Diaphorina citri psyllid: psy417

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240

MKEIVSSGSTQLISTSNGSGNGTLVEKKKNSSASHEKCTFHNDLELDHQPPTREALLPDMTASYKRLLGALGENPDRQGLLKTPERAAKAMLFFTKGYDQTLEEVLNDAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCKKILGLSKLARIVEIYSRRLQVQERLTKQIAIAVTKAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGQFRDDPKTREEFLNLVNTK

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccHHHHHccccccccccCEEEEccccccccccccccccccccEEEECccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccEEEcEEECcccccHHHHHHHHHHHHcc

**************************************************************SYKRLLGALGENPDRQGLLKTPERAAKAMLFFTKGYDQTLEEVLNDAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCKKILGLSKLARIVEIYSRRLQVQERLTKQIAIAVTKAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTSTMLGQFRDDPKTREEFLNLVN**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
GTP cyclohydrolase 1		very confident	B2J1L7
GTP cyclohydrolase 1 1		very confident	Q8YLL1
GTP cyclohydrolase 1	May positively regulate nitric oxide synthesis in endothelial cells. May be involved in dopamine synthesis. May modify pain sensitivity and persistence.	very confident	Q05915

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0048265 [BP]	response to pain	confident	GO:0032501, GO:0044707, GO:0050896, GO:0006950, GO:0008150, GO:0033555, GO:0044699
GO:0051291 [BP]	protein heterooligomerization	confident	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0060308 [MF]	GTP cyclohydrolase I regulator activity	confident	GO:0030234, GO:0003674
GO:0042559 [BP]	pteridine-containing compound biosynthetic process	confident	GO:1901576, GO:0044271, GO:1901566, GO:0071704, GO:0009987, GO:0006725, GO:0009058, GO:0042558, GO:1901564, GO:0044249, GO:0034641, GO:0006807, GO:0008150, GO:0044237, GO:0008152, GO:0019438, GO:0046483, GO:1901362, GO:1901360, GO:0018130
GO:0005509 [MF]	calcium ion binding	confident	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0008217 [BP]	regulation of blood pressure	confident	GO:0032501, GO:0044707, GO:0008015, GO:0003013, GO:0008150, GO:0065007, GO:0065008, GO:0044699, GO:0003008
GO:0043234 [CC]	protein complex	confident	GO:0005575, GO:0032991
GO:0003934 [MF]	GTP cyclohydrolase I activity	confident	GO:0016787, GO:0016810, GO:0003933, GO:0016814, GO:0003824, GO:0019238, GO:0003674
GO:0050794 [BP]	regulation of cellular process	confident	GO:0008150, GO:0065007, GO:0050789
GO:0005515 [MF]	protein binding	confident	GO:0003674, GO:0005488
GO:0005525 [MF]	GTP binding	confident	GO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006184 [BP]	GTP catabolic process	confident	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0043095 [BP]	regulation of GTP cyclohydrolase I activity	confident	GO:0051336, GO:0019222, GO:0050790, GO:0065007, GO:0008150, GO:0065009, GO:0050789
GO:0005730 [CC]	nucleolus	confident	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051066 [BP]	dihydrobiopterin metabolic process	confident	GO:1901564, GO:0009987, GO:0006725, GO:0042558, GO:0071704, GO:0006807, GO:0008150, GO:0044237, GO:0008152, GO:1901360, GO:0046483
GO:0042416 [BP]	dopamine biosynthetic process	confident	GO:0044249, GO:0006807, GO:1901362, GO:0042423, GO:1901360, GO:1901576, GO:0009713, GO:0009712, GO:0071704, GO:0046189, GO:0009987, GO:0006725, GO:0006584, GO:0042417, GO:0009058, GO:0008150, GO:0008152, GO:0018958, GO:1901564, GO:1901566, GO:0044237, GO:0019438, GO:1901617, GO:1901615
GO:0050662 [MF]	coenzyme binding	confident	GO:0003674, GO:0048037, GO:0005488
GO:0034612 [BP]	response to tumor necrosis factor	confident	GO:0042221, GO:0050896, GO:0008150, GO:0034097, GO:0010033
GO:0034341 [BP]	response to interferon-gamma	confident	GO:0002376, GO:0034097, GO:0050896, GO:0045087, GO:0006952, GO:0006950, GO:0008150, GO:0006955, GO:0042221, GO:0010033
GO:0008270 [MF]	zinc ion binding	confident	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0031965 [CC]	nuclear membrane	confident	GO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0031410 [CC]	cytoplasmic vesicle	confident	GO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0051260 [BP]	protein homooligomerization	confident	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0048067 [BP]	cuticle pigmentation	probable	GO:0032502, GO:0043473, GO:0042335, GO:0044707, GO:0048856, GO:0048066, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0008363 [BP]	larval chitin-based cuticle development	probable	GO:0032502, GO:0042337, GO:0042335, GO:0044707, GO:0040003, GO:0032501, GO:0048856, GO:0007591, GO:0009791, GO:0002165, GO:0002164, GO:0044767, GO:0008150, GO:0042303, GO:0007275, GO:0044699, GO:0002168
GO:0046654 [BP]	tetrahydrofolate biosynthetic process	probable	GO:0042398, GO:0019752, GO:0044249, GO:0034641, GO:0006807, GO:0009108, GO:0044281, GO:0044711, GO:0044283, GO:0046653, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0009396, GO:0071704, GO:0006520, GO:0051188, GO:0042558, GO:0042559, GO:0006732, GO:0006082, GO:1901605, GO:1901607, GO:0018130, GO:0006760, GO:0044238, GO:0009987, GO:0006725, GO:0009058, GO:0051186, GO:0008150, GO:0008152, GO:0043436, GO:1901564, GO:0046483, GO:0008652, GO:0044271, GO:0006575, GO:1901566, GO:0046394, GO:0016053, GO:0044237, GO:0019438
GO:0035998 [BP]	7,8-dihydroneopterin 3'-triphosphate biosynthetic process	probable	GO:0051066, GO:0044249, GO:0034641, GO:0006807, GO:1901362, GO:1901360, GO:1901576, GO:0051186, GO:0051188, GO:0042558, GO:0042559, GO:0071704, GO:0018130, GO:0009987, GO:0006725, GO:0009058, GO:0008150, GO:0008152, GO:1901564, GO:0090407, GO:0046483, GO:0044271, GO:1901566, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0019438
GO:2000274 [BP]	regulation of epithelial cell migration, open tracheal system	probable	GO:0030334, GO:0010632, GO:0050793, GO:0065007, GO:0040012, GO:0008150, GO:0051270, GO:2000026, GO:0051239, GO:2000145, GO:0032879, GO:0050794, GO:0050789
GO:0042438 [BP]	melanin biosynthetic process	probable	GO:0044249, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0044711, GO:0042440, GO:0044550, GO:0071704, GO:0019748, GO:0046189, GO:0006582, GO:0006725, GO:0009058, GO:0008150, GO:0008152, GO:0018958, GO:0046148, GO:0044237, GO:0019438, GO:0009987, GO:1901617, GO:1901615
GO:0030742 [MF]	GTP-dependent protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0048072 [BP]	compound eye pigmentation	probable	GO:0032502, GO:0048069, GO:0043473, GO:0048066, GO:0008150, GO:0044699
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042311 [BP]	vasodilation	probable	GO:0035150, GO:0050880, GO:0044707, GO:0008015, GO:0032501, GO:0090066, GO:0003013, GO:0065007, GO:0003018, GO:0008150, GO:0065008, GO:0044699, GO:0003008
GO:0009880 [BP]	embryonic pattern specification	probable	GO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0035185 [BP]	preblastoderm mitotic cell cycle	probable	GO:0032502, GO:0044699, GO:0032501, GO:0000278, GO:0044707, GO:0009987, GO:0048856, GO:0044767, GO:0009790, GO:0044763, GO:0045448, GO:0008150, GO:0033301, GO:0007275, GO:0007049
GO:0045335 [CC]	phagocytic vesicle	probable	GO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0006917 [BP]	induction of apoptosis	probable	GO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0008277 [BP]	regulation of G-protein coupled receptor protein signaling pathway	probable	GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0032496 [BP]	response to lipopolysaccharide	probable	GO:1901700, GO:0009607, GO:0033993, GO:0050896, GO:0009617, GO:0008150, GO:0002237, GO:0042221, GO:0051707, GO:0010033, GO:0051704
GO:0050884 [BP]	neuromuscular process controlling posture	probable	GO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0050905, GO:0044699, GO:0003008
GO:0051000 [BP]	positive regulation of nitric-oxide synthase activity	probable	GO:0050999, GO:0032770, GO:0051341, GO:0019222, GO:0032768, GO:0050790, GO:0051353, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0006729 [BP]	tetrahydrobiopterin biosynthetic process	probable	GO:0006732, GO:0044249, GO:0034641, GO:0006807, GO:0009108, GO:1901362, GO:1901360, GO:1901576, GO:0051186, GO:0051188, GO:0042558, GO:0042559, GO:0071704, GO:0018130, GO:0009987, GO:0006725, GO:0009058, GO:0046146, GO:0008150, GO:0008152, GO:1901564, GO:0046483, GO:0044271, GO:1901566, GO:0044237, GO:0019438
GO:0014916 [BP]	regulation of lung blood pressure	probable	GO:0032501, GO:0044707, GO:0008015, GO:0008150, GO:0003013, GO:0065007, GO:0008217, GO:0065008, GO:0044699, GO:0003008
GO:0045776 [BP]	negative regulation of blood pressure	probable	GO:0032501, GO:0044707, GO:0008015, GO:0008150, GO:0003013, GO:0065007, GO:0008217, GO:0065008, GO:0044699, GO:0003008
GO:0006809 [BP]	nitric oxide biosynthetic process	probable	GO:0044271, GO:0009987, GO:0009058, GO:0044237, GO:0044249, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0046209

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.5.-.-	Acting on carbon-nitrogen bonds, other than peptide bonds.	probable
3.5.4.-	4'-demethylrebeccamycin synthase.	probable
3.5.4.16	GTP cyclohydrolase I.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IS8, chain A
Confidence level:very confident
Coverage over the Query: 54-238
View the alignment between query and template
View the model in PyMOL

Template: 1A8R, chain A
Confidence level:very confident
Coverage over the Query: 35-240
View the alignment between query and template
View the model in PyMOL