BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy4173
         (61 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4ACJ|A Chain A, Crystal Structure Of The Tldc Domain Of Oxidation
           Resistance Protein 2 From Zebrafish
          Length = 167

 Score = 78.6 bits (192), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (76%)

Query: 1   MYFIKGNNESLSIGAGDGKFGLWLDGDLYQGRSEPCSTYGNEPLSPQQDFVVKTLECWAF 60
           ++FIKG+ +SL+ G G G+FGLWLDGDLY GR+  C T+GN  LS ++DF V+ +E W+F
Sbjct: 107 LFFIKGDMDSLAFGGGSGEFGLWLDGDLYHGRNHSCKTFGNPMLSMKEDFFVQDIEIWSF 166


>pdb|1OO3|A Chain A, P395s Mutant Of The P85 Regulatory Subunit Of The N-
          Terminal Src Homology 2 Domain Of Pi3-Kinase
 pdb|1OO4|A Chain A, P395s Mutant Of The P85 Regulatory Subunit Of The N-
          Terminal Src Homology 2 Domain Of Pi3-Kinase Complexed
          To A Peptide Derived From Pdgfr
          Length = 111

 Score = 25.8 bits (55), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 6  GNNESLSIGAGDGKFGLWLDGDLYQGRSEPCSTYGNEPLS 45
          GNN+S+ I   DGK+G + D   +    E  + Y NE L+
Sbjct: 56 GNNKSIKIFHRDGKYG-FSDSLTFNSVVELINHYRNESLA 94


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.141    0.462 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,204,856
Number of Sequences: 62578
Number of extensions: 79739
Number of successful extensions: 179
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 178
Number of HSP's gapped (non-prelim): 2
length of query: 61
length of database: 14,973,337
effective HSP length: 32
effective length of query: 29
effective length of database: 12,970,841
effective search space: 376154389
effective search space used: 376154389
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)