 RYPDLTPKEREDAICKEHG  186 (309)
T ss_pred             HCCCCCHHHHHHHHHHHhC
Confidence            4554 899998 8889888


No 28 
>PF13721 SecD-TM1:  SecD export protein N-terminal TM region
Probab=20.88  E-value=1.2e+02  Score=22.54  Aligned_cols=18  Identities=28%  Similarity=0.471  Sum_probs=11.9

Q ss_pred             ccCHHHHHHHHHHHHHHH
Q psy414          124 RISVWEQLAYMVGILGTI  141 (176)
Q Consensus       124 ~vs~~~~l~~~~g~l~g~  141 (176)
                      +++.||.++.++.+++|+
T Consensus         3 ~yp~WKyllil~vl~~~~   20 (101)
T PF13721_consen    3 RYPLWKYLLILVVLLLGA   20 (101)
T ss_pred             CcchHHHHHHHHHHHHHH
Confidence            678888887665554333


Done!