Diaphorina citri psyllid: psy4163

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MFSSMVKGTAFTASPAQHVGRSVSRHELFPIRANFMALEHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQCEDVRNDDE
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHcccc
*******************GRSVSRHELFPIRANFMALEHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQC********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSSMVKGTAFTASPAQHVGRSVSRHELFPIRANFMALEHCIAPFLNKCDADDDHLITLKEWxxxxxxxxxxxxxxxxxxxxxDE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SPARC Has a high affinity for collagen. Affects nematode body morphology and mobility. Essential for C.elegans development and muscle function. The cysteine-rich region could have protease inhibitory activity or may provide the framework for a protein binding module. Probable role in skeletal morphogenesis.confidentP34714

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SRA, chain A
Confidence level:very confident
Coverage over the Query: 6-75
View the alignment between query and template
View the model in PyMOL