Diaphorina citri psyllid: psy4221


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MEEALRQAVDEGDFEQAKELSPSRCNHAGSSVIEASVEFDYTAQEADELTLRKGDLITGIRVQSGGWWEGLLVRENRRGMFPDNFVRVLGEAAAETQVAMRKKPGRRCRVLFSYTPANADELELHVNDVIDVLSEVEEGWWRGRLRDRTGVFPSNFVEEIPADTMTAESRHRKESNNNEADPAKALRRSGRGMVEGAAAR
cccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccEEEEEEEcccccEEEEEccccCEEEECcccEEEccccccHHHHHcccccccEEEEEcccccccccccccccccEEEEEEEEcccCEEEEEccCEEEECcccEEEcccccccccccccccccccccccccccccccccCEECcccc
*******************************VIEASVEFDYTAQEADELTLRKGDLITGIRVQSGGWWEGLLVRENRRGMFPDNFVRVLGEA*********KKPGRRCRVLFSYTPANADELELHVNDVIDVLSEVEEGWWRGRLRDRTGVFPSNFVE******************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEALRQAVDEGDFEQAKELSPSRCNHAGSSVIEASVEFDYTAQEADELTLRKGDLITGIRVQSGGWWEGLLVRENRRGMFPDNFVRVLGEAAAETQVAMRKKPGRRCRVLFSYTPANADELELHVNDVIDVLSEVEEGWWRGRLRDRTGVFPSNFVEEIPADTMTAESRHRKESNNNEADPAKALRRSGRGMVEGAAAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0019220 [BP]regulation of phosphate metabolic processprobableGO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0044456 [CC]synapse partprobableGO:0005575, GO:0045202
GO:0030139 [CC]endocytic vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NG2, chain A
Confidence level:very confident
Coverage over the Query: 32-163
View the alignment between query and template
View the model in PyMOL