Query         psy4190
Match_columns 90
No_of_seqs    14 out of 16
Neff          1.8 
Searched_HMMs 46136
Date          Fri Aug 16 19:09:19 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4190.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4190hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00043 9.4E-09   34.9   0.8   21   21-42      1-21  (24)
  2 PF13894 zf-C2H2_4:  C2H2-type   95.7  0.0057 1.2E-07   29.0   1.0   22   21-42      1-22  (24)
  3 PF00096 zf-C2H2:  Zinc finger,  94.4   0.017 3.7E-07   28.3   0.7   23   21-43      1-23  (23)
  4 smart00355 ZnF_C2H2 zinc finge  91.4    0.16 3.4E-06   23.7   1.6   21   21-41      1-21  (26)
  5 PHA00732 hypothetical protein   88.0    0.28   6E-06   31.9   1.2   28   21-48      2-38  (79)
  6 PHA00616 hypothetical protein   85.7    0.32   7E-06   29.6   0.5   24   21-44      2-25  (44)
  7 PF05253 zf-U11-48K:  U11-48K-l  84.1    0.91   2E-05   24.3   1.8   20   26-45      5-27  (27)
  8 cd00608 GalT Galactose-1-phosp  76.6     3.1 6.7E-05   32.0   3.2   20   59-78     82-101 (329)
  9 PF15269 zf-C2H2_7:  Zinc-finge  76.3     1.8   4E-05   27.9   1.6   26   16-41     16-41  (54)
 10 PF13913 zf-C2HC_2:  zinc-finge  75.3     2.5 5.3E-05   22.3   1.7   24   20-44      2-25  (25)
 11 COG2888 Predicted Zn-ribbon RN  72.6     1.5 3.3E-05   28.8   0.5   13   18-30     48-60  (61)
 12 PF08209 Sgf11:  Sgf11 (transcr  72.3     2.2 4.8E-05   24.5   1.1   25   19-44      3-27  (33)
 13 PRK11720 galactose-1-phosphate  70.4       4 8.8E-05   32.3   2.6   21   57-77     92-112 (346)
 14 PHA00733 hypothetical protein   69.0     1.8   4E-05   29.9   0.3   23   19-41     72-94  (128)
 15 PF05605 zf-Di19:  Drought indu  65.7     5.7 0.00012   23.2   1.9   23   20-43      2-24  (54)
 16 PF07754 DUF1610:  Domain of un  65.1     2.9 6.2E-05   22.8   0.5   10   19-28     15-24  (24)
 17 PRK14890 putative Zn-ribbon RN  57.2     4.6 9.9E-05   26.2   0.5   13   17-29     45-57  (59)
 18 smart00734 ZnF_Rad18 Rad18-lik  56.5     9.4  0.0002   20.4   1.6   22   21-43      2-23  (26)
 19 PF12756 zf-C2H2_2:  C2H2 type   55.5     6.3 0.00014   23.3   0.9   24   20-43     50-73  (100)
 20 TIGR00209 galT_1 galactose-1-p  54.2      20 0.00044   28.5   3.8   20   59-78     94-113 (347)
 21 PF02176 zf-TRAF:  TRAF-type zi  52.0     6.4 0.00014   22.5   0.5   26   21-46     10-37  (60)
 22 cd07322 PriL_PriS_Eukaryotic E  48.3     9.2  0.0002   31.1   1.1   37   17-53    314-373 (390)
 23 PLN03086 PRLI-interacting fact  46.4      13 0.00028   32.3   1.8   10   35-44    529-538 (567)
 24 PF13912 zf-C2H2_6:  C2H2-type   43.7     9.1  0.0002   19.0   0.3   20   21-40      2-21  (27)
 25 COG1326 Uncharacterized archae  42.5     9.1  0.0002   29.9   0.2   12   20-31      6-17  (201)
 26 PRK06266 transcription initiat  42.2      11 0.00024   27.4   0.6   13   15-27    112-124 (178)
 27 KOG2462|consensus               38.7      18  0.0004   29.3   1.4   31   18-48    159-198 (279)
 28 PF05129 Elf1:  Transcription e  37.7      12 0.00026   24.4   0.2   24   13-36     15-38  (81)
 29 TIGR00373 conserved hypothetic  37.2      15 0.00032   26.1   0.6   14   15-28    104-117 (158)
 30 PRK08351 DNA-directed RNA poly  36.3      18  0.0004   23.2   0.9    9   22-30     17-25  (61)
 31 PHA02768 hypothetical protein;  36.2      29 0.00062   21.9   1.7   30   18-47      3-32  (55)
 32 KOG3970|consensus               35.4      21 0.00045   29.4   1.3   15   16-30     90-104 (299)
 33 KOG1146|consensus               35.1      19  0.0004   34.9   1.0   32   17-48    515-546 (1406)
 34 PRK00464 nrdR transcriptional   34.6      15 0.00033   26.6   0.4   13   20-32     28-40  (154)
 35 PF04423 Rad50_zn_hook:  Rad50   34.3      16 0.00034   21.4   0.3   20   22-41     22-43  (54)
 36 PF06093 Spt4:  Spt4/RpoE2 zinc  34.1      12 0.00027   24.5  -0.2    7   22-28     20-26  (77)
 37 TIGR00244 transcriptional regu  34.1      15 0.00032   27.2   0.2   28   22-49      2-40  (147)
 38 PF08149 BING4CT:  BING4CT (NUC  33.0      10 0.00022   25.8  -0.7   13   20-32     12-24  (80)
 39 PRK15202 type III secretion ch  33.0      19 0.00042   26.3   0.6   13   22-34     43-55  (117)
 40 PRK14892 putative transcriptio  32.5      12 0.00027   25.6  -0.4   36   15-51     16-56  (99)
 41 COG1997 RPL43A Ribosomal prote  31.0      24 0.00052   24.6   0.8   13   17-29     32-44  (89)
 42 COG1085 GalT Galactose-1-phosp  30.6      56  0.0012   26.9   3.0   22   56-77     80-101 (338)
 43 PF03470 zf-XS:  XS zinc finger  30.4      23  0.0005   21.6   0.6    8   23-30      1-8   (43)
 44 COG1327 Predicted transcriptio  29.6      24 0.00052   26.6   0.7   28   22-49      2-40  (156)
 45 smart00531 TFIIE Transcription  29.3      22 0.00048   24.5   0.5   14   15-28     94-107 (147)
 46 PF09237 GAGA:  GAGA factor;  I  29.2      28 0.00062   22.5   0.9   25   20-44     24-49  (54)
 47 PF14206 Cys_rich_CPCC:  Cystei  28.5      34 0.00073   22.7   1.2   20   14-33     12-33  (78)
 48 KOG2817|consensus               28.4      26 0.00057   29.6   0.8   13   20-32    374-386 (394)
 49 PF07150 DUF1390:  Protein of u  27.8      14  0.0003   28.9  -0.9   25   19-44      6-31  (229)
 50 TIGR00269 conserved hypothetic  27.3      65  0.0014   21.1   2.4   32   17-49     23-54  (104)
 51 PF10650 zf-C3H1:  Putative zin  27.1      31 0.00068   18.7   0.7    9   24-32      1-9   (23)
 52 TIGR01367 pyrE_Therm orotate p  26.5      24 0.00052   25.3   0.2    9   19-27    168-176 (187)
 53 PF07282 OrfB_Zn_ribbon:  Putat  26.1      27 0.00059   20.7   0.4   17   17-33     43-59  (69)
 54 KOG3715|consensus               26.0 1.2E+02  0.0026   25.6   4.2   37   41-79    123-159 (344)
 55 PF02591 DUF164:  Putative zinc  24.8      19 0.00042   21.2  -0.4   24    4-27     30-53  (56)
 56 PF14846 DUF4485:  Domain of un  24.7      56  0.0012   21.2   1.7   43   23-66     39-83  (85)
 57 PLN02821 1-hydroxy-2-methyl-2-  23.6      39 0.00085   29.0   1.0   14   62-75    108-121 (460)
 58 KOG3940|consensus               23.5      29 0.00063   29.2   0.2   30   18-48    128-157 (351)
 59 PLN03086 PRLI-interacting fact  23.2      38 0.00083   29.5   0.9   20   22-42    455-474 (567)
 60 PLN03238 probable histone acet  23.0      49  0.0011   26.9   1.4   37   17-53     45-81  (290)
 61 PF13465 zf-H2C2_2:  Zinc-finge  22.9      24 0.00052   18.1  -0.3    9   19-27     13-21  (26)
 62 smart00661 RPOL9 RNA polymeras  22.9      17 0.00037   20.3  -0.9   20   20-39     20-40  (52)
 63 PF12705 PDDEXK_1:  PD-(D/E)XK   22.7      40 0.00087   21.8   0.7   14   17-30    241-254 (257)
 64 PF13719 zinc_ribbon_5:  zinc-r  22.3      36 0.00078   19.0   0.4   13   21-33      3-15  (37)
 65 PRK01045 ispH 4-hydroxy-3-meth  22.2      44 0.00096   26.5   1.0   14   62-75      3-16  (298)
 66 KOG2612|consensus               22.1      61  0.0013   23.2   1.6   30   14-44     68-97  (103)
 67 KOG2324|consensus               22.1      30 0.00065   30.0   0.0   26   20-45    227-252 (457)
 68 smart00224 GGL G protein gamma  21.9      55  0.0012   20.2   1.2   27   45-74     37-63  (63)
 69 KOG3348|consensus               21.6      46 0.00099   23.0   0.8   12   31-42     44-55  (85)
 70 PRK14821 putative deoxyribonuc  21.4      50  0.0011   24.0   1.0   31   26-72     40-70  (184)
 71 cd00924 Cyt_c_Oxidase_Vb Cytoc  21.4      45 0.00098   22.7   0.8   22    5-27     64-86  (97)
 72 COG0675 Transposase and inacti  20.8      39 0.00084   23.5   0.4   16   19-34    321-336 (364)
 73 PF10571 UPF0547:  Uncharacteri  20.7      52  0.0011   17.7   0.8   14   17-30     11-24  (26)
 74 PRK14826 putative deoxyribonuc  20.5      55  0.0012   24.7   1.1   12   61-72     78-89  (222)
 75 COG1675 TFA1 Transcription ini  20.5      46 0.00099   24.9   0.7   13   15-27    108-120 (176)
 76 PF10855 DUF2648:  Protein of u  20.2      24 0.00053   20.9  -0.6   15   44-58     18-32  (33)
 77 smart00525 FES FES domain. iro  20.1      61  0.0013   16.4   0.9   15   19-33      5-19  (26)

No 1  
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.86  E-value=0.00043  Score=34.95  Aligned_cols=21  Identities=38%  Similarity=0.868  Sum_probs=17.0

Q ss_pred             CCCCCCccccccchhhhhhHHH
Q psy4190          21 HQCPSCLFEDNQKGKLTRHLLS   42 (90)
Q Consensus        21 HQCP~CPFEDN~KgKLtRH~is   42 (90)
                      |+|+.|+|..+ +..|.+|+..
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~   21 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKR   21 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHh
Confidence            68999999999 9999999853


No 2  
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=95.65  E-value=0.0057  Score=28.99  Aligned_cols=22  Identities=32%  Similarity=0.578  Sum_probs=18.6

Q ss_pred             CCCCCCccccccchhhhhhHHH
Q psy4190          21 HQCPSCLFEDNQKGKLTRHLLS   42 (90)
Q Consensus        21 HQCP~CPFEDN~KgKLtRH~is   42 (90)
                      |+|+.|++.-+.+..|.+|+..
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~   22 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRT   22 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHh
Confidence            6899999999999999999975


No 3  
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=94.40  E-value=0.017  Score=28.33  Aligned_cols=23  Identities=30%  Similarity=0.515  Sum_probs=20.8

Q ss_pred             CCCCCCccccccchhhhhhHHHh
Q psy4190          21 HQCPSCLFEDNQKGKLTRHLLSC   43 (90)
Q Consensus        21 HQCP~CPFEDN~KgKLtRH~isC   43 (90)
                      |+|+.|...-+.++.|.+|+..|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999763


No 4  
>smart00355 ZnF_C2H2 zinc finger.
Probab=91.39  E-value=0.16  Score=23.73  Aligned_cols=21  Identities=29%  Similarity=0.498  Sum_probs=19.5

Q ss_pred             CCCCCCccccccchhhhhhHH
Q psy4190          21 HQCPSCLFEDNQKGKLTRHLL   41 (90)
Q Consensus        21 HQCP~CPFEDN~KgKLtRH~i   41 (90)
                      ++|+.|...-+.+..|.+|+.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH
Confidence            689999999999999999986


No 5  
>PHA00732 hypothetical protein
Probab=87.96  E-value=0.28  Score=31.90  Aligned_cols=28  Identities=36%  Similarity=0.688  Sum_probs=24.3

Q ss_pred             CCCCCCccccccchhhhhhHHH---------hhhhcc
Q psy4190          21 HQCPSCLFEDNQKGKLTRHLLS---------CAKKYR   48 (90)
Q Consensus        21 HQCP~CPFEDN~KgKLtRH~is---------CaKKF~   48 (90)
                      |+|+.|...-+.++.|.+|+..         |+|.|.
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~~~~C~~CgKsF~   38 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHTLTKCPVCNKSYR   38 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccCCCccCCCCCEeC
Confidence            6899999999999999999864         777776


No 6  
>PHA00616 hypothetical protein
Probab=85.71  E-value=0.32  Score=29.63  Aligned_cols=24  Identities=33%  Similarity=0.366  Sum_probs=21.7

Q ss_pred             CCCCCCccccccchhhhhhHHHhh
Q psy4190          21 HQCPSCLFEDNQKGKLTRHLLSCA   44 (90)
Q Consensus        21 HQCP~CPFEDN~KgKLtRH~isCa   44 (90)
                      +|||-|.-.-..|+-|++|+.+=.
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~h   25 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVH   25 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhc
Confidence            799999999999999999997644


No 7  
>PF05253 zf-U11-48K:  U11-48K-like CHHC zinc finger;  InterPro: IPR022776  This zinc binding domain [] has four conserved zinc chelating residues in a CHHC pattern. This domain is predicted to have an RNA-binding function []. ; PDB: 2VY5_A 2VY4_A.
Probab=84.05  E-value=0.91  Score=24.33  Aligned_cols=20  Identities=20%  Similarity=0.703  Sum_probs=14.6

Q ss_pred             Cccccc---cchhhhhhHHHhhh
Q psy4190          26 CLFEDN---QKGKLTRHLLSCAK   45 (90)
Q Consensus        26 CPFEDN---~KgKLtRH~isCaK   45 (90)
                      |||..+   -+.+|.+|+..|.+
T Consensus         5 CPyn~~H~v~~~~l~~Hi~~C~~   27 (27)
T PF05253_consen    5 CPYNPSHRVPASELQKHIKKCPD   27 (27)
T ss_dssp             -TTTSS-EEEGGGHHHHHHHHH-
T ss_pred             CCCCCCcCcCHHHHHHHHHHcCC
Confidence            666554   57899999999975


No 8  
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate. The structure of E.coli GalT reveals that the enzyme contains two identical subunits. It also demonstrates that the active site is formed by amino acid residues from both subunits of the dimer.
Probab=76.65  E-value=3.1  Score=32.01  Aligned_cols=20  Identities=40%  Similarity=0.524  Sum_probs=17.4

Q ss_pred             CCeeEeecCCceeEEEEeee
Q psy4190          59 GPLFTIAEDSGFCWVLQFSL   78 (90)
Q Consensus        59 ~~~~~~~~~~~~~~~~~~~~   78 (90)
                      .+||......|.|-|+-||=
T Consensus        82 ~~l~~~~~~~G~~eVii~sp  101 (329)
T cd00608          82 DGLFRTAPARGRCEVICFSP  101 (329)
T ss_pred             CcccccCCcceeEEEEEECC
Confidence            57899999999999998873


No 9  
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=76.28  E-value=1.8  Score=27.92  Aligned_cols=26  Identities=31%  Similarity=0.502  Sum_probs=22.6

Q ss_pred             cCCCCCCCCCCccccccchhhhhhHH
Q psy4190          16 KAPAFHQCPSCLFEDNQKGKLTRHLL   41 (90)
Q Consensus        16 r~p~~HQCP~CPFEDN~KgKLtRH~i   41 (90)
                      --|-.|||=.|||.-|.|+.|-.||.
T Consensus        16 gkp~~ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   16 GKPFKYKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             CCCccceeecCCcccchHHHHHHHHH
Confidence            34567999999999999999999984


No 10 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=75.34  E-value=2.5  Score=22.26  Aligned_cols=24  Identities=25%  Similarity=0.523  Sum_probs=18.1

Q ss_pred             CCCCCCCccccccchhhhhhHHHhh
Q psy4190          20 FHQCPSCLFEDNQKGKLTRHLLSCA   44 (90)
Q Consensus        20 ~HQCP~CPFEDN~KgKLtRH~isCa   44 (90)
                      ..+||.|.=.- ....|.+|+..|.
T Consensus         2 l~~C~~CgR~F-~~~~l~~H~~~C~   25 (25)
T PF13913_consen    2 LVPCPICGRKF-NPDRLEKHEKICK   25 (25)
T ss_pred             CCcCCCCCCEE-CHHHHHHHHHhcC
Confidence            46899997554 4567999999884


No 11 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=72.55  E-value=1.5  Score=28.82  Aligned_cols=13  Identities=38%  Similarity=0.784  Sum_probs=10.1

Q ss_pred             CCCCCCCCCcccc
Q psy4190          18 PAFHQCPSCLFED   30 (90)
Q Consensus        18 p~~HQCP~CPFED   30 (90)
                      -.-|+||+|.||-
T Consensus        48 g~~Y~Cp~CGF~G   60 (61)
T COG2888          48 GNPYRCPKCGFEG   60 (61)
T ss_pred             CCceECCCcCccC
Confidence            3568999999973


No 12 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=72.27  E-value=2.2  Score=24.48  Aligned_cols=25  Identities=24%  Similarity=0.646  Sum_probs=18.8

Q ss_pred             CCCCCCCCccccccchhhhhhHHHhh
Q psy4190          19 AFHQCPSCLFEDNQKGKLTRHLLSCA   44 (90)
Q Consensus        19 ~~HQCP~CPFEDN~KgKLtRH~isCa   44 (90)
                      .+.+||||.= .=..+..+-|+-.|.
T Consensus         3 ~~~~C~nC~R-~v~a~RfA~HLekCm   27 (33)
T PF08209_consen    3 PYVECPNCGR-PVAASRFAPHLEKCM   27 (33)
T ss_dssp             -EEE-TTTSS-EEEGGGHHHHHHHHT
T ss_pred             CeEECCCCcC-CcchhhhHHHHHHHH
Confidence            5689999986 345688999999996


No 13 
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional
Probab=70.44  E-value=4  Score=32.32  Aligned_cols=21  Identities=33%  Similarity=0.571  Sum_probs=17.4

Q ss_pred             CCCCeeEeecCCceeEEEEee
Q psy4190          57 GEGPLFTIAEDSGFCWVLQFS   77 (90)
Q Consensus        57 ~~~~~~~~~~~~~~~~~~~~~   77 (90)
                      .+.++|......|.|-|+-||
T Consensus        92 ~~~~l~~~~~~~G~~eViv~s  112 (346)
T PRK11720         92 SDDPLFRCQSARGTSRVICFS  112 (346)
T ss_pred             ccCcccccCccceEEEEEEEC
Confidence            335688888899999999887


No 14 
>PHA00733 hypothetical protein
Probab=68.98  E-value=1.8  Score=29.86  Aligned_cols=23  Identities=26%  Similarity=0.478  Sum_probs=19.9

Q ss_pred             CCCCCCCCccccccchhhhhhHH
Q psy4190          19 AFHQCPSCLFEDNQKGKLTRHLL   41 (90)
Q Consensus        19 ~~HQCP~CPFEDN~KgKLtRH~i   41 (90)
                      ..++|+.|+-.-..++.|.+|+.
T Consensus        72 kPy~C~~Cgk~Fss~s~L~~H~r   94 (128)
T PHA00733         72 SPYVCPLCLMPFSSSVSLKQHIR   94 (128)
T ss_pred             CCccCCCCCCcCCCHHHHHHHHh
Confidence            34799999999999999999986


No 15 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=65.69  E-value=5.7  Score=23.23  Aligned_cols=23  Identities=22%  Similarity=0.300  Sum_probs=17.3

Q ss_pred             CCCCCCCccccccchhhhhhHHHh
Q psy4190          20 FHQCPSCLFEDNQKGKLTRHLLSC   43 (90)
Q Consensus        20 ~HQCP~CPFEDN~KgKLtRH~isC   43 (90)
                      .+.||.|.- +=....|.+|+..-
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~   24 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDE   24 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhH
Confidence            478999998 44556799997653


No 16 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=65.14  E-value=2.9  Score=22.84  Aligned_cols=10  Identities=40%  Similarity=1.002  Sum_probs=8.1

Q ss_pred             CCCCCCCCcc
Q psy4190          19 AFHQCPSCLF   28 (90)
Q Consensus        19 ~~HQCP~CPF   28 (90)
                      .-|.||+|.|
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4588999976


No 17 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=57.20  E-value=4.6  Score=26.16  Aligned_cols=13  Identities=38%  Similarity=0.789  Sum_probs=9.8

Q ss_pred             CCCCCCCCCCccc
Q psy4190          17 APAFHQCPSCLFE   29 (90)
Q Consensus        17 ~p~~HQCP~CPFE   29 (90)
                      --..|.||+|.|+
T Consensus        45 ~~~~Y~CP~CGF~   57 (59)
T PRK14890         45 QSNPYTCPKCGFE   57 (59)
T ss_pred             cCCceECCCCCCc
Confidence            3456889999887


No 18 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=56.46  E-value=9.4  Score=20.36  Aligned_cols=22  Identities=41%  Similarity=0.786  Sum_probs=16.8

Q ss_pred             CCCCCCccccccchhhhhhHHHh
Q psy4190          21 HQCPSCLFEDNQKGKLTRHLLSC   43 (90)
Q Consensus        21 HQCP~CPFEDN~KgKLtRH~isC   43 (90)
                      -+||-|-=.- ....+.+|+-+|
T Consensus         2 v~CPiC~~~v-~~~~in~HLD~C   23 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLDSC   23 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHHHh
Confidence            3799995554 457899999988


No 19 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=55.54  E-value=6.3  Score=23.29  Aligned_cols=24  Identities=25%  Similarity=0.401  Sum_probs=20.8

Q ss_pred             CCCCCCCccccccchhhhhhHHHh
Q psy4190          20 FHQCPSCLFEDNQKGKLTRHLLSC   43 (90)
Q Consensus        20 ~HQCP~CPFEDN~KgKLtRH~isC   43 (90)
                      .+.|+.|...-.....|.+||.+=
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            489999999999999999999863


No 20 
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1. This enzyme is involved in glucose and galactose interconversion. This model describes one of two extremely distantly related branches of the model pfam01087 from PFAM.
Probab=54.17  E-value=20  Score=28.46  Aligned_cols=20  Identities=30%  Similarity=0.420  Sum_probs=17.0

Q ss_pred             CCeeEeecCCceeEEEEeee
Q psy4190          59 GPLFTIAEDSGFCWVLQFSL   78 (90)
Q Consensus        59 ~~~~~~~~~~~~~~~~~~~~   78 (90)
                      .+||......|.|-|+-||=
T Consensus        94 ~~l~~~~~~~G~~eVii~sp  113 (347)
T TIGR00209        94 DPLMRCQSARGTSRVICFSP  113 (347)
T ss_pred             CcccccCCCCeeEEEEEeCC
Confidence            56888888999999998863


No 21 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=51.97  E-value=6.4  Score=22.47  Aligned_cols=26  Identities=35%  Similarity=0.691  Sum_probs=18.2

Q ss_pred             CCCCC-CccccccchhhhhhHH-Hhhhh
Q psy4190          21 HQCPS-CLFEDNQKGKLTRHLL-SCAKK   46 (90)
Q Consensus        21 HQCP~-CPFEDN~KgKLtRH~i-sCaKK   46 (90)
                      -+||+ |--+.-.+..|..|+. .|.++
T Consensus        10 v~C~~~cc~~~i~r~~l~~H~~~~C~~~   37 (60)
T PF02176_consen   10 VPCPNGCCNEMIPRKELDDHLENECPKR   37 (60)
T ss_dssp             EE-TT--S-BEEECCCHHHHHHTTSTTS
T ss_pred             eeCCCCCcccceeHHHHHHHHHccCCCC
Confidence            46777 5556667889999999 89876


No 22 
>cd07322 PriL_PriS_Eukaryotic Eukaryotic core primase: Large subunit, PriL. Primases synthesize the RNA primers required for DNA replication. Primases are grouped into two classes, bacteria/bacteriophage and archaeal/eukaryotic. The proteins in the two classes differ in structure and the replication apparatus components. Archaeal/eukaryotic core primase is a heterodimeric enzyme consisting of a small catalytic subunit (PriS) and a large subunit (PriL). In eukaryotic organisms, a heterotetrameric enzyme formed by DNA polymerase alpha, the B subunit and two primase subunits has primase activity. Although the catalytic activity resides within PriS, the PriL subunit is essential for primase function as disruption of the PriL gene in yeast is lethal. PriL is composed of two structural domains. Several functions have been proposed for PriL such as stabilization of the PriS, involvement in synthesis initiation, improvement of primase processivity, determination of product size and transfer of 
Probab=48.27  E-value=9.2  Score=31.09  Aligned_cols=37  Identities=24%  Similarity=0.464  Sum_probs=25.8

Q ss_pred             CCCCCCCCCCcccc----ccchhhhhh-------------------HHHhhhhccCCccC
Q psy4190          17 APAFHQCPSCLFED----NQKGKLTRH-------------------LLSCAKKYRPERNQ   53 (90)
Q Consensus        17 ~p~~HQCP~CPFED----N~KgKLtRH-------------------~isCaKKF~pe~Nl   53 (90)
                      +|..-+|--|||-+    +.+.+|...                   +++|.|.|.---+-
T Consensus       314 ~p~~g~~HGCPfr~~~~~~L~~~L~~~~~~~~~i~~I~~~~~~~~yq~AC~~~Fe~~h~~  373 (390)
T cd07322         314 PPGPGDCHGCPFRHFDSDSLKQLLQSYGLSDSDIEEIIDLVKSGHYQLACTKYFELTHPG  373 (390)
T ss_pred             CCCCCCcCCCCCCCCCHHHHHHHHHhcCCCHHHHHHHHHHHhcCCccHHHHHHHHHHcCC
Confidence            47777888888865    455555554                   67999999755443


No 23 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=46.41  E-value=13  Score=32.26  Aligned_cols=10  Identities=20%  Similarity=0.498  Sum_probs=5.5

Q ss_pred             hhhhhHHHhh
Q psy4190          35 KLTRHLLSCA   44 (90)
Q Consensus        35 KLtRH~isCa   44 (90)
                      .|+.|...|.
T Consensus       529 ~Lt~HE~~CG  538 (567)
T PLN03086        529 GMSEHESICG  538 (567)
T ss_pred             hHHHHHHhcC
Confidence            5555655553


No 24 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=43.74  E-value=9.1  Score=18.96  Aligned_cols=20  Identities=20%  Similarity=0.316  Sum_probs=17.5

Q ss_pred             CCCCCCccccccchhhhhhH
Q psy4190          21 HQCPSCLFEDNQKGKLTRHL   40 (90)
Q Consensus        21 HQCP~CPFEDN~KgKLtRH~   40 (90)
                      |+|..|.-.-+....|.+|+
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~   21 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHK   21 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHH
T ss_pred             CCCCccCCccCChhHHHHHh
Confidence            78999988888888899997


No 25 
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=42.46  E-value=9.1  Score=29.87  Aligned_cols=12  Identities=42%  Similarity=0.952  Sum_probs=10.2

Q ss_pred             CCCCCCCccccc
Q psy4190          20 FHQCPSCLFEDN   31 (90)
Q Consensus        20 ~HQCP~CPFEDN   31 (90)
                      |.+||+|.+|+-
T Consensus         6 y~~Cp~Cg~eev   17 (201)
T COG1326           6 YIECPSCGSEEV   17 (201)
T ss_pred             EEECCCCCcchh
Confidence            679999998876


No 26 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=42.16  E-value=11  Score=27.42  Aligned_cols=13  Identities=38%  Similarity=0.943  Sum_probs=10.6

Q ss_pred             ccCCCCCCCCCCc
Q psy4190          15 EKAPAFHQCPSCL   27 (90)
Q Consensus        15 Er~p~~HQCP~CP   27 (90)
                      |..+.||.||+|.
T Consensus       112 e~~~~~Y~Cp~C~  124 (178)
T PRK06266        112 EENNMFFFCPNCH  124 (178)
T ss_pred             ccCCCEEECCCCC
Confidence            4568899999995


No 27 
>KOG2462|consensus
Probab=38.72  E-value=18  Score=29.29  Aligned_cols=31  Identities=19%  Similarity=0.321  Sum_probs=25.8

Q ss_pred             CCCCCCCCCccccccchhhhhhHHH---------hhhhcc
Q psy4190          18 PAFHQCPSCLFEDNQKGKLTRHLLS---------CAKKYR   48 (90)
Q Consensus        18 p~~HQCP~CPFEDN~KgKLtRH~is---------CaKKF~   48 (90)
                      +.-++|+.|+=+--..+-|++|+..         |+|.|.
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFS  198 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFS  198 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccCCCccccccccccc
Confidence            5667899999999999999999863         788884


No 28 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=37.65  E-value=12  Score=24.43  Aligned_cols=24  Identities=29%  Similarity=0.573  Sum_probs=8.3

Q ss_pred             ccccCCCCCCCCCCccccccchhh
Q psy4190          13 RLEKAPAFHQCPSCLFEDNQKGKL   36 (90)
Q Consensus        13 RlEr~p~~HQCP~CPFEDN~KgKL   36 (90)
                      +..+.|..++||+|--++..--++
T Consensus        15 ~~~~l~~~F~CPfC~~~~sV~v~i   38 (81)
T PF05129_consen   15 KKPKLPKVFDCPFCNHEKSVSVKI   38 (81)
T ss_dssp             -----SS----TTT--SS-EEEEE
T ss_pred             cCCCCCceEcCCcCCCCCeEEEEE
Confidence            355778999999999776554444


No 29 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=37.20  E-value=15  Score=26.06  Aligned_cols=14  Identities=29%  Similarity=0.584  Sum_probs=11.2

Q ss_pred             ccCCCCCCCCCCcc
Q psy4190          15 EKAPAFHQCPSCLF   28 (90)
Q Consensus        15 Er~p~~HQCP~CPF   28 (90)
                      +..+.+|.||+|.-
T Consensus       104 e~~~~~Y~Cp~c~~  117 (158)
T TIGR00373       104 ETNNMFFICPNMCV  117 (158)
T ss_pred             ccCCCeEECCCCCc
Confidence            44689999999973


No 30 
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=36.28  E-value=18  Score=23.21  Aligned_cols=9  Identities=44%  Similarity=1.073  Sum_probs=8.0

Q ss_pred             CCCCCcccc
Q psy4190          22 QCPSCLFED   30 (90)
Q Consensus        22 QCP~CPFED   30 (90)
                      +||+|..+|
T Consensus        17 ~CP~Cgs~~   25 (61)
T PRK08351         17 RCPVCGSRD   25 (61)
T ss_pred             cCCCCcCCc
Confidence            799999877


No 31 
>PHA02768 hypothetical protein; Provisional
Probab=36.17  E-value=29  Score=21.92  Aligned_cols=30  Identities=17%  Similarity=0.173  Sum_probs=24.2

Q ss_pred             CCCCCCCCCccccccchhhhhhHHHhhhhc
Q psy4190          18 PAFHQCPSCLFEDNQKGKLTRHLLSCAKKY   47 (90)
Q Consensus        18 p~~HQCP~CPFEDN~KgKLtRH~isCaKKF   47 (90)
                      .--|+|+-|.=.-..+.-|++|+..=.|.|
T Consensus         3 ~~~y~C~~CGK~Fs~~~~L~~H~r~H~k~~   32 (55)
T PHA02768          3 LLGYECPICGEIYIKRKSMITHLRKHNTNL   32 (55)
T ss_pred             ccccCcchhCCeeccHHHHHHHHHhcCCcc
Confidence            345799999999999999999998755433


No 32 
>KOG3970|consensus
Probab=35.43  E-value=21  Score=29.38  Aligned_cols=15  Identities=53%  Similarity=0.747  Sum_probs=12.7

Q ss_pred             cCCCCCCCCCCcccc
Q psy4190          16 KAPAFHQCPSCLFED   30 (90)
Q Consensus        16 r~p~~HQCP~CPFED   30 (90)
                      -||+-||||.|--|-
T Consensus        90 TAPaGyqCP~Cs~ei  104 (299)
T KOG3970|consen   90 TAPAGYQCPCCSQEI  104 (299)
T ss_pred             CCCCcccCCCCCCcc
Confidence            489999999997764


No 33 
>KOG1146|consensus
Probab=35.09  E-value=19  Score=34.90  Aligned_cols=32  Identities=22%  Similarity=0.396  Sum_probs=27.1

Q ss_pred             CCCCCCCCCCccccccchhhhhhHHHhhhhcc
Q psy4190          17 APAFHQCPSCLFEDNQKGKLTRHLLSCAKKYR   48 (90)
Q Consensus        17 ~p~~HQCP~CPFEDN~KgKLtRH~isCaKKF~   48 (90)
                      +=.-++|-.|-.+.-.|++|.+||.+|--+=.
T Consensus       515 ~~~p~~C~~C~~stttng~LsihlqS~~h~~~  546 (1406)
T KOG1146|consen  515 PGKPYPCRACNYSTTTNGNLSIHLQSDLHRNE  546 (1406)
T ss_pred             CCCcccceeeeeeeecchHHHHHHHHHhhHHH
Confidence            44568999999999999999999999965543


No 34 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=34.55  E-value=15  Score=26.61  Aligned_cols=13  Identities=15%  Similarity=0.248  Sum_probs=9.8

Q ss_pred             CCCCCCCcccccc
Q psy4190          20 FHQCPSCLFEDNQ   32 (90)
Q Consensus        20 ~HQCP~CPFEDN~   32 (90)
                      ++|||+|.+--+.
T Consensus        28 ~~~c~~c~~~f~~   40 (154)
T PRK00464         28 RRECLACGKRFTT   40 (154)
T ss_pred             eeeccccCCcceE
Confidence            5999999875443


No 35 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=34.33  E-value=16  Score=21.39  Aligned_cols=20  Identities=20%  Similarity=0.680  Sum_probs=13.9

Q ss_pred             CCCCC--ccccccchhhhhhHH
Q psy4190          22 QCPSC--LFEDNQKGKLTRHLL   41 (90)
Q Consensus        22 QCP~C--PFEDN~KgKLtRH~i   41 (90)
                      -||.|  ||.+.-+.+|.++..
T Consensus        22 ~CPlC~r~l~~e~~~~li~~~~   43 (54)
T PF04423_consen   22 CCPLCGRPLDEEHRQELIKKYK   43 (54)
T ss_dssp             E-TTT--EE-HHHHHHHHHHHH
T ss_pred             cCCCCCCCCCHHHHHHHHHHHH
Confidence            79999  688887777777654


No 36 
>PF06093 Spt4:  Spt4/RpoE2 zinc finger;  InterPro: IPR022800  This entry consists of several eukaryotic transcription elongation Spt4 proteins as well as archaebacterial RpoE2 []. Three transcription-elongation factors Spt4, Spt5, and Spt6 are conserved among eukaryotes and are essential for transcription via the modulation of chromatin structure. Spt4 and Spt5 are tightly associated in a complex, while the physical association of the Spt4-Spt5 complex with Spt6 is considerably weaker. It has been demonstrated that Spt4, Spt5, and Spt6 play roles in transcription elongation in both yeast and humans including a role in activation by Tat. It is known that Spt4, Spt5, and Spt6 are general transcription-elongation factors, controlling transcription both positively and negatively in important regulatory and developmental roles []. RpoE2 is one of 13 subunits in the archaeal RNA polymerase. These proteins contain a C4-type zinc finger, and the structure has been solved in []. The structure reveals that Spt4-Spt5 binding is governed by an acid-dipole interaction between Spt5 and Spt4, and the complex binds to and travels along the elongating RNA polymerase. The Spt4-Spt5 complex is likely to be an ancient, core component of the transcription elongation machinery. ; PDB: 2EXU_A 3H7H_A 3LPE_F 3P8B_A 1RYQ_A 3QQC_E.
Probab=34.14  E-value=12  Score=24.47  Aligned_cols=7  Identities=57%  Similarity=1.673  Sum_probs=4.0

Q ss_pred             CCCCCcc
Q psy4190          22 QCPSCLF   28 (90)
Q Consensus        22 QCP~CPF   28 (90)
                      .||||+|
T Consensus        20 gCpnC~~   26 (77)
T PF06093_consen   20 GCPNCPF   26 (77)
T ss_dssp             --TTTHH
T ss_pred             CCCCCcc
Confidence            5999954


No 37 
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=34.08  E-value=15  Score=27.24  Aligned_cols=28  Identities=21%  Similarity=0.657  Sum_probs=19.2

Q ss_pred             CCCCCcccccc-----------chhhhhhHHHhhhhccC
Q psy4190          22 QCPSCLFEDNQ-----------KGKLTRHLLSCAKKYRP   49 (90)
Q Consensus        22 QCP~CPFEDN~-----------KgKLtRH~isCaKKF~p   49 (90)
                      +||+|..+|..           .-+=.|.=.+|.++|.-
T Consensus         2 ~CP~C~~~dtkViDSR~~~dg~~IRRRReC~~C~~RFTT   40 (147)
T TIGR00244         2 HCPFCQHHNTRVLDSRLVEDGQSIRRRRECLECHERFTT   40 (147)
T ss_pred             CCCCCCCCCCEeeeccccCCCCeeeecccCCccCCccce
Confidence            69999986542           12234677899999964


No 38 
>PF08149 BING4CT:  BING4CT (NUC141) domain;  InterPro: IPR012952 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [, ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events. This C-terminal domain is found in the BING4 family of nucleolar WD40 repeat proteins [].
Probab=33.05  E-value=10  Score=25.80  Aligned_cols=13  Identities=31%  Similarity=0.416  Sum_probs=9.6

Q ss_pred             CCCCCCCcccccc
Q psy4190          20 FHQCPSCLFEDNQ   32 (90)
Q Consensus        20 ~HQCP~CPFEDN~   32 (90)
                      -..+-+|||||=.
T Consensus        12 v~~~~F~PfEDvL   24 (80)
T PF08149_consen   12 VESLRFCPFEDVL   24 (80)
T ss_pred             eeeeEEechHHee
Confidence            3567789999953


No 39 
>PRK15202 type III secretion chaperone protein SigE; Provisional
Probab=33.03  E-value=19  Score=26.26  Aligned_cols=13  Identities=31%  Similarity=0.401  Sum_probs=10.9

Q ss_pred             CCCCCccccccch
Q psy4190          22 QCPSCLFEDNQKG   34 (90)
Q Consensus        22 QCP~CPFEDN~Kg   34 (90)
                      -||+||+-||.-.
T Consensus        43 ~CPf~~LPdn~~~   55 (117)
T PRK15202         43 CCPFMPLPDNILT   55 (117)
T ss_pred             cCCcccCCccHHH
Confidence            5999999999653


No 40 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=32.48  E-value=12  Score=25.63  Aligned_cols=36  Identities=22%  Similarity=0.286  Sum_probs=22.1

Q ss_pred             ccCCCCCCCCCCcccccc-----chhhhhhHHHhhhhccCCc
Q psy4190          15 EKAPAFHQCPSCLFEDNQ-----KGKLTRHLLSCAKKYRPER   51 (90)
Q Consensus        15 Er~p~~HQCP~CPFEDN~-----KgKLtRH~isCaKKF~pe~   51 (90)
                      .+.|.++.||+|. +.-.     |++..+.=..|.-+|.-.+
T Consensus        16 ~klpt~f~CP~Cg-e~~v~v~~~k~~~h~~C~~CG~y~~~~V   56 (99)
T PRK14892         16 PKLPKIFECPRCG-KVSISVKIKKNIAIITCGNCGLYTEFEV   56 (99)
T ss_pred             cCCCcEeECCCCC-CeEeeeecCCCcceEECCCCCCccCEEC
Confidence            4568899999998 4322     2233444456777765543


No 41 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=30.95  E-value=24  Score=24.58  Aligned_cols=13  Identities=38%  Similarity=0.580  Sum_probs=10.3

Q ss_pred             CCCCCCCCCCccc
Q psy4190          17 APAFHQCPSCLFE   29 (90)
Q Consensus        17 ~p~~HQCP~CPFE   29 (90)
                      .-+-|+||+|...
T Consensus        32 ~~~~~~Cp~C~~~   44 (89)
T COG1997          32 QRAKHVCPFCGRT   44 (89)
T ss_pred             HhcCCcCCCCCCc
Confidence            3467999999876


No 42 
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion]
Probab=30.64  E-value=56  Score=26.85  Aligned_cols=22  Identities=41%  Similarity=0.507  Sum_probs=19.3

Q ss_pred             CCCCCeeEeecCCceeEEEEee
Q psy4190          56 KGEGPLFTIAEDSGFCWVLQFS   77 (90)
Q Consensus        56 p~~~~~~~~~~~~~~~~~~~~~   77 (90)
                      .+++|+|.+.+--|.|-|+-+|
T Consensus        80 ~~~~~~~~~~~~~g~~~VIves  101 (338)
T COG1085          80 GSEDPLFKIQEARGKSRVIVES  101 (338)
T ss_pred             ccccchhcccccCcceEEEEEC
Confidence            3488999999999999999876


No 43 
>PF03470 zf-XS:  XS zinc finger domain;  InterPro: IPR005381 This domain is a putative nucleic acid binding zinc finger and is found at the N terminus of proteins that also contain an adjacent XS domain IPR005380 from INTERPRO and in some proteins a C-terminal XH domain IPR005379 from INTERPRO.
Probab=30.40  E-value=23  Score=21.65  Aligned_cols=8  Identities=38%  Similarity=0.916  Sum_probs=5.7

Q ss_pred             CCCCcccc
Q psy4190          23 CPSCLFED   30 (90)
Q Consensus        23 CP~CPFED   30 (90)
                      ||+||=..
T Consensus         1 CP~C~~kk    8 (43)
T PF03470_consen    1 CPFCPGKK    8 (43)
T ss_pred             CCCCCCCC
Confidence            88888554


No 44 
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=29.62  E-value=24  Score=26.63  Aligned_cols=28  Identities=29%  Similarity=0.694  Sum_probs=19.5

Q ss_pred             CCCCCcccc-----------ccchhhhhhHHHhhhhccC
Q psy4190          22 QCPSCLFED-----------NQKGKLTRHLLSCAKKYRP   49 (90)
Q Consensus        22 QCP~CPFED-----------N~KgKLtRH~isCaKKF~p   49 (90)
                      .||+|.-+|           +.--+=.|+-..|.++|.-
T Consensus         2 ~CPfC~~~~tkViDSR~~edg~aIRRRReC~~C~~RFTT   40 (156)
T COG1327           2 KCPFCGHEDTKVIDSRPAEEGNAIRRRRECLECGERFTT   40 (156)
T ss_pred             CCCCCCCCCCeeeecccccccchhhhhhcccccccccch
Confidence            599996654           3344556778889999863


No 45 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=29.32  E-value=22  Score=24.51  Aligned_cols=14  Identities=36%  Similarity=0.866  Sum_probs=11.0

Q ss_pred             ccCCCCCCCCCCcc
Q psy4190          15 EKAPAFHQCPSCLF   28 (90)
Q Consensus        15 Er~p~~HQCP~CPF   28 (90)
                      |....+|.||+|.-
T Consensus        94 e~~~~~Y~Cp~C~~  107 (147)
T smart00531       94 ETNNAYYKCPNCQS  107 (147)
T ss_pred             ccCCcEEECcCCCC
Confidence            45678999999973


No 46 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=29.16  E-value=28  Score=22.45  Aligned_cols=25  Identities=32%  Similarity=0.430  Sum_probs=17.2

Q ss_pred             CCCCCCCccccccchhhhhhH-HHhh
Q psy4190          20 FHQCPSCLFEDNQKGKLTRHL-LSCA   44 (90)
Q Consensus        20 ~HQCP~CPFEDN~KgKLtRH~-isCa   44 (90)
                      .+.||.|.-.-.+--.|.||+ +.=+
T Consensus        24 PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   24 PATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             -EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCcchhhccchhhHHHHHHHHhc
Confidence            467999999999999999998 4433


No 47 
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=28.49  E-value=34  Score=22.73  Aligned_cols=20  Identities=35%  Similarity=0.886  Sum_probs=15.3

Q ss_pred             cccCCC--CCCCCCCccccccc
Q psy4190          14 LEKAPA--FHQCPSCLFEDNQK   33 (90)
Q Consensus        14 lEr~p~--~HQCP~CPFEDN~K   33 (90)
                      |+..+.  |.-||-|-.||++-
T Consensus        12 l~~~~~~~ydIC~VC~WEdD~~   33 (78)
T PF14206_consen   12 LEERGEGTYDICPVCFWEDDGV   33 (78)
T ss_pred             eccCCCcCceECCCCCcccCCc
Confidence            444444  88999999999874


No 48 
>KOG2817|consensus
Probab=28.42  E-value=26  Score=29.63  Aligned_cols=13  Identities=31%  Similarity=0.677  Sum_probs=11.1

Q ss_pred             CCCCCCCcccccc
Q psy4190          20 FHQCPSCLFEDNQ   32 (90)
Q Consensus        20 ~HQCP~CPFEDN~   32 (90)
                      .+.||.||-|.+-
T Consensus       374 sfKCPYCP~e~~~  386 (394)
T KOG2817|consen  374 SFKCPYCPVEQLA  386 (394)
T ss_pred             eeeCCCCCcccCH
Confidence            6899999999764


No 49 
>PF07150 DUF1390:  Protein of unknown function (DUF1390);  InterPro: IPR009820 This entry is represented by Paramecium bursaria Chlorella virus 1, A79R; it is a family of uncharacterised viral proteins.
Probab=27.76  E-value=14  Score=28.94  Aligned_cols=25  Identities=28%  Similarity=0.753  Sum_probs=22.2

Q ss_pred             CCCCCCCCccccccchhhhhhHH-Hhh
Q psy4190          19 AFHQCPSCLFEDNQKGKLTRHLL-SCA   44 (90)
Q Consensus        19 ~~HQCP~CPFEDN~KgKLtRH~i-sCa   44 (90)
                      .+|-| .|.+++..+|-++||-- +|.
T Consensus         6 ~lY~C-~CGYkT~~~gnAsKHkKtsC~   31 (229)
T PF07150_consen    6 TLYTC-GCGYKTTNKGNASKHKKTSCG   31 (229)
T ss_pred             EEEEe-cCCceecCCccccccCCCcCC
Confidence            47899 79999999999999987 665


No 50 
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=27.29  E-value=65  Score=21.09  Aligned_cols=32  Identities=16%  Similarity=0.204  Sum_probs=21.2

Q ss_pred             CCCCCCCCCCccccccchhhhhhHHHhhhhccC
Q psy4190          17 APAFHQCPSCLFEDNQKGKLTRHLLSCAKKYRP   49 (90)
Q Consensus        17 ~p~~HQCP~CPFEDN~KgKLtRH~isCaKKF~p   49 (90)
                      ..+++.|+ ||+.++.+-.-.|.++.=-.+=.|
T Consensus        23 ~lp~~~~~-CP~~~~a~R~~~k~~L~~LE~~~P   54 (104)
T TIGR00269        23 ELKVHLDE-CPYSSLSVRARIRDFLYDLENKKP   54 (104)
T ss_pred             CCCcCCCC-CCCCCCCchHHHHHHHHHHHHHCc
Confidence            34567777 999998888777766644333333


No 51 
>PF10650 zf-C3H1:  Putative zinc-finger domain;  InterPro: IPR019607  This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger. 
Probab=27.08  E-value=31  Score=18.68  Aligned_cols=9  Identities=33%  Similarity=0.700  Sum_probs=7.4

Q ss_pred             CCCcccccc
Q psy4190          24 PSCLFEDNQ   32 (90)
Q Consensus        24 P~CPFEDN~   32 (90)
                      |.||||-++
T Consensus         1 ~lC~yEl~G    9 (23)
T PF10650_consen    1 PLCPYELTG    9 (23)
T ss_pred             CCCccccCC
Confidence            679999876


No 52 
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family. This model represents a distinct clade of orotate phosphoribosyltransferases. Members include the experimentally determined example from Thermus aquaticus and additional examples from Caulobacter crescentus, Helicobacter pylori, Mesorhizobium loti, and related species.
Probab=26.51  E-value=24  Score=25.34  Aligned_cols=9  Identities=56%  Similarity=1.372  Sum_probs=7.5

Q ss_pred             CCCCCCCCc
Q psy4190          19 AFHQCPSCL   27 (90)
Q Consensus        19 ~~HQCP~CP   27 (90)
                      ..||||.|+
T Consensus       168 ~~~~c~~~~  176 (187)
T TIGR01367       168 DSHECPLCL  176 (187)
T ss_pred             CcccCChhh
Confidence            468999996


No 53 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=26.10  E-value=27  Score=20.66  Aligned_cols=17  Identities=29%  Similarity=0.741  Sum_probs=12.9

Q ss_pred             CCCCCCCCCCccccccc
Q psy4190          17 APAFHQCPSCLFEDNQK   33 (90)
Q Consensus        17 ~p~~HQCP~CPFEDN~K   33 (90)
                      ....+.||+|.++.|--
T Consensus        43 ~~r~~~C~~Cg~~~~rD   59 (69)
T PF07282_consen   43 SGRVFTCPNCGFEMDRD   59 (69)
T ss_pred             ccceEEcCCCCCEECcH
Confidence            45578899999987643


No 54 
>KOG3715|consensus
Probab=26.00  E-value=1.2e+02  Score=25.60  Aligned_cols=37  Identities=27%  Similarity=0.532  Sum_probs=30.3

Q ss_pred             HHhhhhccCCccCCCCCCCCeeEeecCCceeEEEEeeee
Q psy4190          41 LSCAKKYRPERNQVRKGEGPLFTIAEDSGFCWVLQFSLS   79 (90)
Q Consensus        41 isCaKKF~pe~Nl~Pp~~~~~~~~~~~~~~~~~~~~~~~   79 (90)
                      .+|-+.+.-|.  .|--+||+|--.+|.|||.+--|.|.
T Consensus       123 ~a~vRsLScE~--~~~~~~pvfFGD~dnGfv~s~tF~l~  159 (344)
T KOG3715|consen  123 QACVRSLSCET--MPSDNGPVFFGDDDNGFVLSHTFRLY  159 (344)
T ss_pred             HHHHHHhcccc--CCCCCCceEEeeCCCCeEEEEEEEec
Confidence            46777777777  45566999999999999999999885


No 55 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=24.79  E-value=19  Score=21.15  Aligned_cols=24  Identities=25%  Similarity=0.448  Sum_probs=14.3

Q ss_pred             eccccccccccccCCCCCCCCCCc
Q psy4190           4 MEAEHNVRGRLEKAPAFHQCPSCL   27 (90)
Q Consensus         4 MEA~HNirgRlEr~p~~HQCP~CP   27 (90)
                      |+-.....-++.+......||+|.
T Consensus        30 ~~l~~~~~~~i~~~~~i~~Cp~Cg   53 (56)
T PF02591_consen   30 MELPPQELNEIRKGDEIVFCPNCG   53 (56)
T ss_pred             EEcCHHHHHHHHcCCCeEECcCCC
Confidence            333334444555556778899884


No 56 
>PF14846 DUF4485:  Domain of unknown function (DUF4485)
Probab=24.67  E-value=56  Score=21.20  Aligned_cols=43  Identities=21%  Similarity=0.352  Sum_probs=28.2

Q ss_pred             CCCCccccccchhhhhhHHHhh--hhccCCccCCCCCCCCeeEeec
Q psy4190          23 CPSCLFEDNQKGKLTRHLLSCA--KKYRPERNQVRKGEGPLFTIAE   66 (90)
Q Consensus        23 CP~CPFEDN~KgKLtRH~isCa--KKF~pe~Nl~Pp~~~~~~~~~~   66 (90)
                      |+.+..+...+-.-++++..|-  ..+.+-+|..|| +|||-+|.+
T Consensus        39 ~~~~~~~~~~RN~Y~~~Ll~~l~~~~L~~PF~~~Pp-~g~L~~l~~   83 (85)
T PF14846_consen   39 PPHNVEEKKNRNEYASLLLHCLQQGRLEGPFTKPPP-DGPLPTLPS   83 (85)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHhcCccCCCCCCCCC-CCCCccccc
Confidence            3445555555566677788885  457777887766 568877653


No 57 
>PLN02821 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase
Probab=23.61  E-value=39  Score=28.98  Aligned_cols=14  Identities=36%  Similarity=1.044  Sum_probs=11.6

Q ss_pred             eEeecCCceeEEEE
Q psy4190          62 FTIAEDSGFCWVLQ   75 (90)
Q Consensus        62 ~~~~~~~~~~~~~~   75 (90)
                      +.+|+..||||-..
T Consensus       108 I~LA~~~GFC~GVe  121 (460)
T PLN02821        108 VKLAKAYGFCWGVE  121 (460)
T ss_pred             EEEeCCCCCCccHH
Confidence            67899999999643


No 58 
>KOG3940|consensus
Probab=23.50  E-value=29  Score=29.19  Aligned_cols=30  Identities=27%  Similarity=0.515  Sum_probs=24.4

Q ss_pred             CCCCCCCCCccccccchhhhhhHHHhhhhcc
Q psy4190          18 PAFHQCPSCLFEDNQKGKLTRHLLSCAKKYR   48 (90)
Q Consensus        18 p~~HQCP~CPFEDN~KgKLtRH~isCaKKF~   48 (90)
                      +.|-|||.|-=--| -.-..||+..|.--=.
T Consensus       128 ~DYiQcpYC~RrFN-a~AAeRHinFCkeQas  157 (351)
T KOG3940|consen  128 LDYNQCPYCTRRFN-AQAAERHINFCKEQAS  157 (351)
T ss_pred             hhhhccchhhhccc-hhhhhhccccchhhhc
Confidence            45889999988888 7788999999975433


No 59 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=23.16  E-value=38  Score=29.50  Aligned_cols=20  Identities=25%  Similarity=0.591  Sum_probs=8.7

Q ss_pred             CCCCCccccccchhhhhhHHH
Q psy4190          22 QCPSCLFEDNQKGKLTRHLLS   42 (90)
Q Consensus        22 QCP~CPFEDN~KgKLtRH~is   42 (90)
                      .|+.|...- .++.|.+|+..
T Consensus       455 ~C~~Cgk~f-~~s~LekH~~~  474 (567)
T PLN03086        455 HCEKCGQAF-QQGEMEKHMKV  474 (567)
T ss_pred             cCCCCCCcc-chHHHHHHHHh
Confidence            455553322 23444555444


No 60 
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=23.02  E-value=49  Score=26.91  Aligned_cols=37  Identities=27%  Similarity=0.429  Sum_probs=29.5

Q ss_pred             CCCCCCCCCCccccccchhhhhhHHHhhhhccCCccC
Q psy4190          17 APAFHQCPSCLFEDNQKGKLTRHLLSCAKKYRPERNQ   53 (90)
Q Consensus        17 ~p~~HQCP~CPFEDN~KgKLtRH~isCaKKF~pe~Nl   53 (90)
                      ....|-|..|--=-..+..|.||+..|..+.-|+.-.
T Consensus        45 ~~~lyiCe~Clky~~~~~~l~~H~~~C~~r~PPG~eI   81 (290)
T PLN03238         45 CTKLYICEYCLKYMRKKKSLLRHLAKCDIRQPPGGGI   81 (290)
T ss_pred             CCeEEEcCCCcchhCCHHHHHHHHHhCCCCCCCcCEe
Confidence            3556789999999999999999999998875554433


No 61 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=22.91  E-value=24  Score=18.12  Aligned_cols=9  Identities=33%  Similarity=0.718  Sum_probs=7.2

Q ss_pred             CCCCCCCCc
Q psy4190          19 AFHQCPSCL   27 (90)
Q Consensus        19 ~~HQCP~CP   27 (90)
                      ..|+|+.|.
T Consensus        13 k~~~C~~C~   21 (26)
T PF13465_consen   13 KPYKCPYCG   21 (26)
T ss_dssp             SSEEESSSS
T ss_pred             CCCCCCCCc
Confidence            349999996


No 62 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=22.88  E-value=17  Score=20.33  Aligned_cols=20  Identities=20%  Similarity=0.468  Sum_probs=15.0

Q ss_pred             CCCCCCCccccccchh-hhhh
Q psy4190          20 FHQCPSCLFEDNQKGK-LTRH   39 (90)
Q Consensus        20 ~HQCP~CPFEDN~KgK-LtRH   39 (90)
                      .+.||.|++......+ +.++
T Consensus        20 ~~vC~~Cg~~~~~~~~~~~~~   40 (52)
T smart00661       20 RFVCRKCGYEEPIEQKYVYKE   40 (52)
T ss_pred             EEECCcCCCeEECCCcEEEEE
Confidence            7889999998877666 4443


No 63 
>PF12705 PDDEXK_1:  PD-(D/E)XK nuclease superfamily; PDB: 1W36_B 3K70_B 3U4Q_A 3U44_A.
Probab=22.70  E-value=40  Score=21.77  Aligned_cols=14  Identities=36%  Similarity=0.897  Sum_probs=8.6

Q ss_pred             CCCCCCCCCCcccc
Q psy4190          17 APAFHQCPSCLFED   30 (90)
Q Consensus        17 ~p~~HQCP~CPFED   30 (90)
                      ++....|..|||-+
T Consensus       241 ~~~~~~C~~C~~~~  254 (257)
T PF12705_consen  241 PPNSEHCSYCPFRD  254 (257)
T ss_dssp             -SS--TTSS-TTHH
T ss_pred             CCCCCCCCCCCCcc
Confidence            48889999999965


No 64 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=22.27  E-value=36  Score=19.00  Aligned_cols=13  Identities=23%  Similarity=0.503  Sum_probs=8.9

Q ss_pred             CCCCCCccccccc
Q psy4190          21 HQCPSCLFEDNQK   33 (90)
Q Consensus        21 HQCP~CPFEDN~K   33 (90)
                      -+||+|-..-+..
T Consensus         3 i~CP~C~~~f~v~   15 (37)
T PF13719_consen    3 ITCPNCQTRFRVP   15 (37)
T ss_pred             EECCCCCceEEcC
Confidence            3799998765543


No 65 
>PRK01045 ispH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed
Probab=22.17  E-value=44  Score=26.50  Aligned_cols=14  Identities=29%  Similarity=0.615  Sum_probs=11.1

Q ss_pred             eEeecCCceeEEEE
Q psy4190          62 FTIAEDSGFCWVLQ   75 (90)
Q Consensus        62 ~~~~~~~~~~~~~~   75 (90)
                      ..+|+..||||-.+
T Consensus         3 I~lA~~~GFC~GV~   16 (298)
T PRK01045          3 ILLANPRGFCAGVD   16 (298)
T ss_pred             EEEeCCCCCCccHH
Confidence            46899999999643


No 66 
>KOG2612|consensus
Probab=22.11  E-value=61  Score=23.21  Aligned_cols=30  Identities=23%  Similarity=0.472  Sum_probs=22.7

Q ss_pred             cccCCCCCCCCCCccccccchhhhhhHHHhh
Q psy4190          14 LEKAPAFHQCPSCLFEDNQKGKLTRHLLSCA   44 (90)
Q Consensus        14 lEr~p~~HQCP~CPFEDN~KgKLtRH~isCa   44 (90)
                      ..+.|++-.||||.= |-.-..++-|+-.|.
T Consensus        68 qaek~~~~hCeNC~R-dVaAaR~AaHLekCl   97 (103)
T KOG2612|consen   68 QAEKPMDCHCENCDR-DVAAARFAAHLEKCL   97 (103)
T ss_pred             hccCCccccCCCCcc-HHHHHHHHHHHHHHH
Confidence            345688999999963 445667888998885


No 67 
>KOG2324|consensus
Probab=22.10  E-value=30  Score=30.00  Aligned_cols=26  Identities=31%  Similarity=0.669  Sum_probs=15.9

Q ss_pred             CCCCCCCccccccchhhhhhHHHhhh
Q psy4190          20 FHQCPSCLFEDNQKGKLTRHLLSCAK   45 (90)
Q Consensus        20 ~HQCP~CPFEDN~KgKLtRH~isCaK   45 (90)
                      ..+||+|.|+.|...--.--.++|.|
T Consensus       227 l~~C~~C~~s~n~e~~~~sk~~~Cp~  252 (457)
T KOG2324|consen  227 LMSCPSCGYSKNSEDLDLSKIASCPK  252 (457)
T ss_pred             eeecCcCCccCchhhhcCCccccCCc
Confidence            46899999998864322222255654


No 68 
>smart00224 GGL G protein gamma subunit-like motifs.
Probab=21.91  E-value=55  Score=20.21  Aligned_cols=27  Identities=26%  Similarity=0.575  Sum_probs=18.8

Q ss_pred             hhccCCccCCCCCCCCeeEeecCCceeEEE
Q psy4190          45 KKYRPERNQVRKGEGPLFTIAEDSGFCWVL   74 (90)
Q Consensus        45 KKF~pe~Nl~Pp~~~~~~~~~~~~~~~~~~   74 (90)
                      ..+-|-+.-.||.+.|.-   ||.+.||+|
T Consensus        37 ~~~DP~l~g~~~~~NP~~---~dk~~c~~l   63 (63)
T smart00224       37 AEEDPLLTGPPPSKNPFI---EDKTSCWIL   63 (63)
T ss_pred             CCCCCCcCCCCCCCCCCC---CCCCCcCcC
Confidence            345666666666667764   688899985


No 69 
>KOG3348|consensus
Probab=21.61  E-value=46  Score=23.04  Aligned_cols=12  Identities=42%  Similarity=0.487  Sum_probs=10.1

Q ss_pred             ccchhhhhhHHH
Q psy4190          31 NQKGKLTRHLLS   42 (90)
Q Consensus        31 N~KgKLtRH~is   42 (90)
                      +||++|+||.+.
T Consensus        44 eGKs~L~rHRlV   55 (85)
T KOG3348|consen   44 EGKSLLARHRLV   55 (85)
T ss_pred             CChHHHHHHHHH
Confidence            689999999754


No 70 
>PRK14821 putative deoxyribonucleotide triphosphate pyrophosphatase; Provisional
Probab=21.41  E-value=50  Score=24.00  Aligned_cols=31  Identities=26%  Similarity=0.161  Sum_probs=19.1

Q ss_pred             CccccccchhhhhhHHHhhhhccCCccCCCCCCCCeeEeecCCceeE
Q psy4190          26 CLFEDNQKGKLTRHLLSCAKKYRPERNQVRKGEGPLFTIAEDSGFCW   72 (90)
Q Consensus        26 CPFEDN~KgKLtRH~isCaKKF~pe~Nl~Pp~~~~~~~~~~~~~~~~   72 (90)
                      .-||+|-.-|.. ..   ++..    |        ...||||||.|-
T Consensus        40 ~t~~enA~~KA~-~~---~~~~----~--------~pvlaDDSGL~v   70 (184)
T PRK14821         40 DTLEEVAAFGAK-WV---YNKL----N--------RPVIVEDSGLFI   70 (184)
T ss_pred             CCHHHHHHHHHH-HH---HHHH----C--------CCEEEEcCEEee
Confidence            568888777753 11   2221    1        247999999983


No 71 
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=21.36  E-value=45  Score=22.71  Aligned_cols=22  Identities=36%  Similarity=0.593  Sum_probs=17.2

Q ss_pred             ccccccc-cccccCCCCCCCCCCc
Q psy4190           5 EAEHNVR-GRLEKAPAFHQCPSCL   27 (90)
Q Consensus         5 EA~HNir-gRlEr~p~~HQCP~CP   27 (90)
                      +++|++. -+|++. ..++||.|.
T Consensus        64 ~~~h~v~W~~l~~g-~~~rC~eCG   86 (97)
T cd00924          64 PDSHDVIWMWLEKG-KPKRCPECG   86 (97)
T ss_pred             CCCceEEEEEEeCC-CceeCCCCC
Confidence            3467776 788998 589999995


No 72 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=20.78  E-value=39  Score=23.48  Aligned_cols=16  Identities=25%  Similarity=0.733  Sum_probs=11.2

Q ss_pred             CCCCCCCCccccccch
Q psy4190          19 AFHQCPSCLFEDNQKG   34 (90)
Q Consensus        19 ~~HQCP~CPFEDN~Kg   34 (90)
                      ..+.||.|.++.|---
T Consensus       321 r~~~C~~cg~~~~rD~  336 (364)
T COG0675         321 RLFKCPRCGFVHDRDV  336 (364)
T ss_pred             eeEECCCCCCeehhhH
Confidence            4578999988866433


No 73 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=20.71  E-value=52  Score=17.71  Aligned_cols=14  Identities=21%  Similarity=0.617  Sum_probs=9.9

Q ss_pred             CCCCCCCCCCcccc
Q psy4190          17 APAFHQCPSCLFED   30 (90)
Q Consensus        17 ~p~~HQCP~CPFED   30 (90)
                      +-+.-.||+|.++-
T Consensus        11 ~~~~~~Cp~CG~~F   24 (26)
T PF10571_consen   11 PESAKFCPHCGYDF   24 (26)
T ss_pred             hhhcCcCCCCCCCC
Confidence            34556799998874


No 74 
>PRK14826 putative deoxyribonucleotide triphosphate pyrophosphatase; Provisional
Probab=20.47  E-value=55  Score=24.70  Aligned_cols=12  Identities=33%  Similarity=0.631  Sum_probs=10.1

Q ss_pred             eeEeecCCceeE
Q psy4190          61 LFTIAEDSGFCW   72 (90)
Q Consensus        61 ~~~~~~~~~~~~   72 (90)
                      +..||||||.|-
T Consensus        78 ~~vlaDDSGL~v   89 (222)
T PRK14826         78 LIALADDTGLEV   89 (222)
T ss_pred             CcEEEecCcEEE
Confidence            467999999985


No 75 
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=20.45  E-value=46  Score=24.92  Aligned_cols=13  Identities=31%  Similarity=0.858  Sum_probs=10.7

Q ss_pred             ccCCCCCCCCCCc
Q psy4190          15 EKAPAFHQCPSCL   27 (90)
Q Consensus        15 Er~p~~HQCP~CP   27 (90)
                      +....||+||+|-
T Consensus       108 ~~~~~~y~C~~~~  120 (176)
T COG1675         108 ETENNYYVCPNCH  120 (176)
T ss_pred             hccCCceeCCCCC
Confidence            4678899999985


No 76 
>PF10855 DUF2648:  Protein of unknown function (DUF2648);  InterPro: IPR022561  This family of proteins with unknown function appears to be restricted to eubacteia. 
Probab=20.23  E-value=24  Score=20.89  Aligned_cols=15  Identities=40%  Similarity=0.368  Sum_probs=12.9

Q ss_pred             hhhccCCccCCCCCC
Q psy4190          44 AKKYRPERNQVRKGE   58 (90)
Q Consensus        44 aKKF~pe~Nl~Pp~~   58 (90)
                      =|||+.-.|+.|-||
T Consensus        18 fKKyQ~~vnqapnie   32 (33)
T PF10855_consen   18 FKKYQNHVNQAPNIE   32 (33)
T ss_pred             HHHHHHHHhcCCCCC
Confidence            388999999999886


No 77 
>smart00525 FES FES domain. iron-sulpphur binding domain in DNA-(apurinic or apyrimidinic site) lyase (subfamily of ENDO3)
Probab=20.14  E-value=61  Score=16.44  Aligned_cols=15  Identities=20%  Similarity=0.414  Sum_probs=10.9

Q ss_pred             CCCCCCCCccccccc
Q psy4190          19 AFHQCPSCLFEDNQK   33 (90)
Q Consensus        19 ~~HQCP~CPFEDN~K   33 (90)
                      ...+|..||+.+-.+
T Consensus         5 r~P~C~~Cpl~~~C~   19 (26)
T smart00525        5 RKPRCDECPLKDLCP   19 (26)
T ss_pred             CCCCCCCCcCHHHhh
Confidence            356899999886544


Done!