BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy4191
(443 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1I7K|A Chain A, Crystal Structure Of Human Mitotic-Specific Ubiquitin-
Conjugating Enzyme, Ubch10
pdb|1I7K|B Chain B, Crystal Structure Of Human Mitotic-Specific Ubiquitin-
Conjugating Enzyme, Ubch10
Length = 179
Score = 29.6 bits (65), Expect = 3.6, Method: Compositional matrix adjust.
Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 12/64 (18%)
Query: 311 IDTQGGNILIEIFRSCFK-LYDM--VLQFLRTLF--------LRTHNVHYWPVPDAVQAY 359
+DTQG NI ++I + + LYD+ +L +++L L TH W P A + Y
Sbjct: 107 VDTQG-NISLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKY 165
Query: 360 VQES 363
+QE+
Sbjct: 166 LQET 169
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.138 0.417
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,509,697
Number of Sequences: 62578
Number of extensions: 414146
Number of successful extensions: 1064
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1064
Number of HSP's gapped (non-prelim): 1
length of query: 443
length of database: 14,973,337
effective HSP length: 102
effective length of query: 341
effective length of database: 8,590,381
effective search space: 2929319921
effective search space used: 2929319921
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)