Query         psy4268
Match_columns 86
No_of_seqs    110 out of 1285
Neff          11.5
Searched_HMMs 46136
Date          Fri Aug 16 21:13:53 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy4268.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/4268hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.8 5.9E-22 1.3E-26  107.8   3.5   70    2-74    177-246 (279)
  2 KOG2462|consensus               99.8   3E-21 6.4E-26  105.1   3.1   64    1-65    202-265 (279)
  3 KOG3576|consensus               99.6 3.1E-17 6.8E-22   86.7  -0.8   69    1-70    132-200 (267)
  4 KOG3623|consensus               99.5 5.1E-15 1.1E-19   89.9   1.0   61    2-63    910-970 (1007)
  5 KOG1074|consensus               99.4 1.2E-14 2.6E-19   89.1  -1.2   68    2-70    621-695 (958)
  6 KOG3623|consensus               99.3 1.3E-12 2.7E-17   79.9   1.8   65   10-75    890-954 (1007)
  7 PHA02768 hypothetical protein;  99.3   4E-12 8.6E-17   54.6   2.1   42   15-59      6-47  (55)
  8 PHA00733 hypothetical protein   99.2 2.3E-11 4.9E-16   61.3   4.9   61    4-68     64-124 (128)
  9 KOG3576|consensus               99.1 2.5E-11 5.4E-16   64.7   1.0   66   10-76    113-178 (267)
 10 KOG1074|consensus               99.1 1.5E-10 3.2E-15   71.8   3.4   59   15-74    880-938 (958)
 11 PF13465 zf-H2C2_2:  Zinc-finge  99.0 3.5E-11 7.6E-16   44.7  -1.2   23   31-54      3-25  (26)
 12 PF13465 zf-H2C2_2:  Zinc-finge  99.0 7.4E-10 1.6E-14   41.1   2.3   24    2-25      2-25  (26)
 13 KOG3993|consensus               98.8 1.4E-09 3.1E-14   63.3   1.1   70    1-70    282-383 (500)
 14 PHA00616 hypothetical protein   98.7 1.2E-08 2.6E-13   41.9   1.7   33   14-47      1-33  (44)
 15 PHA00616 hypothetical protein   98.6 2.5E-08 5.3E-13   41.0   1.8   31   44-74      2-32  (44)
 16 PHA00732 hypothetical protein   98.6 4.5E-08 9.7E-13   45.5   2.3   43   14-63      1-44  (79)
 17 KOG3608|consensus               98.5 1.5E-08 3.3E-13   58.2  -0.3   66    2-68    195-262 (467)
 18 KOG3608|consensus               98.5 1.3E-07 2.9E-12   54.5   3.0   64    2-67    279-345 (467)
 19 PF00096 zf-C2H2:  Zinc finger,  98.4 4.6E-07   1E-11   32.3   2.0   22   44-65      1-22  (23)
 20 PHA02768 hypothetical protein;  98.3 1.3E-06 2.8E-11   37.7   2.9   24   44-67      6-29  (55)
 21 PF00096 zf-C2H2:  Zinc finger,  98.2 1.6E-06 3.4E-11   30.9   2.3   23   15-37      1-23  (23)
 22 PF05605 zf-Di19:  Drought indu  98.2 5.9E-06 1.3E-10   35.7   4.4   51   14-68      2-54  (54)
 23 PHA00733 hypothetical protein   98.2 1.4E-06 3.1E-11   44.0   2.1   55   11-66     37-96  (128)
 24 PF13894 zf-C2H2_4:  C2H2-type   98.1 3.6E-06 7.8E-11   30.0   2.3   23   44-66      1-23  (24)
 25 PLN03086 PRLI-interacting fact  98.1 4.5E-06 9.7E-11   51.2   2.9   38   13-53    477-514 (567)
 26 PLN03086 PRLI-interacting fact  98.0 8.4E-06 1.8E-10   50.1   3.8   63    2-67    492-564 (567)
 27 KOG3993|consensus               98.0   6E-07 1.3E-11   52.8  -1.2   59   14-73    267-325 (500)
 28 PF13912 zf-C2H2_6:  C2H2-type   98.0 5.8E-06 1.3E-10   30.5   1.6   22   44-65      2-23  (27)
 29 PF13912 zf-C2H2_6:  C2H2-type   98.0 4.1E-06 8.9E-11   31.0   1.1   25   14-38      1-25  (27)
 30 PF13894 zf-C2H2_4:  C2H2-type   97.8 2.7E-05 5.8E-10   27.6   2.4   23   15-37      1-23  (24)
 31 PF09237 GAGA:  GAGA factor;  I  97.8 2.9E-05 6.2E-10   32.8   2.7   32   40-72     22-53  (54)
 32 COG5189 SFP1 Putative transcri  97.8 7.8E-06 1.7E-10   46.8   0.6   51   12-63    347-418 (423)
 33 smart00355 ZnF_C2H2 zinc finge  97.6 8.5E-05 1.8E-09   26.6   2.5   20   45-64      2-21  (26)
 34 PF09237 GAGA:  GAGA factor;  I  97.6  0.0002 4.3E-09   30.3   3.5   34    9-42     19-52  (54)
 35 PRK04860 hypothetical protein;  97.6 8.3E-05 1.8E-09   39.1   2.6   39   13-56    118-156 (160)
 36 smart00355 ZnF_C2H2 zinc finge  97.5 0.00016 3.5E-09   25.8   2.3   24   15-38      1-24  (26)
 37 PF12756 zf-C2H2_2:  C2H2 type   97.5 0.00012 2.5E-09   35.1   2.3   24   44-67     51-74  (100)
 38 PF12874 zf-met:  Zinc-finger o  97.3 0.00022 4.7E-09   25.7   1.7   21   15-35      1-21  (25)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.2  0.0005 1.1E-08   24.5   2.1   22   45-67      2-23  (24)
 40 PHA00732 hypothetical protein   97.2 0.00062 1.3E-08   31.7   2.7   24   44-67      2-26  (79)
 41 PF12874 zf-met:  Zinc-finger o  97.1 0.00031 6.7E-09   25.2   1.3   22   44-65      1-22  (25)
 42 PF12171 zf-C2H2_jaz:  Zinc-fin  96.6 0.00063 1.4E-08   25.0   0.2   21   15-35      2-22  (27)
 43 PF13913 zf-C2HC_2:  zinc-finge  96.6  0.0034 7.4E-08   22.7   2.2   20   44-64      3-22  (25)
 44 KOG2893|consensus               95.8  0.0022 4.8E-08   35.8  -0.2   45   12-62      9-53  (341)
 45 smart00451 ZnF_U1 U1-like zinc  95.6   0.016 3.6E-07   22.3   2.1   22   14-35      3-24  (35)
 46 KOG1146|consensus               95.0   0.025 5.5E-07   38.6   2.5   57    8-65    459-540 (1406)
 47 cd00350 rubredoxin_like Rubred  94.7   0.028   6E-07   21.7   1.5   24   15-51      2-25  (33)
 48 PRK04860 hypothetical protein;  94.4  0.0092   2E-07   31.5  -0.4   25    2-26    131-155 (160)
 49 KOG2186|consensus               94.3   0.033 7.1E-07   31.5   1.6   49   14-66      3-51  (276)
 50 PF12756 zf-C2H2_2:  C2H2 type   94.3   0.083 1.8E-06   25.1   2.9   25   14-38     50-74  (100)
 51 PF09538 FYDLN_acid:  Protein o  94.2   0.039 8.4E-07   27.3   1.6   30   15-56     10-39  (108)
 52 COG5048 FOG: Zn-finger [Genera  93.8   0.015 3.2E-07   34.4  -0.3   60   13-73    288-353 (467)
 53 COG1592 Rubrerythrin [Energy p  92.2    0.12 2.5E-06   27.6   1.7   23   14-50    134-156 (166)
 54 TIGR00373 conserved hypothetic  91.3    0.23 4.9E-06   26.3   2.2   36    9-54    104-139 (158)
 55 COG4049 Uncharacterized protei  91.1    0.16 3.5E-06   22.0   1.2   29    8-36     11-39  (65)
 56 TIGR02300 FYDLN_acid conserved  90.9    0.21 4.6E-06   25.4   1.7   32   15-58     10-41  (129)
 57 PRK06266 transcription initiat  90.4    0.24 5.2E-06   26.8   1.8   34   11-54    114-147 (178)
 58 cd00729 rubredoxin_SM Rubredox  89.5    0.32 6.9E-06   18.9   1.3   25   14-51      2-26  (34)
 59 PF12013 DUF3505:  Protein of u  89.2    0.45 9.8E-06   23.4   2.1   25   44-68     81-109 (109)
 60 PF09986 DUF2225:  Uncharacteri  88.8   0.062 1.3E-06   29.8  -1.2   45   12-56      3-61  (214)
 61 PF04959 ARS2:  Arsenite-resist  88.7    0.51 1.1E-05   26.4   2.3   30   11-40     74-103 (214)
 62 smart00531 TFIIE Transcription  88.7    0.32   7E-06   25.4   1.4   39   11-54     96-134 (147)
 63 PF05443 ROS_MUCR:  ROS/MUCR tr  88.3    0.36 7.8E-06   24.9   1.4   24   44-70     73-96  (132)
 64 PF13717 zinc_ribbon_4:  zinc-r  86.6    0.73 1.6E-05   18.1   1.6   33   15-53      3-35  (36)
 65 TIGR02098 MJ0042_CXXC MJ0042 f  86.5     0.6 1.3E-05   18.3   1.4   34   15-54      3-36  (38)
 66 KOG1146|consensus               86.0    0.76 1.7E-05   32.2   2.3   59   12-72   1282-1357(1406)
 67 PF04959 ARS2:  Arsenite-resist  86.0    0.52 1.1E-05   26.3   1.3   26   44-69     78-103 (214)
 68 PF13719 zinc_ribbon_5:  zinc-r  85.8    0.87 1.9E-05   17.9   1.6   34   15-54      3-36  (37)
 69 COG5189 SFP1 Putative transcri  85.1     1.1 2.3E-05   26.8   2.3   24   40-64    347-372 (423)
 70 PRK00398 rpoP DNA-directed RNA  84.4    0.69 1.5E-05   19.0   1.1   30   14-54      3-32  (46)
 71 smart00659 RPOLCX RNA polymera  84.3     1.1 2.3E-05   18.5   1.6   27   14-52      2-28  (44)
 72 COG5048 FOG: Zn-finger [Genera  83.2    0.46 9.9E-06   28.3   0.4   45    2-47    305-355 (467)
 73 PF05191 ADK_lid:  Adenylate ki  82.8    0.32   7E-06   19.1  -0.2   32   15-55      2-33  (36)
 74 TIGR02605 CxxC_CxxC_SSSS putat  82.8    0.37 8.1E-06   20.3  -0.0   30   14-51      5-34  (52)
 75 PRK00464 nrdR transcriptional   82.5    0.16 3.5E-06   26.8  -1.4   12   44-55     29-40  (154)
 76 KOG4167|consensus               81.8    0.29 6.3E-06   32.0  -0.8   25   44-68    793-817 (907)
 77 COG3357 Predicted transcriptio  80.8    0.88 1.9E-05   21.9   0.8   11   14-24     58-68  (97)
 78 KOG4167|consensus               80.5    0.41 8.9E-06   31.4  -0.4   28   13-40    791-818 (907)
 79 COG1997 RPL43A Ribosomal prote  80.3    0.53 1.1E-05   22.4  -0.0   30   14-54     35-64  (89)
 80 KOG3408|consensus               80.0     1.2 2.5E-05   22.7   1.1   22   44-65     58-79  (129)
 81 PF10571 UPF0547:  Uncharacteri  78.6     1.3 2.8E-05   16.1   0.8   11   44-54     15-25  (26)
 82 smart00614 ZnF_BED BED zinc fi  78.0     2.6 5.7E-05   17.6   1.8   20   45-64     20-44  (50)
 83 PF02892 zf-BED:  BED zinc fing  77.5     3.3 7.2E-05   16.7   2.0   12   13-24     15-26  (45)
 84 COG2888 Predicted Zn-ribbon RN  76.4     2.9 6.2E-05   18.5   1.7    7   44-50     51-57  (61)
 85 COG4530 Uncharacterized protei  74.7     2.4 5.2E-05   21.2   1.3   29   16-56     11-39  (129)
 86 PHA00626 hypothetical protein   74.6     1.7 3.6E-05   19.0   0.7   16   41-57     22-37  (59)
 87 cd00924 Cyt_c_Oxidase_Vb Cytoc  74.4     1.5 3.3E-05   21.4   0.6   18    7-25     73-90  (97)
 88 smart00734 ZnF_Rad18 Rad18-lik  74.2     3.9 8.4E-05   14.7   1.8   18   45-63      3-20  (26)
 89 PF08790 zf-LYAR:  LYAR-type C2  73.0    0.66 1.4E-05   17.3  -0.6   11   44-54      1-11  (28)
 90 PF07754 DUF1610:  Domain of un  72.9     1.9 4.2E-05   15.4   0.6    8   44-51     17-24  (24)
 91 PF13878 zf-C2H2_3:  zinc-finge  72.9     5.7 0.00012   16.0   2.4   25   14-38     13-39  (41)
 92 PF09723 Zn-ribbon_8:  Zinc rib  72.3     1.7 3.6E-05   17.6   0.4   14   44-57      6-19  (42)
 93 KOG2593|consensus               71.8     2.5 5.4E-05   26.2   1.2   40    9-52    123-162 (436)
 94 PF08209 Sgf11:  Sgf11 (transcr  71.8     5.5 0.00012   15.4   1.9   23   44-67      5-27  (33)
 95 smart00834 CxxC_CXXC_SSSS Puta  71.1       2 4.3E-05   16.9   0.5   13   44-56      6-18  (41)
 96 COG1996 RPC10 DNA-directed RNA  69.9     3.6 7.7E-05   17.5   1.2   30   12-52      4-33  (49)
 97 COG1773 Rubredoxin [Energy pro  69.0     2.4 5.3E-05   18.4   0.6   15   14-28      3-17  (55)
 98 KOG4173|consensus               64.5     3.4 7.4E-05   23.2   0.7   48   15-63    107-166 (253)
 99 PF07295 DUF1451:  Protein of u  64.3     5.7 0.00012   20.9   1.5   28   13-51    111-138 (146)
100 PF10013 DUF2256:  Uncharacteri  64.3     5.7 0.00012   16.3   1.2   17   44-60      9-25  (42)
101 KOG0978|consensus               62.4     4.7  0.0001   26.7   1.1   16   44-59    679-694 (698)
102 PLN02294 cytochrome c oxidase   60.9     4.8  0.0001   21.8   0.9   11   14-24    141-151 (174)
103 PRK03824 hypA hydrogenase nick  60.8     3.5 7.5E-05   21.3   0.3   15   13-27     69-83  (135)
104 smart00154 ZnF_AN1 AN1-like Zi  60.0     5.2 0.00011   15.9   0.7   14   42-56     12-25  (39)
105 PF11494 Ta0938:  Ta0938;  Inte  59.8     4.8  0.0001   19.7   0.7   42    9-56      9-50  (105)
106 PF09963 DUF2197:  Uncharacteri  58.3     5.2 0.00011   17.5   0.6   37   15-52      3-40  (56)
107 COG3091 SprT Zn-dependent meta  57.7     5.5 0.00012   21.2   0.8   34   13-52    116-149 (156)
108 KOG2785|consensus               57.3      23 0.00049   22.0   3.2   51   13-64    165-241 (390)
109 COG3364 Zn-ribbon containing p  56.3     8.1 0.00018   19.1   1.1   16   13-28      1-16  (112)
110 TIGR00100 hypA hydrogenase nic  56.2     6.5 0.00014   19.7   0.9   12   14-25     70-81  (115)
111 cd00730 rubredoxin Rubredoxin;  56.2       5 0.00011   17.0   0.4   13   15-27      2-14  (50)
112 KOG2071|consensus               55.5      10 0.00022   24.7   1.7   28   12-39    416-443 (579)
113 PRK12380 hydrogenase nickel in  55.2       8 0.00017   19.3   1.1   11   14-24     70-80  (113)
114 PF00301 Rubredoxin:  Rubredoxi  54.9     6.1 0.00013   16.5   0.6   36   15-51      2-42  (47)
115 KOG2907|consensus               54.0     4.8 0.00011   20.2   0.2   40   14-55     74-114 (116)
116 PF09845 DUF2072:  Zn-ribbon co  53.9     7.2 0.00016   20.2   0.8   15   14-28      1-15  (131)
117 PF13451 zf-trcl:  Probable zin  53.2     7.6 0.00016   16.5   0.7   14   13-26      3-16  (49)
118 PF12907 zf-met2:  Zinc-binding  52.2     3.7 8.1E-05   16.6  -0.3    7   16-22      3-9   (40)
119 PF01286 XPA_N:  XPA protein N-  51.9     6.5 0.00014   15.3   0.4   13   45-57      5-17  (34)
120 KOG0717|consensus               51.8     9.9 0.00021   24.1   1.3   21   44-64    293-313 (508)
121 PF07282 OrfB_Zn_ribbon:  Putat  51.4      14 0.00031   16.3   1.5   13   44-56     47-59  (69)
122 PF10537 WAC_Acf1_DNA_bd:  ATP-  50.5      32 0.00069   17.0   3.2   38   13-52      2-39  (102)
123 PF13824 zf-Mss51:  Zinc-finger  50.5      16 0.00034   16.0   1.5    8   44-51     15-22  (55)
124 COG4391 Uncharacterized protei  50.4     4.6  0.0001   18.0  -0.2   45    5-54     15-59  (62)
125 PRK14890 putative Zn-ribbon RN  50.3      21 0.00045   15.8   1.8    9   44-52     26-34  (59)
126 COG2331 Uncharacterized protei  50.1     7.7 0.00017   18.1   0.5   33   14-54     12-44  (82)
127 KOG2482|consensus               50.0      23  0.0005   21.7   2.5   23   44-66    196-218 (423)
128 PF15269 zf-C2H2_7:  Zinc-finge  50.0      17 0.00036   15.2   1.4   21   44-64     21-41  (54)
129 COG4957 Predicted transcriptio  49.8      16 0.00035   19.1   1.7   25   15-42     77-101 (148)
130 PRK14138 NAD-dependent deacety  48.3      37 0.00081   19.4   3.1   39    8-51    113-151 (244)
131 PF02176 zf-TRAF:  TRAF-type zi  48.1     6.7 0.00014   16.8   0.2   43   13-56      8-55  (60)
132 KOG2231|consensus               47.6      20 0.00043   23.9   2.2   19   17-35    185-203 (669)
133 PF01428 zf-AN1:  AN1-like Zinc  47.1     9.4  0.0002   15.4   0.5   14   13-26     12-25  (43)
134 PF01927 Mut7-C:  Mut7-C RNAse   47.0      17 0.00038   19.0   1.6   19   44-62    125-143 (147)
135 COG1571 Predicted DNA-binding   46.9      17 0.00037   22.8   1.7   30   16-57    352-381 (421)
136 PRK05452 anaerobic nitric oxid  46.6     5.9 0.00013   25.0  -0.2   17   11-27    422-438 (479)
137 KOG1842|consensus               46.6      14 0.00031   23.4   1.3   23   14-36     15-37  (505)
138 PF04423 Rad50_zn_hook:  Rad50   46.3       8 0.00017   16.4   0.2   13   44-56     21-33  (54)
139 PRK00564 hypA hydrogenase nick  45.8      12 0.00025   18.9   0.8   11   14-24     71-81  (117)
140 PF14353 CpXC:  CpXC protein     45.7      10 0.00023   19.1   0.7   21   37-57     32-52  (128)
141 PF01215 COX5B:  Cytochrome c o  45.6     5.9 0.00013   20.7  -0.2   20    6-26    105-124 (136)
142 TIGR00627 tfb4 transcription f  45.0      23 0.00051   20.9   2.0   10   15-24    256-265 (279)
143 KOG0782|consensus               44.9       7 0.00015   25.6  -0.1   12   44-55    254-265 (1004)
144 PF03604 DNA_RNApol_7kD:  DNA d  44.4      11 0.00025   14.3   0.5   11   44-54      1-11  (32)
145 PF04780 DUF629:  Protein of un  44.3      24 0.00053   22.5   2.1   25   44-68     58-82  (466)
146 PF15135 UPF0515:  Uncharacteri  44.2      12 0.00026   21.7   0.8   12   44-55    156-167 (278)
147 COG3677 Transposase and inacti  44.0      14  0.0003   19.1   0.9   15   40-55     51-65  (129)
148 PRK11032 hypothetical protein;  44.0      19 0.00041   19.4   1.4   28   13-51    123-150 (160)
149 KOG2636|consensus               43.8      23  0.0005   22.5   1.9   28    8-35    395-423 (497)
150 PF08274 PhnA_Zn_Ribbon:  PhnA   43.7     9.1  0.0002   14.4   0.2    9   44-52     20-28  (30)
151 PF10071 DUF2310:  Zn-ribbon-co  43.6      11 0.00023   22.0   0.5   31   12-50    218-248 (258)
152 PLN03238 probable histone acet  43.5      35 0.00076   20.3   2.5   22   44-65     49-70  (290)
153 KOG4727|consensus               43.5      16 0.00035   20.0   1.1   22   14-35     75-96  (193)
154 PRK04351 hypothetical protein;  43.0      11 0.00023   20.0   0.4   32   14-54    112-143 (149)
155 KOG3362|consensus               41.8     6.8 0.00015   20.7  -0.4    7   15-21    119-125 (156)
156 PF10276 zf-CHCC:  Zinc-finger   40.4      17 0.00038   14.6   0.8   11   14-24     29-39  (40)
157 PF11931 DUF3449:  Domain of un  40.3     9.4  0.0002   21.2   0.0   20   44-63    102-122 (196)
158 PRK09678 DNA-binding transcrip  40.0     7.5 0.00016   17.9  -0.3   41   15-58      2-44  (72)
159 PF06397 Desulfoferrod_N:  Desu  39.9      15 0.00031   14.5   0.5   11   13-23      5-15  (36)
160 COG4338 Uncharacterized protei  39.7      13 0.00028   15.8   0.3   15   45-59     14-28  (54)
161 cd01413 SIR2_Af2 SIR2_Af2: Arc  39.0      53  0.0011   18.5   2.8   38    8-51    107-144 (222)
162 cd00065 FYVE FYVE domain; Zinc  38.8      33 0.00071   14.4   1.6   13   44-56     19-31  (57)
163 smart00440 ZnF_C2C2 C2C2 Zinc   38.6      17 0.00037   14.5   0.6   11   44-54     29-39  (40)
164 COG1326 Uncharacterized archae  37.5      42 0.00092   18.8   2.2   36   13-54      5-41  (201)
165 PF05290 Baculo_IE-1:  Baculovi  37.3      39 0.00084   17.8   1.9   19   12-30     78-96  (140)
166 PLN02748 tRNA dimethylallyltra  37.0      32  0.0007   22.0   1.9   24   13-36    417-441 (468)
167 KOG0227|consensus               36.9      24 0.00052   19.7   1.2   27    6-34     47-73  (222)
168 smart00731 SprT SprT homologue  36.7      13 0.00029   19.3   0.2   32   14-53    112-143 (146)
169 PF10263 SprT-like:  SprT-like   36.1      11 0.00024   19.6  -0.1   10   44-53    144-153 (157)
170 PRK03681 hypA hydrogenase nick  35.8      27 0.00058   17.5   1.2   11   14-24     70-80  (114)
171 PTZ00448 hypothetical protein;  35.5      35 0.00075   21.1   1.8   22   44-65    315-336 (373)
172 PF01096 TFIIS_C:  Transcriptio  35.4      12 0.00027   14.8  -0.0   10   44-53     29-38  (39)
173 COG1675 TFA1 Transcription ini  35.2      48   0.001   18.2   2.1   33   11-53    110-142 (176)
174 cd01407 SIR2-fam SIR2 family o  34.4      86  0.0019   17.5   3.2   40    8-52    103-142 (218)
175 smart00064 FYVE Protein presen  34.1      36 0.00078   14.9   1.4   29   15-56     11-39  (68)
176 COG0675 Transposase and inacti  33.9      27  0.0006   20.4   1.2   14   44-57    323-336 (364)
177 KOG2857|consensus               33.6      22 0.00047   18.8   0.7   23   13-35     16-38  (157)
178 PF06524 NOA36:  NOA36 protein;  33.5      46   0.001   19.7   2.0   13   10-22    138-150 (314)
179 COG5188 PRP9 Splicing factor 3  32.7      35 0.00076   21.1   1.5   28    8-35    368-396 (470)
180 TIGR01206 lysW lysine biosynth  32.4      23  0.0005   15.3   0.6   12   44-55      3-14  (54)
181 PRK10220 hypothetical protein;  32.1      31 0.00068   17.4   1.1   13   44-56     21-33  (111)
182 TIGR00244 transcriptional regu  32.0      23 0.00049   18.9   0.6   13   44-56     29-41  (147)
183 PF03811 Zn_Tnp_IS1:  InsA N-te  31.9      41 0.00088   13.2   1.2   11   10-20     25-35  (36)
184 TIGR00686 phnA alkylphosphonat  31.9      27 0.00059   17.5   0.8   13   44-56     20-32  (109)
185 PHA02998 RNA polymerase subuni  31.7     4.6  0.0001   22.1  -1.9   13   44-56    172-184 (195)
186 PF14311 DUF4379:  Domain of un  30.9      53  0.0011   13.9   1.8   12   44-55     29-40  (55)
187 PTZ00064 histone acetyltransfe  30.9      50  0.0011   21.5   2.0   22   44-65    281-302 (552)
188 COG0846 SIR2 NAD-dependent pro  30.8      43 0.00092   19.5   1.6   38    9-51    117-154 (250)
189 TIGR00622 ssl1 transcription f  29.9      44 0.00096   16.9   1.4   49   16-67     57-105 (112)
190 PLN00104 MYST -like histone ac  29.8      46 0.00099   21.2   1.7   21   44-64    199-219 (450)
191 KOG1280|consensus               29.8      65  0.0014   19.9   2.2   39   12-50     77-116 (381)
192 PF07975 C1_4:  TFIIH C1-like d  29.4       8 0.00017   16.6  -1.1   23   12-34     19-41  (51)
193 PRK05978 hypothetical protein;  28.4      24 0.00052   18.8   0.3   10   45-54     54-63  (148)
194 PRK00481 NAD-dependent deacety  28.4      83  0.0018   18.0   2.5   35    8-51    116-150 (242)
195 KOG1984|consensus               27.8      19 0.00041   24.9  -0.1   54   10-71    334-387 (1007)
196 KOG3014|consensus               27.6      74  0.0016   18.7   2.2   25   14-38     37-63  (257)
197 TIGR03831 YgiT_finger YgiT-typ  27.5      30 0.00064   13.6   0.5   11   15-25     33-43  (46)
198 COG5151 SSL1 RNA polymerase II  27.2      26 0.00057   21.2   0.4   24   44-67    389-412 (421)
199 PRK00762 hypA hydrogenase nick  26.7      28  0.0006   17.8   0.4   12   14-26     70-81  (124)
200 cd00974 DSRD Desulforedoxin (D  26.7      33 0.00071   12.9   0.5   10   44-53      5-14  (34)
201 COG5246 PRP11 Splicing factor   26.5      66  0.0014   18.0   1.8   28    6-35     47-74  (222)
202 PF14369 zf-RING_3:  zinc-finge  26.4      36 0.00078   13.2   0.6   10   45-54     23-32  (35)
203 COG5027 SAS2 Histone acetyltra  26.2      40 0.00086   20.8   1.0   25   44-68    159-183 (395)
204 COG1327 Predicted transcriptio  26.2      32 0.00069   18.5   0.5   13   44-56     29-41  (156)
205 PRK12722 transcriptional activ  25.9      51  0.0011   18.3   1.3    7   44-50    155-161 (187)
206 PTZ00043 cytochrome c oxidase   25.8      40 0.00086   19.5   0.9   16   12-27    179-194 (268)
207 PRK08222 hydrogenase 4 subunit  25.8      60  0.0013   17.7   1.6   18   44-61    115-132 (181)
208 PF03107 C1_2:  C1 domain;  Int  25.1      47   0.001   12.1   0.8    8   45-52      2-9   (30)
209 KOG2747|consensus               24.9      48   0.001   20.8   1.2   25   44-68    159-183 (396)
210 PF13240 zinc_ribbon_2:  zinc-r  24.6      35 0.00077   11.7   0.4    6   46-51     16-21  (23)
211 KOG1994|consensus               24.6      55  0.0012   19.0   1.3   21   14-34    239-259 (268)
212 PRK00420 hypothetical protein;  24.6      40 0.00087   17.0   0.7   27   15-53     24-50  (112)
213 cd00296 SIR2 SIR2 superfamily   24.4 1.2E+02  0.0026   16.8   2.7   19    8-26    107-125 (222)
214 PRK12860 transcriptional activ  24.4      53  0.0011   18.3   1.2    9   16-24    136-144 (189)
215 PLN03239 histone acetyltransfe  24.4      54  0.0012   20.2   1.3   21   44-64    107-127 (351)
216 KOG2932|consensus               24.3 1.5E+02  0.0032   18.3   3.0   25   44-68    145-172 (389)
217 PF11672 DUF3268:  Protein of u  24.3      25 0.00053   17.5  -0.0   10   13-22      1-10  (102)
218 PF14787 zf-CCHC_5:  GAG-polypr  24.0      44 0.00096   13.2   0.6   14   45-58      4-17  (36)
219 TIGR00319 desulf_FeS4 desulfof  23.8      45 0.00097   12.5   0.7   12   13-24      6-17  (34)
220 PRK01343 zinc-binding protein;  23.8      52  0.0011   14.5   0.9   11   44-54     10-20  (57)
221 TIGR03830 CxxCG_CxxCG_HTH puta  23.7      96  0.0021   15.4   2.0   22   14-35     31-52  (127)
222 smart00132 LIM Zinc-binding do  23.5      41 0.00089   12.3   0.6   10   44-53     28-37  (39)
223 PF11789 zf-Nse:  Zinc-finger o  23.4      61  0.0013   14.1   1.1   11   47-57     28-38  (57)
224 PF05766 NinG:  Bacteriophage L  23.3      24 0.00052   19.6  -0.2   14   13-26      5-18  (189)
225 COG4847 Uncharacterized protei  22.4      41  0.0009   16.5   0.5   12   11-22      3-14  (103)
226 PF08271 TF_Zn_Ribbon:  TFIIB z  22.4      48   0.001   13.2   0.7    7   45-51      2-8   (43)
227 KOG4118|consensus               22.3      53  0.0011   14.9   0.8   24   44-67     39-62  (74)
228 PF08792 A2L_zn_ribbon:  A2L zi  22.2      41 0.00089   12.8   0.4   11   44-54     22-32  (33)
229 PRK12387 formate hydrogenlyase  21.6      74  0.0016   17.3   1.4   19   13-31    113-131 (180)
230 PF13248 zf-ribbon_3:  zinc-rib  21.1      36 0.00078   12.0   0.1    6   46-51     19-24  (26)
231 PF13821 DUF4187:  Domain of un  21.0      63  0.0014   14.0   0.9   18   15-32     28-45  (55)
232 PRK06260 threonine synthase; V  20.9      80  0.0017   19.5   1.6   10   15-24      4-13  (397)
233 PF06353 DUF1062:  Protein of u  20.5      51  0.0011   17.4   0.7   10   15-24     14-23  (142)
234 KOG0801|consensus               20.4      63  0.0014   17.7   1.0   17    4-23    131-147 (205)
235 COG1656 Uncharacterized conser  20.1 1.3E+02  0.0029   16.5   2.1   20   44-63    131-150 (165)

No 1  
>KOG2462|consensus
Probab=99.85  E-value=5.9e-22  Score=107.85  Aligned_cols=70  Identities=20%  Similarity=0.379  Sum_probs=57.9

Q ss_pred             ccccccCCCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHHhccCCCCCC
Q psy4268           2 LGYYFSAPSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYRKHVGEDGAL   74 (86)
Q Consensus         2 l~~h~~~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~   74 (86)
                      |++|+++|+  -++.|.+||+.|+..|.|+.|+|+|+|++| |.|..|++.|..+++|..|+++|.+.|+..+
T Consensus       177 LkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKP-F~C~hC~kAFADRSNLRAHmQTHS~~K~~qC  246 (279)
T KOG2462|consen  177 LKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKP-FSCPHCGKAFADRSNLRAHMQTHSDVKKHQC  246 (279)
T ss_pred             HhhHhhccC--CCcccccccccccchHHhhcccccccCCCC-ccCCcccchhcchHHHHHHHHhhcCCccccC
Confidence            567777776  578888888888888888888888888888 8888888888888888888888888886544


No 2  
>KOG2462|consensus
Probab=99.83  E-value=3e-21  Score=105.14  Aligned_cols=64  Identities=25%  Similarity=0.485  Sum_probs=61.1

Q ss_pred             CccccccCCCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHH
Q psy4268           1 MLGYYFSAPSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYR   65 (86)
Q Consensus         1 ~l~~h~~~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~   65 (86)
                      +|+.|+++|+|||||.|..|+++|..+++|..|+++|.+.++ |.|..|+|.|...+.|.+|...
T Consensus       202 LLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~-~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  202 LLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKK-HQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             HhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcc-ccCcchhhHHHHHHHHHHhhhh
Confidence            589999999999999999999999999999999999999999 9999999999999999999743


No 3  
>KOG3576|consensus
Probab=99.62  E-value=3.1e-17  Score=86.66  Aligned_cols=69  Identities=33%  Similarity=0.577  Sum_probs=65.0

Q ss_pred             CccccccCCCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHHhccCC
Q psy4268           1 MLGYYFSAPSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYRKHVGE   70 (86)
Q Consensus         1 ~l~~h~~~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~   70 (86)
                      ||.+|++-|+..+.+.|..||++|....+|.+|.++|+|..| |+|..|++.|.+..+|..|.+..+|..
T Consensus       132 mlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrp-ykc~~c~kaftqrcsleshl~kvhgv~  200 (267)
T KOG3576|consen  132 MLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRP-YKCSLCEKAFTQRCSLESHLKKVHGVQ  200 (267)
T ss_pred             HHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccc-cchhhhhHHHHhhccHHHHHHHHcCch
Confidence            688999999999999999999999999999999999999999 999999999999999999998777654


No 4  
>KOG3623|consensus
Probab=99.49  E-value=5.1e-15  Score=89.91  Aligned_cols=61  Identities=25%  Similarity=0.523  Sum_probs=53.7

Q ss_pred             ccccccCCCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHH
Q psy4268           2 LGYYFSAPSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHY   63 (86)
Q Consensus         2 l~~h~~~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~   63 (86)
                      |.+|.=-|+|.+||.|.+|.++|..+..|..|.|.|.|++| |.|..|+|.|..+-+...||
T Consensus       910 LaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKP-fQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  910 LARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKP-FQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             HHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCc-chhhhhhhhcccccchHhhh
Confidence            45676678999999999999999999999999999999999 99999999999888888887


No 5  
>KOG1074|consensus
Probab=99.42  E-value=1.2e-14  Score=89.09  Aligned_cols=68  Identities=25%  Similarity=0.583  Sum_probs=60.5

Q ss_pred             ccccccCCCCCCceecccccccccChHHHHHHHHHhhCC----CCCccCC---CCccccCChhHHHHHHHHhccCC
Q psy4268           2 LGYYFSAPSGEKRYLCDSCDRTYSNRSSLKRHMNYECGK----LPAFPCT---LCSYATKRKTSLASHYYRKHVGE   70 (86)
Q Consensus         2 l~~h~~~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~----~~~~~c~---~c~~~f~~~~~l~~h~~~~~~~~   70 (86)
                      |++|.++|+||+||+|++|+++|..+.+|..|+.+|...    .. +.|.   +|.+.|...-.|+.|++.|.++.
T Consensus       621 LqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q-~ScP~~~ic~~kftn~V~lpQhIriH~~~~  695 (958)
T KOG1074|consen  621 LQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQ-FSCPSTFICQKKFTNAVTLPQHIRIHLGGQ  695 (958)
T ss_pred             hhhhhhcccCcCccccccccchhccccchhhcccccccCcccccc-ccCCchhhhcccccccccccceEEeecCCC
Confidence            789999999999999999999999999999999888764    34 6788   89999999999999998888543


No 6  
>KOG3623|consensus
Probab=99.28  E-value=1.3e-12  Score=79.88  Aligned_cols=65  Identities=29%  Similarity=0.547  Sum_probs=60.5

Q ss_pred             CCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHHhccCCCCCCC
Q psy4268          10 SGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYRKHVGEDGALP   75 (86)
Q Consensus        10 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~~   75 (86)
                      +.+..|.|..|.+.|-..+.|.+|.--|+|.+| |.|.+|.|.|.....|..|.|+|.|+|++.+.
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRP-yqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCd  954 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRP-YQCIICKKAFKHKHHLTEHKRLHSGEKPFQCD  954 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCC-cccchhhHhhhhhhhhhhhhhhccCCCcchhh
Confidence            345689999999999999999999988999999 99999999999999999999999999998763


No 7  
>PHA02768 hypothetical protein; Provisional
Probab=99.25  E-value=4e-12  Score=54.56  Aligned_cols=42  Identities=21%  Similarity=0.428  Sum_probs=37.8

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHH
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSL   59 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l   59 (86)
                      |.|..||+.|+....|..|++.|.  ++ ++|..|++.|.+.+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~-~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TN-LKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--Cc-ccCCcccceeccccee
Confidence            789999999999999999999988  56 9999999999877654


No 8  
>PHA00733 hypothetical protein
Probab=99.25  E-value=2.3e-11  Score=61.27  Aligned_cols=61  Identities=25%  Similarity=0.500  Sum_probs=50.9

Q ss_pred             ccccCCCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHHhcc
Q psy4268           4 YYFSAPSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYRKHV   68 (86)
Q Consensus         4 ~h~~~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~   68 (86)
                      .|+..+ +.++|.|..|++.|.....|..|++.+  ..+ |.|..|++.|.....|..|+...|+
T Consensus        64 ~~~~~~-~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~-~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         64 KLLTSK-AVSPYVCPLCLMPFSSSVSLKQHIRYT--EHS-KVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             hhcccC-CCCCccCCCCCCcCCCHHHHHHHHhcC--CcC-ccCCCCCCccCCHHHHHHHHHHhcC
Confidence            344444 588999999999999999999999865  346 8999999999999999999876654


No 9  
>KOG3576|consensus
Probab=99.10  E-value=2.5e-11  Score=64.67  Aligned_cols=66  Identities=17%  Similarity=0.311  Sum_probs=59.6

Q ss_pred             CCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHHhccCCCCCCCC
Q psy4268          10 SGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYRKHVGEDGALPP   76 (86)
Q Consensus        10 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~~~   76 (86)
                      ++...+.|.+|++.|.....|.+|++.|...+. +-|..||+.|..-..|.+|.++|+|.+++.+..
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr-~lct~cgkgfndtfdlkrh~rthtgvrpykc~~  178 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKR-HLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSL  178 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccHHHH-HHHhhccCcccchhhhhhhhccccCccccchhh
Confidence            445669999999999999999999999988888 899999999999999999999999999987643


No 10 
>KOG1074|consensus
Probab=99.06  E-value=1.5e-10  Score=71.81  Aligned_cols=59  Identities=24%  Similarity=0.473  Sum_probs=54.7

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHHhccCCCCCC
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYRKHVGEDGAL   74 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~   74 (86)
                      ..|.+|++.|.....|+.|+++|++.++ |.|..|++.|....+|+.|+.+|....+...
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KP-F~C~fC~~aFttrgnLKvHMgtH~w~q~~sr  938 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKP-FFCHFCEEAFTTRGNLKVHMGTHMWVQPPSR  938 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCC-ccchhhhhhhhhhhhhhhhhccccccCCCcc
Confidence            7899999999999999999999999999 9999999999999999999998887665444


No 11 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.97  E-value=3.5e-11  Score=44.66  Aligned_cols=23  Identities=30%  Similarity=0.785  Sum_probs=11.6

Q ss_pred             HHHHHHhhCCCCCccCCCCccccC
Q psy4268          31 KRHMNYECGKLPAFPCTLCSYATK   54 (86)
Q Consensus        31 ~~h~~~~~~~~~~~~c~~c~~~f~   54 (86)
                      ..|+++|+++++ |.|..|++.|.
T Consensus         3 ~~H~~~H~~~k~-~~C~~C~k~F~   25 (26)
T PF13465_consen    3 RRHMRTHTGEKP-YKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHSSSSS-EEESSSSEEES
T ss_pred             HHHhhhcCCCCC-CCCCCCcCeeC
Confidence            345555555555 55555555443


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.96  E-value=7.4e-10  Score=41.05  Aligned_cols=24  Identities=33%  Similarity=0.717  Sum_probs=22.1

Q ss_pred             ccccccCCCCCCceeccccccccc
Q psy4268           2 LGYYFSAPSGEKRYLCDSCDRTYS   25 (86)
Q Consensus         2 l~~h~~~h~~~~~~~c~~c~~~~~   25 (86)
                      |.+|++.|+|++||.|..|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            578999999999999999999985


No 13 
>KOG3993|consensus
Probab=98.81  E-value=1.4e-09  Score=63.33  Aligned_cols=70  Identities=21%  Similarity=0.416  Sum_probs=56.5

Q ss_pred             CccccccCCCCCCceecccccccccChHHHHHHHHHhhCCC--------C------------------------CccCCC
Q psy4268           1 MLGYYFSAPSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKL--------P------------------------AFPCTL   48 (86)
Q Consensus         1 ~l~~h~~~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~--------~------------------------~~~c~~   48 (86)
                      ||..|+........|.|..|++.|+...||..|.++|....        +                        .|.|..
T Consensus       282 ~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~  361 (500)
T KOG3993|consen  282 ALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHT  361 (500)
T ss_pred             HHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHH
Confidence            45667666666678999999999999999999999875321        1                        167999


Q ss_pred             CccccCChhHHHHHHHHhccCC
Q psy4268          49 CSYATKRKTSLASHYYRKHVGE   70 (86)
Q Consensus        49 c~~~f~~~~~l~~h~~~~~~~~   70 (86)
                      |+++|.+...|.+|+..|+...
T Consensus       362 C~KkFrRqAYLrKHqlthq~~~  383 (500)
T KOG3993|consen  362 CGKKFRRQAYLRKHQLTHQRAP  383 (500)
T ss_pred             hhhhhHHHHHHHHhHHhhhccc
Confidence            9999999999999987777543


No 14 
>PHA00616 hypothetical protein
Probab=98.68  E-value=1.2e-08  Score=41.93  Aligned_cols=33  Identities=12%  Similarity=0.290  Sum_probs=19.9

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCC
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCT   47 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~   47 (86)
                      ||.|..||+.|...+.+..|++.+++.++ +.|.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~-~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK-LTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc-ccee
Confidence            35566666666666666666666666655 5544


No 15 
>PHA00616 hypothetical protein
Probab=98.63  E-value=2.5e-08  Score=41.04  Aligned_cols=31  Identities=19%  Similarity=0.398  Sum_probs=28.4

Q ss_pred             ccCCCCccccCChhHHHHHHHHhccCCCCCC
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKHVGEDGAL   74 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~~   74 (86)
                      |.|..||+.|.....+..|++.++++++...
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            8999999999999999999999999987544


No 16 
>PHA00732 hypothetical protein
Probab=98.58  E-value=4.5e-08  Score=45.48  Aligned_cols=43  Identities=26%  Similarity=0.524  Sum_probs=35.9

Q ss_pred             ceecccccccccChHHHHHHHHH-hhCCCCCccCCCCccccCChhHHHHHH
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNY-ECGKLPAFPCTLCSYATKRKTSLASHY   63 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~-~~~~~~~~~c~~c~~~f~~~~~l~~h~   63 (86)
                      ||.|..|++.|.....|..|++. |.   + +.|..|++.|.+   +..|.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~-~~C~~CgKsF~~---l~~H~   44 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---L-TKCPVCNKSYRR---LNQHF   44 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---C-CccCCCCCEeCC---hhhhh
Confidence            57899999999999999999974 43   4 789999999983   56665


No 17 
>KOG3608|consensus
Probab=98.52  E-value=1.5e-08  Score=58.19  Aligned_cols=66  Identities=24%  Similarity=0.368  Sum_probs=48.1

Q ss_pred             ccccccCCCCCCceecccccccccChHHHHHHHHH--hhCCCCCccCCCCccccCChhHHHHHHHHhcc
Q psy4268           2 LGYYFSAPSGEKRYLCDSCDRTYSNRSSLKRHMNY--ECGKLPAFPCTLCSYATKRKTSLASHYYRKHV   68 (86)
Q Consensus         2 l~~h~~~h~~~~~~~c~~c~~~~~~~~~l~~h~~~--~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~   68 (86)
                      |..|++.|+++|-..|..||.-|.....|-.|.+-  .....+ |.|..|.|.|.....|..|+..|..
T Consensus       195 LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~-fqC~~C~KrFaTeklL~~Hv~rHvn  262 (467)
T KOG3608|consen  195 LREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNS-FQCAQCFKRFATEKLLKSHVVRHVN  262 (467)
T ss_pred             HHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCc-hHHHHHHHHHhHHHHHHHHHHHhhh
Confidence            66788999999998888888888888888877753  223345 7777777777776666666655543


No 18 
>KOG3608|consensus
Probab=98.49  E-value=1.3e-07  Score=54.46  Aligned_cols=64  Identities=27%  Similarity=0.577  Sum_probs=47.5

Q ss_pred             cccccc-CCCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCC--CccccCChhHHHHHHHHhc
Q psy4268           2 LGYYFS-APSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTL--CSYATKRKTSLASHYYRKH   67 (86)
Q Consensus         2 l~~h~~-~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~--c~~~f~~~~~l~~h~~~~~   67 (86)
                      |..|++ .|+..||++|..|.+.+...+.|..|..+|. ... |.|..  |..+|.+...+.+|++.++
T Consensus       279 L~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~-y~C~h~~C~~s~r~~~q~~~H~~evh  345 (467)
T KOG3608|consen  279 LTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTV-YQCEHPDCHYSVRTYTQMRRHFLEVH  345 (467)
T ss_pred             HHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccc-eecCCCCCcHHHHHHHHHHHHHHHhc
Confidence            345655 5777888888888888888888888888776 333 77765  7777777777777776666


No 19 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.35  E-value=4.6e-07  Score=32.32  Aligned_cols=22  Identities=27%  Similarity=0.685  Sum_probs=12.6

Q ss_pred             ccCCCCccccCChhHHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYYR   65 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~   65 (86)
                      |.|..|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3455566666666666666544


No 20 
>PHA02768 hypothetical protein; Provisional
Probab=98.29  E-value=1.3e-06  Score=37.68  Aligned_cols=24  Identities=17%  Similarity=0.602  Sum_probs=23.4

Q ss_pred             ccCCCCccccCChhHHHHHHHHhc
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKH   67 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~   67 (86)
                      |.|..||+.|.+..+|..|++.|+
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~   29 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN   29 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC
Confidence            899999999999999999999998


No 21 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.23  E-value=1.6e-06  Score=30.89  Aligned_cols=23  Identities=43%  Similarity=0.950  Sum_probs=21.0

Q ss_pred             eecccccccccChHHHHHHHHHh
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYE   37 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~   37 (86)
                      |.|..|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            68999999999999999999864


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.22  E-value=5.9e-06  Score=35.71  Aligned_cols=51  Identities=24%  Similarity=0.434  Sum_probs=38.4

Q ss_pred             ceecccccccccChHHHHHHHHH-hhCC-CCCccCCCCccccCChhHHHHHHHHhcc
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNY-ECGK-LPAFPCTLCSYATKRKTSLASHYYRKHV   68 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~-~~~~-~~~~~c~~c~~~f~~~~~l~~h~~~~~~   68 (86)
                      .|.|..|++ ......|..|... |... +. +.|+.|...+.  .+|..|+..+++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~-v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKN-VVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCC-ccCCCchhhhh--hHHHHHHHHhcC
Confidence            478999999 5667889999775 5544 45 89999987655  378889877653


No 23 
>PHA00733 hypothetical protein
Probab=98.17  E-value=1.4e-06  Score=44.02  Aligned_cols=55  Identities=20%  Similarity=0.251  Sum_probs=42.3

Q ss_pred             CCCceecccccccccChHHHHHHH--H---HhhCCCCCccCCCCccccCChhHHHHHHHHh
Q psy4268          11 GEKRYLCDSCDRTYSNRSSLKRHM--N---YECGKLPAFPCTLCSYATKRKTSLASHYYRK   66 (86)
Q Consensus        11 ~~~~~~c~~c~~~~~~~~~l~~h~--~---~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   66 (86)
                      ..+++.|.+|...|.....+..+.  .   .+.+..+ |.|..|++.|.....|..|++.+
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kP-y~C~~Cgk~Fss~s~L~~H~r~h   96 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSP-YVCPLCLMPFSSSVSLKQHIRYT   96 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCC-ccCCCCCCcCCCHHHHHHHHhcC
Confidence            467899999988777766666551  1   2234567 99999999999999999998754


No 24 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.12  E-value=3.6e-06  Score=29.97  Aligned_cols=23  Identities=26%  Similarity=0.657  Sum_probs=12.4

Q ss_pred             ccCCCCccccCChhHHHHHHHHh
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRK   66 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~   66 (86)
                      |.|..|++.|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            34566666666666666665544


No 25 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.05  E-value=4.5e-06  Score=51.21  Aligned_cols=38  Identities=16%  Similarity=0.479  Sum_probs=16.4

Q ss_pred             CceecccccccccChHHHHHHHHHhhCCCCCccCCCCcccc
Q psy4268          13 KRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYAT   53 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   53 (86)
                      +++.|. |++.+ ....|..|...+.+.++ +.|..|++.|
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp-i~C~fC~~~v  514 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRL-ITCRFCGDMV  514 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCc-eeCCCCCCcc
Confidence            344444 44322 33444444444444444 4444444444


No 26 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.02  E-value=8.4e-06  Score=50.05  Aligned_cols=63  Identities=17%  Similarity=0.335  Sum_probs=49.9

Q ss_pred             ccccccCCCCCCceeccccccccc----------ChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHHhc
Q psy4268           2 LGYYFSAPSGEKRYLCDSCDRTYS----------NRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYRKH   67 (86)
Q Consensus         2 l~~h~~~h~~~~~~~c~~c~~~~~----------~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   67 (86)
                      |..|+..|.+.+++.|..|+..+.          ....|..|... .|.++ +.|..|++.+.... +..|+-..|
T Consensus       492 L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~-CG~rt-~~C~~Cgk~Vrlrd-m~~H~~~~h  564 (567)
T PLN03086        492 MVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI-CGSRT-APCDSCGRSVMLKE-MDIHQIAVH  564 (567)
T ss_pred             HHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh-cCCcc-eEccccCCeeeehh-HHHHHHHhh
Confidence            456888899999999999998884          23578899887 48888 99999999887764 677765444


No 27 
>KOG3993|consensus
Probab=98.01  E-value=6e-07  Score=52.80  Aligned_cols=59  Identities=22%  Similarity=0.430  Sum_probs=49.8

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHHhccCCCCC
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYRKHVGEDGA   73 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~~   73 (86)
                      .|.|..|...|.....|.+|.-.-..... |+|..|+|.|.-..+|..|++.|--+....
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vE-YrCPEC~KVFsCPANLASHRRWHKPR~eaa  325 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVE-YRCPECDKVFSCPANLASHRRWHKPRPEAA  325 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEee-ecCCcccccccCchhhhhhhcccCCchhhh
Confidence            48999999999999999999755555556 999999999999999999998887654433


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.97  E-value=5.8e-06  Score=30.54  Aligned_cols=22  Identities=23%  Similarity=0.445  Sum_probs=11.7

Q ss_pred             ccCCCCccccCChhHHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYYR   65 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~   65 (86)
                      |.|..|++.|.....|..|++.
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~   23 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRS   23 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCT
T ss_pred             CCCCccCCccCChhHHHHHhHH
Confidence            4555555555555555555433


No 29 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.95  E-value=4.1e-06  Score=30.96  Aligned_cols=25  Identities=36%  Similarity=0.878  Sum_probs=22.3

Q ss_pred             ceecccccccccChHHHHHHHHHhh
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYEC   38 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~   38 (86)
                      +|.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5899999999999999999997653


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.84  E-value=2.7e-05  Score=27.58  Aligned_cols=23  Identities=26%  Similarity=0.819  Sum_probs=19.1

Q ss_pred             eecccccccccChHHHHHHHHHh
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYE   37 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~   37 (86)
                      |.|..|++.|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            68999999999999999999865


No 31 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.84  E-value=2.9e-05  Score=32.85  Aligned_cols=32  Identities=22%  Similarity=0.548  Sum_probs=19.5

Q ss_pred             CCCCccCCCCccccCChhHHHHHHHHhccCCCC
Q psy4268          40 KLPAFPCTLCSYATKRKTSLASHYYRKHVGEDG   72 (86)
Q Consensus        40 ~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~   72 (86)
                      ..| -.|+.|+..+.+..+|.+|+...|+.+++
T Consensus        22 ~~P-atCP~C~a~~~~srnLrRHle~~H~~k~~   53 (54)
T PF09237_consen   22 EQP-ATCPICGAVIRQSRNLRRHLEIRHFKKPG   53 (54)
T ss_dssp             S---EE-TTT--EESSHHHHHHHHHHHTTTS--
T ss_pred             CCC-CCCCcchhhccchhhHHHHHHHHhcccCC
Confidence            345 67888888888888888888777777653


No 32 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.77  E-value=7.8e-06  Score=46.85  Aligned_cols=51  Identities=31%  Similarity=0.617  Sum_probs=41.8

Q ss_pred             CCceeccc--ccccccChHHHHHHHHH-hh------------------CCCCCccCCCCccccCChhHHHHHH
Q psy4268          12 EKRYLCDS--CDRTYSNRSSLKRHMNY-EC------------------GKLPAFPCTLCSYATKRKTSLASHY   63 (86)
Q Consensus        12 ~~~~~c~~--c~~~~~~~~~l~~h~~~-~~------------------~~~~~~~c~~c~~~f~~~~~l~~h~   63 (86)
                      +|||+|.+  |.+.|...-.|..|+.- |-                  -.+| |.|..|+|.+.....|..|+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KP-YrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKP-YRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCc-eeccccchhhccCccceecc
Confidence            59999998  99999999999988752 20                  0167 99999999999988888885


No 33 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.64  E-value=8.5e-05  Score=26.60  Aligned_cols=20  Identities=30%  Similarity=0.537  Sum_probs=11.4

Q ss_pred             cCCCCccccCChhHHHHHHH
Q psy4268          45 PCTLCSYATKRKTSLASHYY   64 (86)
Q Consensus        45 ~c~~c~~~f~~~~~l~~h~~   64 (86)
                      .|..|++.|.....+..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHH
Confidence            45555556655555555554


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.60  E-value=0.0002  Score=30.34  Aligned_cols=34  Identities=24%  Similarity=0.442  Sum_probs=24.3

Q ss_pred             CCCCCceecccccccccChHHHHHHHHHhhCCCC
Q psy4268           9 PSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLP   42 (86)
Q Consensus         9 h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~   42 (86)
                      +..+.|..|.+|+..+.+..+|.+|+....+.++
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            4467899999999999999999999988777665


No 35 
>PRK04860 hypothetical protein; Provisional
Probab=97.56  E-value=8.3e-05  Score=39.06  Aligned_cols=39  Identities=23%  Similarity=0.525  Sum_probs=32.5

Q ss_pred             CceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCCh
Q psy4268          13 KRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRK   56 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   56 (86)
                      -+|.|. |+.   ....+..|.+++.+.++ |.|..|++.|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~-YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAV-YRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCcc-EECCCCCceeEEe
Confidence            369997 886   56778899999999999 9999999887644


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.48  E-value=0.00016  Score=25.80  Aligned_cols=24  Identities=33%  Similarity=0.826  Sum_probs=21.0

Q ss_pred             eecccccccccChHHHHHHHHHhh
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYEC   38 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~   38 (86)
                      +.|..|++.|.....+..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999998654


No 37 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.47  E-value=0.00012  Score=35.08  Aligned_cols=24  Identities=29%  Similarity=0.689  Sum_probs=20.5

Q ss_pred             ccCCCCccccCChhHHHHHHHHhc
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKH   67 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~   67 (86)
                      +.|..|++.|.....|..|++.+.
T Consensus        51 ~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   51 FRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             EEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCccCCCCcCHHHHHHHHcCcc
Confidence            789999999999999999997653


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.32  E-value=0.00022  Score=25.66  Aligned_cols=21  Identities=33%  Similarity=1.053  Sum_probs=11.3

Q ss_pred             eecccccccccChHHHHHHHH
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMN   35 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~   35 (86)
                      |.|.+|+..|.....+..|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            345555555555555555554


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.20  E-value=0.0005  Score=24.49  Aligned_cols=22  Identities=45%  Similarity=0.886  Sum_probs=9.5

Q ss_pred             cCCCCccccCChhHHHHHHHHhc
Q psy4268          45 PCTLCSYATKRKTSLASHYYRKH   67 (86)
Q Consensus        45 ~c~~c~~~f~~~~~l~~h~~~~~   67 (86)
                      .|..|..... ...|..|++.++
T Consensus         2 ~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    2 KCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             E-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCcCC-HHHHHHHHHhhC
Confidence            4555554444 445555554443


No 40 
>PHA00732 hypothetical protein
Probab=97.16  E-value=0.00062  Score=31.72  Aligned_cols=24  Identities=29%  Similarity=0.647  Sum_probs=21.5

Q ss_pred             ccCCCCccccCChhHHHHHHHH-hc
Q psy4268          44 FPCTLCSYATKRKTSLASHYYR-KH   67 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~-~~   67 (86)
                      |.|..|++.|.+...|..|++. |.
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~   26 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT   26 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC
Confidence            8899999999999999999874 44


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.13  E-value=0.00031  Score=25.24  Aligned_cols=22  Identities=27%  Similarity=0.588  Sum_probs=19.5

Q ss_pred             ccCCCCccccCChhHHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYYR   65 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~   65 (86)
                      |.|..|++.|.....+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            5799999999999999999854


No 42 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.59  E-value=0.00063  Score=25.00  Aligned_cols=21  Identities=43%  Similarity=1.092  Sum_probs=12.2

Q ss_pred             eecccccccccChHHHHHHHH
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMN   35 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~   35 (86)
                      |.|..|++.|.....+..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666555544


No 43 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.59  E-value=0.0034  Score=22.71  Aligned_cols=20  Identities=25%  Similarity=0.574  Sum_probs=13.1

Q ss_pred             ccCCCCccccCChhHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYY   64 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~   64 (86)
                      ..|..||+.| ....|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            4677788888 4445777753


No 44 
>KOG2893|consensus
Probab=95.78  E-value=0.0022  Score=35.84  Aligned_cols=45  Identities=24%  Similarity=0.522  Sum_probs=33.2

Q ss_pred             CCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHH
Q psy4268          12 EKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASH   62 (86)
Q Consensus        12 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h   62 (86)
                      .|+ .|..|+.-|.....|++|++.    +- |+|.+|.+..-+-..|..|
T Consensus         9 ~kp-wcwycnrefddekiliqhqka----kh-fkchichkkl~sgpglsih   53 (341)
T KOG2893|consen    9 DKP-WCWYCNREFDDEKILIQHQKA----KH-FKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             CCc-eeeecccccchhhhhhhhhhh----cc-ceeeeehhhhccCCCceee
Confidence            344 577899999999999999875    34 9999998765544444444


No 45 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.62  E-value=0.016  Score=22.27  Aligned_cols=22  Identities=23%  Similarity=0.754  Sum_probs=14.2

Q ss_pred             ceecccccccccChHHHHHHHH
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMN   35 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~   35 (86)
                      +|.|.+|+..|.....+..|..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4667777777766666666654


No 46 
>KOG1146|consensus
Probab=94.96  E-value=0.025  Score=38.61  Aligned_cols=57  Identities=28%  Similarity=0.511  Sum_probs=46.1

Q ss_pred             CCCCCCceecccccccccChHHHHHHHHHhh-------------------------CCCCCccCCCCccccCChhHHHHH
Q psy4268           8 APSGEKRYLCDSCDRTYSNRSSLKRHMNYEC-------------------------GKLPAFPCTLCSYATKRKTSLASH   62 (86)
Q Consensus         8 ~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~-------------------------~~~~~~~c~~c~~~f~~~~~l~~h   62 (86)
                      .++..+.+.|..|+..|.....|..|++..+                         +.++ |.|..|...+....+|.+|
T Consensus       459 L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p-~~C~~C~~stttng~Lsih  537 (1406)
T KOG1146|consen  459 LHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP-YPCRACNYSTTTNGNLSIH  537 (1406)
T ss_pred             eecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc-ccceeeeeeeecchHHHHH
Confidence            4566688999999999999999999998711                         1135 7899999999998889888


Q ss_pred             HHH
Q psy4268          63 YYR   65 (86)
Q Consensus        63 ~~~   65 (86)
                      +..
T Consensus       538 lqS  540 (1406)
T KOG1146|consen  538 LQS  540 (1406)
T ss_pred             HHH
Confidence            743


No 47 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.72  E-value=0.028  Score=21.66  Aligned_cols=24  Identities=29%  Similarity=0.960  Sum_probs=16.6

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCCCccCCCCcc
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSY   51 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   51 (86)
                      |.|.+||..+....            .+ +.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~~-~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------AP-WVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CC-CcCcCCCC
Confidence            68888987653322            45 78998874


No 48 
>PRK04860 hypothetical protein; Provisional
Probab=94.35  E-value=0.0092  Score=31.53  Aligned_cols=25  Identities=24%  Similarity=0.353  Sum_probs=21.4

Q ss_pred             ccccccCCCCCCceecccccccccC
Q psy4268           2 LGYYFSAPSGEKRYLCDSCDRTYSN   26 (86)
Q Consensus         2 l~~h~~~h~~~~~~~c~~c~~~~~~   26 (86)
                      +.+|.++|.|+++|.|..|+..|..
T Consensus       131 ~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        131 VRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             HHHHHHHhcCCccEECCCCCceeEE
Confidence            4578889999999999999987754


No 49 
>KOG2186|consensus
Probab=94.28  E-value=0.033  Score=31.51  Aligned_cols=49  Identities=20%  Similarity=0.423  Sum_probs=35.3

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHHh
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYRK   66 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~   66 (86)
                      -|.|.+||....- ..+..|+..-++ .- |.|..|+..|.. .....|...-
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~srCrn-~~-fSCIDC~k~F~~-~sYknH~kCI   51 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMSRCRN-AY-FSCIDCGKTFER-VSYKNHTKCI   51 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHHhccC-Ce-eEEeeccccccc-chhhhhhhhc
Confidence            3789999976543 556778866555 44 999999999998 4567776433


No 50 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.27  E-value=0.083  Score=25.06  Aligned_cols=25  Identities=28%  Similarity=0.757  Sum_probs=21.7

Q ss_pred             ceecccccccccChHHHHHHHHHhh
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYEC   38 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~   38 (86)
                      .+.|..|++.|.....|..|++.+.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            5899999999999999999998753


No 51 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=94.18  E-value=0.039  Score=27.33  Aligned_cols=30  Identities=27%  Similarity=0.650  Sum_probs=23.2

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCCh
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRK   56 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   56 (86)
                      ..|..||..|           .-.++.| ..|+.||..|.-.
T Consensus        10 R~Cp~CG~kF-----------YDLnk~P-ivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKF-----------YDLNKDP-IVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchh-----------ccCCCCC-ccCCCCCCccCcc
Confidence            5899999888           2344567 8899999888766


No 52 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.78  E-value=0.015  Score=34.43  Aligned_cols=60  Identities=25%  Similarity=0.474  Sum_probs=49.9

Q ss_pred             CceecccccccccChHHHHHHHH--HhhCC--CCCccCC--CCccccCChhHHHHHHHHhccCCCCC
Q psy4268          13 KRYLCDSCDRTYSNRSSLKRHMN--YECGK--LPAFPCT--LCSYATKRKTSLASHYYRKHVGEDGA   73 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~~h~~--~~~~~--~~~~~c~--~c~~~f~~~~~l~~h~~~~~~~~~~~   73 (86)
                      .++.|..|...|.....+..|.+  .|.++  ++ +.|.  .|++.|.+...+..|...+.+.....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~-~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~  353 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKP-FSCPYSLCGKLFSRNDALKRHILLHTSISPAK  353 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCc-eeeeccCCCccccccccccCCcccccCCCccc
Confidence            36788889999999999999998  78888  78 8998  79999999998888887777665443


No 53 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=92.23  E-value=0.12  Score=27.63  Aligned_cols=23  Identities=30%  Similarity=0.843  Sum_probs=17.6

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCCCCc
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCS   50 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~   50 (86)
                      -|.|.+||+.             +.|..| ..|+.||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P-~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAP-EVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCC-CcCCCCC
Confidence            6899999864             345566 8899998


No 54 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=91.29  E-value=0.23  Score=26.29  Aligned_cols=36  Identities=14%  Similarity=0.444  Sum_probs=26.1

Q ss_pred             CCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccC
Q psy4268           9 PSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATK   54 (86)
Q Consensus         9 h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   54 (86)
                      .....-|.|..|+..|+....+.         .. |.|+.||....
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~---------~~-F~Cp~Cg~~L~  139 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME---------LN-FTCPRCGAMLD  139 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH---------cC-CcCCCCCCEee
Confidence            34566799999998887766553         24 99999987544


No 55 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=91.11  E-value=0.16  Score=22.03  Aligned_cols=29  Identities=28%  Similarity=0.555  Sum_probs=21.5

Q ss_pred             CCCCCCceecccccccccChHHHHHHHHH
Q psy4268           8 APSGEKRYLCDSCDRTYSNRSSLKRHMNY   36 (86)
Q Consensus         8 ~h~~~~~~~c~~c~~~~~~~~~l~~h~~~   36 (86)
                      ...|+.-+.|..|+..|-...++.+|...
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            34577778888888888877777777653


No 56 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=90.88  E-value=0.21  Score=25.43  Aligned_cols=32  Identities=6%  Similarity=0.176  Sum_probs=23.6

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhH
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTS   58 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~   58 (86)
                      ..|..||..|.           -.++.| ..|+.||..|.....
T Consensus        10 r~Cp~cg~kFY-----------DLnk~p-~vcP~cg~~~~~~~~   41 (129)
T TIGR02300        10 RICPNTGSKFY-----------DLNRRP-AVSPYTGEQFPPEEA   41 (129)
T ss_pred             ccCCCcCcccc-----------ccCCCC-ccCCCcCCccCcchh
Confidence            58999998882           344556 899999988766533


No 57 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=90.44  E-value=0.24  Score=26.75  Aligned_cols=34  Identities=15%  Similarity=0.552  Sum_probs=25.1

Q ss_pred             CCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccC
Q psy4268          11 GEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATK   54 (86)
Q Consensus        11 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   54 (86)
                      ...-|.|..|+..|+....+.         .. |.|+.||....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~-F~Cp~Cg~~L~  147 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YG-FRCPQCGEMLE  147 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cC-CcCCCCCCCCe
Confidence            456799999998887765542         24 99999997654


No 58 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.45  E-value=0.32  Score=18.86  Aligned_cols=25  Identities=20%  Similarity=0.652  Sum_probs=16.1

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCCCCcc
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSY   51 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   51 (86)
                      .|.|..||+.+...            ..| ..|+.|+.
T Consensus         2 ~~~C~~CG~i~~g~------------~~p-~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE------------EAP-EKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC------------cCC-CcCcCCCC
Confidence            47888998654221            134 68888875


No 59 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=89.17  E-value=0.45  Score=23.40  Aligned_cols=25  Identities=28%  Similarity=0.797  Sum_probs=22.0

Q ss_pred             ccC----CCCccccCChhHHHHHHHHhcc
Q psy4268          44 FPC----TLCSYATKRKTSLASHYYRKHV   68 (86)
Q Consensus        44 ~~c----~~c~~~f~~~~~l~~h~~~~~~   68 (86)
                      |.|    ..|+....+...+.+|++..||
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            789    8899999999999999988775


No 60 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=88.77  E-value=0.062  Score=29.77  Aligned_cols=45  Identities=20%  Similarity=0.578  Sum_probs=27.7

Q ss_pred             CCceecccccccccChHHHHHHHHH---h-------hCCCCC----ccCCCCccccCCh
Q psy4268          12 EKRYLCDSCDRTYSNRSSLKRHMNY---E-------CGKLPA----FPCTLCSYATKRK   56 (86)
Q Consensus        12 ~~~~~c~~c~~~~~~~~~l~~h~~~---~-------~~~~~~----~~c~~c~~~f~~~   56 (86)
                      ++...|.+|+..|..........+.   .       .+..|.    ..|+.||.++...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            3568999999998877554444332   0       111110    3699999876643


No 61 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=88.73  E-value=0.51  Score=26.35  Aligned_cols=30  Identities=13%  Similarity=0.482  Sum_probs=22.4

Q ss_pred             CCCceecccccccccChHHHHHHHHHhhCC
Q psy4268          11 GEKRYLCDSCDRTYSNRSSLKRHMNYECGK   40 (86)
Q Consensus        11 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~   40 (86)
                      .+..|.|..|++.|.....+..|+...+.+
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            455699999999999999999999865443


No 62 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=88.65  E-value=0.32  Score=25.35  Aligned_cols=39  Identities=18%  Similarity=0.424  Sum_probs=24.8

Q ss_pred             CCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccC
Q psy4268          11 GEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATK   54 (86)
Q Consensus        11 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   54 (86)
                      +..-|.|..|+..|.....+...   . .... |.|+.||....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~~---d-~~~~-f~Cp~Cg~~l~  134 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQLL---D-MDGT-FTCPRCGEELE  134 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHhc---C-CCCc-EECCCCCCEEE
Confidence            45578999999888754432211   1 1233 89999987654


No 63 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=88.33  E-value=0.36  Score=24.86  Aligned_cols=24  Identities=21%  Similarity=0.225  Sum_probs=14.8

Q ss_pred             ccCCCCccccCChhHHHHHHHHhccCC
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKHVGE   70 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~~~~   70 (86)
                      ..|..||+.|...   .+|...|+|-.
T Consensus        73 i~clecGk~~k~L---krHL~~~~glt   96 (132)
T PF05443_consen   73 IICLECGKKFKTL---KRHLRTHHGLT   96 (132)
T ss_dssp             EE-TBT--EESBH---HHHHHHTT-S-
T ss_pred             eEEccCCcccchH---HHHHHHccCCC
Confidence            5799999988765   78888886654


No 64 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=86.60  E-value=0.73  Score=18.07  Aligned_cols=33  Identities=15%  Similarity=0.340  Sum_probs=20.2

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCCCccCCCCcccc
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYAT   53 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   53 (86)
                      ..|..|+..|......     +-..... ..|..|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~-----ip~~g~~-v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-----IPPKGRK-VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH-----CCCCCcE-EECCCCCCEe
Confidence            4678888777655432     2122234 6888888766


No 65 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=86.55  E-value=0.6  Score=18.26  Aligned_cols=34  Identities=15%  Similarity=0.298  Sum_probs=20.2

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCCCccCCCCccccC
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATK   54 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   54 (86)
                      +.|..|+..|......     ....... ..|..|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~-----~~~~~~~-v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQ-----LGANGGK-VRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHH-----cCCCCCE-EECCCCCCEEE
Confidence            5788888777554432     1111223 68888887663


No 66 
>KOG1146|consensus
Probab=86.02  E-value=0.76  Score=32.15  Aligned_cols=59  Identities=20%  Similarity=0.431  Sum_probs=45.3

Q ss_pred             CCceecccccccccChHHHHHHHHHhh-----------------CCCCCccCCCCccccCChhHHHHHHHHhccCCCC
Q psy4268          12 EKRYLCDSCDRTYSNRSSLKRHMNYEC-----------------GKLPAFPCTLCSYATKRKTSLASHYYRKHVGEDG   72 (86)
Q Consensus        12 ~~~~~c~~c~~~~~~~~~l~~h~~~~~-----------------~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~~   72 (86)
                      ..+|.|.+|...|.....+..|.+...                 .... | |..|...|.....|+.|++.-+++...
T Consensus      1282 ~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~-~-c~~c~~~~~~~~alqihm~~~~~~~kt 1357 (1406)
T KOG1146|consen 1282 THRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTY-H-CLACEVLLSGREALQIHMRSSAHRRKT 1357 (1406)
T ss_pred             chhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCccccc-c-chHHHhhcchhHHHHHHHHHhhhcccC
Confidence            457999999999999999988875211                 1123 5 888999999999999999876665543


No 67 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=85.99  E-value=0.52  Score=26.32  Aligned_cols=26  Identities=27%  Similarity=0.539  Sum_probs=19.5

Q ss_pred             ccCCCCccccCChhHHHHHHHHhccC
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKHVG   69 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~~~   69 (86)
                      |.|..|+|.|.-..-..+|+..-|.+
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             ECCCCCCcccCChHHHHHHHhhcCHH
Confidence            78999999999998889998766544


No 68 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=85.79  E-value=0.87  Score=17.91  Aligned_cols=34  Identities=15%  Similarity=0.462  Sum_probs=20.5

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCCCccCCCCccccC
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATK   54 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   54 (86)
                      ..|..|+..|.....     +...+... ..|..|+..|.
T Consensus         3 i~CP~C~~~f~v~~~-----~l~~~~~~-vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDD-----KLPAGGRK-VRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHH-----HcccCCcE-EECCCCCcEee
Confidence            467888877755443     12222334 78888887663


No 69 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=85.09  E-value=1.1  Score=26.76  Aligned_cols=24  Identities=25%  Similarity=0.607  Sum_probs=20.9

Q ss_pred             CCCCccCCC--CccccCChhHHHHHHH
Q psy4268          40 KLPAFPCTL--CSYATKRKTSLASHYY   64 (86)
Q Consensus        40 ~~~~~~c~~--c~~~f~~~~~l~~h~~   64 (86)
                      ++| |+|+.  |.|.+.....|..|+.
T Consensus       347 ~Kp-ykCpV~gC~K~YknqnGLKYH~l  372 (423)
T COG5189         347 GKP-YKCPVEGCNKKYKNQNGLKYHML  372 (423)
T ss_pred             Cce-ecCCCCCchhhhccccchhhhhh
Confidence            478 99976  9999999999999963


No 70 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=84.44  E-value=0.69  Score=19.05  Aligned_cols=30  Identities=23%  Similarity=0.540  Sum_probs=19.0

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccC
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATK   54 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   54 (86)
                      .|.|..||..+....          .... +.|+.||..+.
T Consensus         3 ~y~C~~CG~~~~~~~----------~~~~-~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDE----------YGTG-VRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECC----------CCCc-eECCCCCCeEE
Confidence            588888987664321          1114 78999986543


No 71 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=84.33  E-value=1.1  Score=18.52  Aligned_cols=27  Identities=30%  Similarity=0.735  Sum_probs=17.9

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCCCCccc
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYA   52 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   52 (86)
                      .|.|..||..|...           ...+ ..|..||..
T Consensus         2 ~Y~C~~Cg~~~~~~-----------~~~~-irC~~CG~r   28 (44)
T smart00659        2 IYICGECGRENEIK-----------SKDV-VRCRECGYR   28 (44)
T ss_pred             EEECCCCCCEeecC-----------CCCc-eECCCCCce
Confidence            37888898776432           2234 789888854


No 72 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=83.18  E-value=0.46  Score=28.25  Aligned_cols=45  Identities=29%  Similarity=0.471  Sum_probs=36.8

Q ss_pred             cccccc--CCCCC--Cceecc--cccccccChHHHHHHHHHhhCCCCCccCC
Q psy4268           2 LGYYFS--APSGE--KRYLCD--SCDRTYSNRSSLKRHMNYECGKLPAFPCT   47 (86)
Q Consensus         2 l~~h~~--~h~~~--~~~~c~--~c~~~~~~~~~l~~h~~~~~~~~~~~~c~   47 (86)
                      +..|..  .|.++  +++.|.  .|++.|.....+..|...+.+..+ +.+.
T Consensus       305 l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~  355 (467)
T COG5048         305 LTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISP-AKEK  355 (467)
T ss_pred             ccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCc-cccc
Confidence            456677  79999  999999  799999999999999888887765 5543


No 73 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=82.84  E-value=0.32  Score=19.14  Aligned_cols=32  Identities=22%  Similarity=0.490  Sum_probs=18.2

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCC
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKR   55 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~   55 (86)
                      ..|..||..|..        ........ -.|..||..+.+
T Consensus         2 r~C~~Cg~~Yh~--------~~~pP~~~-~~Cd~cg~~L~q   33 (36)
T PF05191_consen    2 RICPKCGRIYHI--------EFNPPKVE-GVCDNCGGELVQ   33 (36)
T ss_dssp             EEETTTTEEEET--------TTB--SST-TBCTTTTEBEBE
T ss_pred             cCcCCCCCcccc--------ccCCCCCC-CccCCCCCeeEe
Confidence            467788877643        22233444 578888765543


No 74 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=82.82  E-value=0.37  Score=20.29  Aligned_cols=30  Identities=17%  Similarity=0.467  Sum_probs=18.1

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCCCCcc
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSY   51 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   51 (86)
                      .|.|..|+..|.....+      .. ... ..|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~~------~~-~~~-~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQKM------SD-DPL-ATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEec------CC-CCC-CCCCCCCC
Confidence            37888888877643221      11 223 46888885


No 75 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=82.52  E-value=0.16  Score=26.78  Aligned_cols=12  Identities=17%  Similarity=0.340  Sum_probs=6.8

Q ss_pred             ccCCCCccccCC
Q psy4268          44 FPCTLCSYATKR   55 (86)
Q Consensus        44 ~~c~~c~~~f~~   55 (86)
                      +.|..||+.|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            456666665554


No 76 
>KOG4167|consensus
Probab=81.79  E-value=0.29  Score=32.04  Aligned_cols=25  Identities=24%  Similarity=0.430  Sum_probs=21.7

Q ss_pred             ccCCCCccccCChhHHHHHHHHhcc
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKHV   68 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~~   68 (86)
                      |.|..|++.|....++..|+++|-.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHHH
Confidence            7899999999998889999988753


No 77 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=80.82  E-value=0.88  Score=21.87  Aligned_cols=11  Identities=18%  Similarity=0.613  Sum_probs=5.1

Q ss_pred             ceecccccccc
Q psy4268          14 RYLCDSCDRTY   24 (86)
Q Consensus        14 ~~~c~~c~~~~   24 (86)
                      |-.|..||+.|
T Consensus        58 Pa~CkkCGfef   68 (97)
T COG3357          58 PARCKKCGFEF   68 (97)
T ss_pred             ChhhcccCccc
Confidence            34444454444


No 78 
>KOG4167|consensus
Probab=80.49  E-value=0.41  Score=31.41  Aligned_cols=28  Identities=18%  Similarity=0.405  Sum_probs=24.4

Q ss_pred             CceecccccccccChHHHHHHHHHhhCC
Q psy4268          13 KRYLCDSCDRTYSNRSSLKRHMNYECGK   40 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~   40 (86)
                      .-|.|..|++.|.....+..||+.|.-.
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~q  818 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQQ  818 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHHH
Confidence            3499999999999999999999988653


No 79 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=80.26  E-value=0.53  Score=22.43  Aligned_cols=30  Identities=23%  Similarity=0.528  Sum_probs=18.0

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccC
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATK   54 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   54 (86)
                      .|.|..|++.        .+.+.-.|  - +.|..|+..|.
T Consensus        35 ~~~Cp~C~~~--------~VkR~a~G--I-W~C~kCg~~fA   64 (89)
T COG1997          35 KHVCPFCGRT--------TVKRIATG--I-WKCRKCGAKFA   64 (89)
T ss_pred             CCcCCCCCCc--------ceeeeccC--e-EEcCCCCCeec
Confidence            4778888754        11222233  3 78888887775


No 80 
>KOG3408|consensus
Probab=79.97  E-value=1.2  Score=22.66  Aligned_cols=22  Identities=23%  Similarity=0.466  Sum_probs=19.0

Q ss_pred             ccCCCCccccCChhHHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYYR   65 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~   65 (86)
                      |-|..|.+.|.....|..|.+.
T Consensus        58 fyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   58 FYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eehhhhhhhhcchHHHHHHHhc
Confidence            7899999999999999988753


No 81 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=78.60  E-value=1.3  Score=16.07  Aligned_cols=11  Identities=27%  Similarity=0.637  Sum_probs=7.8

Q ss_pred             ccCCCCccccC
Q psy4268          44 FPCTLCSYATK   54 (86)
Q Consensus        44 ~~c~~c~~~f~   54 (86)
                      -.|..||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            35788887774


No 82 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=77.98  E-value=2.6  Score=17.60  Aligned_cols=20  Identities=25%  Similarity=0.564  Sum_probs=10.2

Q ss_pred             cCCCCccccCCh-----hHHHHHHH
Q psy4268          45 PCTLCSYATKRK-----TSLASHYY   64 (86)
Q Consensus        45 ~c~~c~~~f~~~-----~~l~~h~~   64 (86)
                      .|..|++.+...     ++|.+|+.
T Consensus        20 ~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       20 KCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EecCCCCEeeeCCCCCcHHHHHHHH
Confidence            455555544332     45555554


No 83 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=77.53  E-value=3.3  Score=16.65  Aligned_cols=12  Identities=25%  Similarity=0.703  Sum_probs=4.6

Q ss_pred             Cceecccccccc
Q psy4268          13 KRYLCDSCDRTY   24 (86)
Q Consensus        13 ~~~~c~~c~~~~   24 (86)
                      ....|..|++.+
T Consensus        15 ~~a~C~~C~~~~   26 (45)
T PF02892_consen   15 KKAKCKYCGKVI   26 (45)
T ss_dssp             S-EEETTTTEE-
T ss_pred             CeEEeCCCCeEE
Confidence            334455554433


No 84 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=76.41  E-value=2.9  Score=18.51  Aligned_cols=7  Identities=29%  Similarity=1.217  Sum_probs=3.7

Q ss_pred             ccCCCCc
Q psy4268          44 FPCTLCS   50 (86)
Q Consensus        44 ~~c~~c~   50 (86)
                      |.|+.||
T Consensus        51 Y~Cp~CG   57 (61)
T COG2888          51 YRCPKCG   57 (61)
T ss_pred             eECCCcC
Confidence            5555554


No 85 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=74.74  E-value=2.4  Score=21.22  Aligned_cols=29  Identities=10%  Similarity=0.265  Sum_probs=18.9

Q ss_pred             ecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCCh
Q psy4268          16 LCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRK   56 (86)
Q Consensus        16 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   56 (86)
                      .|..|++.|           ....+.| ..|+.||+.|..+
T Consensus        11 idPetg~KF-----------YDLNrdP-iVsPytG~s~P~s   39 (129)
T COG4530          11 IDPETGKKF-----------YDLNRDP-IVSPYTGKSYPRS   39 (129)
T ss_pred             cCccccchh-----------hccCCCc-cccCcccccchHH
Confidence            566677666           2234456 7788899888544


No 86 
>PHA00626 hypothetical protein
Probab=74.63  E-value=1.7  Score=18.99  Aligned_cols=16  Identities=19%  Similarity=0.603  Sum_probs=12.9

Q ss_pred             CCCccCCCCccccCChh
Q psy4268          41 LPAFPCTLCSYATKRKT   57 (86)
Q Consensus        41 ~~~~~c~~c~~~f~~~~   57 (86)
                      .. |.|..||..|+..+
T Consensus        22 nr-YkCkdCGY~ft~~~   37 (59)
T PHA00626         22 DD-YVCCDCGYNDSKDA   37 (59)
T ss_pred             cc-eEcCCCCCeechhh
Confidence            35 99999999887664


No 87 
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=74.39  E-value=1.5  Score=21.37  Aligned_cols=18  Identities=22%  Similarity=0.521  Sum_probs=9.5

Q ss_pred             cCCCCCCceeccccccccc
Q psy4268           7 SAPSGEKRYLCDSCDRTYS   25 (86)
Q Consensus         7 ~~h~~~~~~~c~~c~~~~~   25 (86)
                      ..+.| +++.|..||..|.
T Consensus        73 ~l~~g-~~~rC~eCG~~fk   90 (97)
T cd00924          73 WLEKG-KPKRCPECGHVFK   90 (97)
T ss_pred             EEeCC-CceeCCCCCcEEE
Confidence            33444 4666666665553


No 88 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=74.18  E-value=3.9  Score=14.71  Aligned_cols=18  Identities=22%  Similarity=0.547  Sum_probs=10.9

Q ss_pred             cCCCCccccCChhHHHHHH
Q psy4268          45 PCTLCSYATKRKTSLASHY   63 (86)
Q Consensus        45 ~c~~c~~~f~~~~~l~~h~   63 (86)
                      .|+.|++.+ ....+..|.
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            577777766 334555554


No 89 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=72.98  E-value=0.66  Score=17.25  Aligned_cols=11  Identities=36%  Similarity=0.724  Sum_probs=6.6

Q ss_pred             ccCCCCccccC
Q psy4268          44 FPCTLCSYATK   54 (86)
Q Consensus        44 ~~c~~c~~~f~   54 (86)
                      |.|..|++.|.
T Consensus         1 ~sCiDC~~~F~   11 (28)
T PF08790_consen    1 FSCIDCSKDFD   11 (28)
T ss_dssp             EEETTTTEEEE
T ss_pred             CeeecCCCCcC
Confidence            35666666663


No 90 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=72.93  E-value=1.9  Score=15.38  Aligned_cols=8  Identities=50%  Similarity=1.672  Sum_probs=5.7

Q ss_pred             ccCCCCcc
Q psy4268          44 FPCTLCSY   51 (86)
Q Consensus        44 ~~c~~c~~   51 (86)
                      |.|+.||.
T Consensus        17 f~CPnCG~   24 (24)
T PF07754_consen   17 FPCPNCGF   24 (24)
T ss_pred             EeCCCCCC
Confidence            77777763


No 91 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=72.88  E-value=5.7  Score=16.01  Aligned_cols=25  Identities=20%  Similarity=0.355  Sum_probs=16.7

Q ss_pred             ceecccccc--cccChHHHHHHHHHhh
Q psy4268          14 RYLCDSCDR--TYSNRSSLKRHMNYEC   38 (86)
Q Consensus        14 ~~~c~~c~~--~~~~~~~l~~h~~~~~   38 (86)
                      .-.|..||=  .....+....|.+.|.
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            368999984  4445567777777654


No 92 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=72.35  E-value=1.7  Score=17.61  Aligned_cols=14  Identities=14%  Similarity=0.415  Sum_probs=11.1

Q ss_pred             ccCCCCccccCChh
Q psy4268          44 FPCTLCSYATKRKT   57 (86)
Q Consensus        44 ~~c~~c~~~f~~~~   57 (86)
                      |.|..||..|....
T Consensus         6 y~C~~Cg~~fe~~~   19 (42)
T PF09723_consen    6 YRCEECGHEFEVLQ   19 (42)
T ss_pred             EEeCCCCCEEEEEE
Confidence            78999998887653


No 93 
>KOG2593|consensus
Probab=71.83  E-value=2.5  Score=26.20  Aligned_cols=40  Identities=20%  Similarity=0.538  Sum_probs=26.2

Q ss_pred             CCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccc
Q psy4268           9 PSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYA   52 (86)
Q Consensus         9 h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   52 (86)
                      -+...-|.|..|.+.|.....+..   ...-.-. |.|..|+..
T Consensus       123 ~t~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~-F~C~~C~ge  162 (436)
T KOG2593|consen  123 DTNVAGYVCPNCQKKYTSLEALQL---LDNETGE-FHCENCGGE  162 (436)
T ss_pred             ccccccccCCccccchhhhHHHHh---hcccCce-EEEecCCCc
Confidence            344567999999999987665432   2211223 999998753


No 94 
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=71.82  E-value=5.5  Score=15.38  Aligned_cols=23  Identities=17%  Similarity=0.352  Sum_probs=14.0

Q ss_pred             ccCCCCccccCChhHHHHHHHHhc
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKH   67 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~   67 (86)
                      +.|..|++.+.... +..|...-.
T Consensus         5 ~~C~nC~R~v~a~R-fA~HLekCm   27 (33)
T PF08209_consen    5 VECPNCGRPVAASR-FAPHLEKCM   27 (33)
T ss_dssp             EE-TTTSSEEEGGG-HHHHHHHHT
T ss_pred             EECCCCcCCcchhh-hHHHHHHHH
Confidence            67888888766543 566665443


No 95 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=71.10  E-value=2  Score=16.88  Aligned_cols=13  Identities=15%  Similarity=0.432  Sum_probs=10.4

Q ss_pred             ccCCCCccccCCh
Q psy4268          44 FPCTLCSYATKRK   56 (86)
Q Consensus        44 ~~c~~c~~~f~~~   56 (86)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (41)
T smart00834        6 YRCEDCGHTFEVL   18 (41)
T ss_pred             EEcCCCCCEEEEE
Confidence            7899999887644


No 96 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=69.92  E-value=3.6  Score=17.48  Aligned_cols=30  Identities=20%  Similarity=0.478  Sum_probs=18.4

Q ss_pred             CCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccc
Q psy4268          12 EKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYA   52 (86)
Q Consensus        12 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   52 (86)
                      ...|.|..||+.|..          ...... ..|..||..
T Consensus         4 ~~~Y~C~~Cg~~~~~----------~~~~~~-irCp~Cg~r   33 (49)
T COG1996           4 MMEYKCARCGREVEL----------DQETRG-IRCPYCGSR   33 (49)
T ss_pred             eEEEEhhhcCCeeeh----------hhccCc-eeCCCCCcE
Confidence            346889999987711          111123 688888853


No 97 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=68.95  E-value=2.4  Score=18.43  Aligned_cols=15  Identities=27%  Similarity=0.784  Sum_probs=11.3

Q ss_pred             ceecccccccccChH
Q psy4268          14 RYLCDSCDRTYSNRS   28 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~   28 (86)
                      .|.|++||..|.-..
T Consensus         3 ~~~C~~CG~vYd~e~   17 (55)
T COG1773           3 RWRCSVCGYVYDPEK   17 (55)
T ss_pred             ceEecCCceEecccc
Confidence            588999998775543


No 98 
>KOG4173|consensus
Probab=64.51  E-value=3.4  Score=23.16  Aligned_cols=48  Identities=23%  Similarity=0.425  Sum_probs=34.0

Q ss_pred             eecccccccccChHHHHHHHHH----------hhCCCCCccCC--CCccccCChhHHHHHH
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNY----------ECGKLPAFPCT--LCSYATKRKTSLASHY   63 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~----------~~~~~~~~~c~--~c~~~f~~~~~l~~h~   63 (86)
                      ..|+.|.+.|....-|..|+.-          ..|..- |.|.  .|+-.|.+......|+
T Consensus       107 ~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dM-y~ClvEgCt~KFkT~r~RkdH~  166 (253)
T KOG4173|consen  107 NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDM-YQCLVEGCTEKFKTSRDRKDHM  166 (253)
T ss_pred             chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccH-HHHHHHhhhhhhhhhhhhhhHH
Confidence            3788899999888888777652          223223 6774  3888888887777776


No 99 
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=64.35  E-value=5.7  Score=20.94  Aligned_cols=28  Identities=25%  Similarity=0.708  Sum_probs=17.6

Q ss_pred             CceecccccccccChHHHHHHHHHhhCCCCCccCCCCcc
Q psy4268          13 KRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSY   51 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   51 (86)
                      ..+.|..||.....         .+.+..|  .|+.|+.
T Consensus       111 G~l~C~~Cg~~~~~---------~~~~~l~--~Cp~C~~  138 (146)
T PF07295_consen  111 GTLVCENCGHEVEL---------THPERLP--PCPKCGH  138 (146)
T ss_pred             ceEecccCCCEEEe---------cCCCcCC--CCCCCCC
Confidence            35889999864311         2444444  7888874


No 100
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=64.28  E-value=5.7  Score=16.26  Aligned_cols=17  Identities=18%  Similarity=0.370  Sum_probs=11.5

Q ss_pred             ccCCCCccccCChhHHH
Q psy4268          44 FPCTLCSYATKRKTSLA   60 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~   60 (86)
                      -.|..|++.|.......
T Consensus         9 K~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen    9 KICPVCGRPFTWRKKWA   25 (42)
T ss_pred             CcCcccCCcchHHHHHH
Confidence            35888888887665443


No 101
>KOG0978|consensus
Probab=62.35  E-value=4.7  Score=26.71  Aligned_cols=16  Identities=19%  Similarity=0.258  Sum_probs=11.6

Q ss_pred             ccCCCCccccCChhHH
Q psy4268          44 FPCTLCSYATKRKTSL   59 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l   59 (86)
                      -+|+.|+.+|.....+
T Consensus       679 RKCP~Cn~aFganDv~  694 (698)
T KOG0978|consen  679 RKCPKCNAAFGANDVH  694 (698)
T ss_pred             CCCCCCCCCCCccccc
Confidence            4788888888766543


No 102
>PLN02294 cytochrome c oxidase subunit Vb
Probab=60.86  E-value=4.8  Score=21.82  Aligned_cols=11  Identities=18%  Similarity=0.851  Sum_probs=5.0

Q ss_pred             ceecccccccc
Q psy4268          14 RYLCDSCDRTY   24 (86)
Q Consensus        14 ~~~c~~c~~~~   24 (86)
                      ++.|..||..|
T Consensus       141 p~RCpeCG~~f  151 (174)
T PLN02294        141 SFECPVCTQYF  151 (174)
T ss_pred             ceeCCCCCCEE
Confidence            44444444443


No 103
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=60.83  E-value=3.5  Score=21.33  Aligned_cols=15  Identities=20%  Similarity=0.565  Sum_probs=11.3

Q ss_pred             CceecccccccccCh
Q psy4268          13 KRYLCDSCDRTYSNR   27 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~   27 (86)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            458899999877553


No 104
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=60.05  E-value=5.2  Score=15.93  Aligned_cols=14  Identities=21%  Similarity=0.446  Sum_probs=11.0

Q ss_pred             CCccCCCCccccCCh
Q psy4268          42 PAFPCTLCSYATKRK   56 (86)
Q Consensus        42 ~~~~c~~c~~~f~~~   56 (86)
                      + |.|..|+..|-..
T Consensus        12 ~-f~C~~C~~~FC~~   25 (39)
T smart00154       12 G-FKCRHCGNLFCGE   25 (39)
T ss_pred             C-eECCccCCccccc
Confidence            5 8899998888644


No 105
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=59.76  E-value=4.8  Score=19.66  Aligned_cols=42  Identities=24%  Similarity=0.384  Sum_probs=16.9

Q ss_pred             CCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCCh
Q psy4268           9 PSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRK   56 (86)
Q Consensus         9 h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~   56 (86)
                      .+|.|.-.|.+|+..+....     +. -.|.+..|-|..|.+.|..-
T Consensus         9 ~ag~ke~~CalCG~tWg~~y-----~E-v~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen    9 EAGTKEMGCALCGATWGDYY-----EE-VDGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             ---SGGGS-SS---S---SS------B--TT--BSSS--SSSS-TTS-
T ss_pred             ecccccccccccCCcHHHHH-----Hh-hcCCEEEEEcHHHHHHHHHH
Confidence            35678889999998876432     22 23554437889999888764


No 106
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=58.27  E-value=5.2  Score=17.49  Aligned_cols=37  Identities=14%  Similarity=0.236  Sum_probs=19.1

Q ss_pred             eecccccccccChHHHHHHHHH-hhCCCCCccCCCCccc
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNY-ECGKLPAFPCTLCSYA   52 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~-~~~~~~~~~c~~c~~~   52 (86)
                      ..|.+|++.+.-......-.+. ...... |.|..|.-.
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLrnrPi~t-YmC~eC~~R   40 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLRNRPIHT-YMCDECKER   40 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhhcCCCcc-eeChhHHHH
Confidence            4688888755443222222222 222334 889988643


No 107
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=57.69  E-value=5.5  Score=21.19  Aligned_cols=34  Identities=26%  Similarity=0.657  Sum_probs=20.9

Q ss_pred             CceecccccccccChHHHHHHHHHhhCCCCCccCCCCccc
Q psy4268          13 KRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYA   52 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   52 (86)
                      -+|.|. |+.-|...   .+|...-.|+ . |.|..|+..
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~-YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-V-YRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-e-EEeccCCce
Confidence            468888 88765432   2344444555 4 888888754


No 108
>KOG2785|consensus
Probab=57.30  E-value=23  Score=21.95  Aligned_cols=51  Identities=22%  Similarity=0.336  Sum_probs=36.7

Q ss_pred             CceecccccccccChHHHHHHHHHhhCCC-----------------------CCccCCCCc---cccCChhHHHHHHH
Q psy4268          13 KRYLCDSCDRTYSNRSSLKRHMNYECGKL-----------------------PAFPCTLCS---YATKRKTSLASHYY   64 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~-----------------------~~~~c~~c~---~~f~~~~~l~~h~~   64 (86)
                      .|-.|-.|++.+.....-..||..++|--                       . |.|..|.   +.|.+....+.||.
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~-~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIG-FICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccC-ceEEEeccccCcccccHHHHHHHh
Confidence            34566678888888777777776554421                       3 6787887   88888888888884


No 109
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=56.31  E-value=8.1  Score=19.14  Aligned_cols=16  Identities=19%  Similarity=0.546  Sum_probs=12.7

Q ss_pred             CceecccccccccChH
Q psy4268          13 KRYLCDSCDRTYSNRS   28 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~   28 (86)
                      .|+.|..||..|....
T Consensus         1 MpH~CtrCG~vf~~g~   16 (112)
T COG3364           1 MPHQCTRCGEVFDDGS   16 (112)
T ss_pred             CCceeccccccccccc
Confidence            3689999999997753


No 110
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=56.24  E-value=6.5  Score=19.71  Aligned_cols=12  Identities=25%  Similarity=0.700  Sum_probs=7.6

Q ss_pred             ceeccccccccc
Q psy4268          14 RYLCDSCDRTYS   25 (86)
Q Consensus        14 ~~~c~~c~~~~~   25 (86)
                      ...|..|+..|.
T Consensus        70 ~~~C~~Cg~~~~   81 (115)
T TIGR00100        70 ECECEDCSEEVS   81 (115)
T ss_pred             EEEcccCCCEEe
Confidence            367777776553


No 111
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=56.17  E-value=5  Score=17.05  Aligned_cols=13  Identities=31%  Similarity=0.779  Sum_probs=10.2

Q ss_pred             eecccccccccCh
Q psy4268          15 YLCDSCDRTYSNR   27 (86)
Q Consensus        15 ~~c~~c~~~~~~~   27 (86)
                      |.|..|++.|...
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            7899999877643


No 112
>KOG2071|consensus
Probab=55.54  E-value=10  Score=24.68  Aligned_cols=28  Identities=18%  Similarity=0.477  Sum_probs=21.7

Q ss_pred             CCceecccccccccChHHHHHHHHHhhC
Q psy4268          12 EKRYLCDSCDRTYSNRSSLKRHMNYECG   39 (86)
Q Consensus        12 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~   39 (86)
                      ..+..|..||..|...+....|+..|..
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhh
Confidence            5678999999999988877777765543


No 113
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=55.20  E-value=8  Score=19.34  Aligned_cols=11  Identities=18%  Similarity=0.540  Sum_probs=7.3

Q ss_pred             ceecccccccc
Q psy4268          14 RYLCDSCDRTY   24 (86)
Q Consensus        14 ~~~c~~c~~~~   24 (86)
                      ...|..|+..|
T Consensus        70 ~~~C~~Cg~~~   80 (113)
T PRK12380         70 QAWCWDCSQVV   80 (113)
T ss_pred             EEEcccCCCEE
Confidence            36777777655


No 114
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=54.92  E-value=6.1  Score=16.54  Aligned_cols=36  Identities=19%  Similarity=0.467  Sum_probs=17.2

Q ss_pred             eecccccccccChHHHHHH-----HHHhhCCCCCccCCCCcc
Q psy4268          15 YLCDSCDRTYSNRSSLKRH-----MNYECGKLPAFPCTLCSY   51 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h-----~~~~~~~~~~~~c~~c~~   51 (86)
                      |.|.+|++.|.....-..+     .....-... |.|..|+.
T Consensus         2 y~C~~CgyvYd~~~Gd~~~~i~pGt~F~~Lp~~-w~CP~C~a   42 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPENGIPPGTPFEDLPDD-WVCPVCGA   42 (47)
T ss_dssp             EEETTTSBEEETTTBBGGGTB-TT--GGGS-TT--B-TTTSS
T ss_pred             cCCCCCCEEEcCCcCCcccCcCCCCCHHHCCCC-CcCcCCCC
Confidence            7899999877554321111     011111224 78888874


No 115
>KOG2907|consensus
Probab=53.96  E-value=4.8  Score=20.24  Aligned_cols=40  Identities=18%  Similarity=0.491  Sum_probs=20.7

Q ss_pred             ceecccccccccChHHHHHHHHH-hhCCCCCccCCCCccccCC
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNY-ECGKLPAFPCTLCSYATKR   55 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~-~~~~~~~~~c~~c~~~f~~   55 (86)
                      ...|..||-.-.....++  +|+ ..|..--|.|..|++.|..
T Consensus        74 ~~kCpkCghe~m~Y~T~Q--lRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   74 KHKCPKCGHEEMSYHTLQ--LRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             hccCcccCCchhhhhhhh--cccccCCceEEEEcCccceeeec
Confidence            467777775332222222  222 3343222778888877754


No 116
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=53.90  E-value=7.2  Score=20.21  Aligned_cols=15  Identities=27%  Similarity=0.709  Sum_probs=12.2

Q ss_pred             ceecccccccccChH
Q psy4268          14 RYLCDSCDRTYSNRS   28 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~   28 (86)
                      |+.|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            578999999997654


No 117
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=53.16  E-value=7.6  Score=16.49  Aligned_cols=14  Identities=21%  Similarity=0.622  Sum_probs=8.7

Q ss_pred             CceecccccccccC
Q psy4268          13 KRYLCDSCDRTYSN   26 (86)
Q Consensus        13 ~~~~c~~c~~~~~~   26 (86)
                      +.+.|..||..|..
T Consensus         3 k~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    3 KTLTCKDCGAEFVF   16 (49)
T ss_pred             eeEEcccCCCeEEE
Confidence            55677777765543


No 118
>PF12907 zf-met2:  Zinc-binding
Probab=52.19  E-value=3.7  Score=16.61  Aligned_cols=7  Identities=29%  Similarity=1.222  Sum_probs=3.1

Q ss_pred             ecccccc
Q psy4268          16 LCDSCDR   22 (86)
Q Consensus        16 ~c~~c~~   22 (86)
                      .|.+|..
T Consensus         3 ~C~iC~q    9 (40)
T PF12907_consen    3 ICKICRQ    9 (40)
T ss_pred             CcHHhhH
Confidence            3444443


No 119
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=51.86  E-value=6.5  Score=15.31  Aligned_cols=13  Identities=15%  Similarity=0.322  Sum_probs=6.2

Q ss_pred             cCCCCccccCChh
Q psy4268          45 PCTLCSYATKRKT   57 (86)
Q Consensus        45 ~c~~c~~~f~~~~   57 (86)
                      .|..|++.|..+.
T Consensus         5 ~C~eC~~~f~dSy   17 (34)
T PF01286_consen    5 KCDECGKPFMDSY   17 (34)
T ss_dssp             E-TTT--EES-SS
T ss_pred             hHhHhCCHHHHHH
Confidence            6788888776553


No 120
>KOG0717|consensus
Probab=51.82  E-value=9.9  Score=24.10  Aligned_cols=21  Identities=24%  Similarity=0.513  Sum_probs=17.2

Q ss_pred             ccCCCCccccCChhHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYY   64 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~   64 (86)
                      +-|..|.++|.+...+.+|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            468999999999888888763


No 121
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=51.39  E-value=14  Score=16.32  Aligned_cols=13  Identities=31%  Similarity=0.968  Sum_probs=9.9

Q ss_pred             ccCCCCccccCCh
Q psy4268          44 FPCTLCSYATKRK   56 (86)
Q Consensus        44 ~~c~~c~~~f~~~   56 (86)
                      |.|..||..+...
T Consensus        47 ~~C~~Cg~~~~rD   59 (69)
T PF07282_consen   47 FTCPNCGFEMDRD   59 (69)
T ss_pred             EEcCCCCCEECcH
Confidence            8899998776554


No 122
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=50.53  E-value=32  Score=17.02  Aligned_cols=38  Identities=5%  Similarity=0.132  Sum_probs=27.5

Q ss_pred             CceecccccccccChHHHHHHHHHhhCCCCCccCCCCccc
Q psy4268          13 KRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYA   52 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   52 (86)
                      .-|.|...+..|.....+...+..... +. |.|...|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~~-~v-wtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYNQ-RV-WTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHhC-Ce-eEEecCCCC
Confidence            346777888889888888777765544 34 889887764


No 123
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=50.46  E-value=16  Score=15.96  Aligned_cols=8  Identities=38%  Similarity=1.053  Sum_probs=4.6

Q ss_pred             ccCCCCcc
Q psy4268          44 FPCTLCSY   51 (86)
Q Consensus        44 ~~c~~c~~   51 (86)
                      |.|+.||.
T Consensus        15 ~~Cp~cGi   22 (55)
T PF13824_consen   15 FECPDCGI   22 (55)
T ss_pred             CcCCCCCC
Confidence            56666654


No 124
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.41  E-value=4.6  Score=17.99  Aligned_cols=45  Identities=13%  Similarity=0.267  Sum_probs=25.5

Q ss_pred             cccCCCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccC
Q psy4268           5 YFSAPSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATK   54 (86)
Q Consensus         5 h~~~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   54 (86)
                      +..++.+..++-|.--+-.|.....+.     ..+......|..|+..|.
T Consensus        15 ~~~I~~~~~~l~C~g~~~p~~HPrV~L-----~mg~~gev~CPYC~t~y~   59 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPPNDHPRVFL-----DMGDEGEVVCPYCSTRYR   59 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCCCCCCEEEE-----EcCCCCcEecCccccEEE
Confidence            445667788888887655443322111     113222267999988775


No 125
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=50.34  E-value=21  Score=15.84  Aligned_cols=9  Identities=33%  Similarity=0.837  Sum_probs=4.9

Q ss_pred             ccCCCCccc
Q psy4268          44 FPCTLCSYA   52 (86)
Q Consensus        44 ~~c~~c~~~   52 (86)
                      |.|+.||..
T Consensus        26 F~CPnCG~~   34 (59)
T PRK14890         26 FLCPNCGEV   34 (59)
T ss_pred             eeCCCCCCe
Confidence            555555544


No 126
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.12  E-value=7.7  Score=18.13  Aligned_cols=33  Identities=24%  Similarity=0.604  Sum_probs=19.4

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccC
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATK   54 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   54 (86)
                      .|.|..|+..|    .+.+++.    ..|+-.|..|+..+.
T Consensus        12 ~Y~c~~cg~~~----dvvq~~~----ddplt~ce~c~a~~k   44 (82)
T COG2331          12 SYECTECGNRF----DVVQAMT----DDPLTTCEECGARLK   44 (82)
T ss_pred             EEeecccchHH----HHHHhcc----cCccccChhhChHHH
Confidence            38899998776    3333332    223256888876443


No 127
>KOG2482|consensus
Probab=50.01  E-value=23  Score=21.72  Aligned_cols=23  Identities=26%  Similarity=0.569  Sum_probs=18.8

Q ss_pred             ccCCCCccccCChhHHHHHHHHh
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRK   66 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~   66 (86)
                      +.|..|.+.|.....|..||+..
T Consensus       196 ~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHhc
Confidence            57888999999999999988653


No 128
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=49.99  E-value=17  Score=15.15  Aligned_cols=21  Identities=24%  Similarity=0.656  Sum_probs=12.4

Q ss_pred             ccCCCCccccCChhHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYY   64 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~   64 (86)
                      |+|-.|.......+.|-+|++
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            445556555556666666664


No 129
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=49.79  E-value=16  Score=19.13  Aligned_cols=25  Identities=32%  Similarity=0.626  Sum_probs=18.6

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCC
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLP   42 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~   42 (86)
                      ..|-.+|+.|   .+|.+|..+|.+-.|
T Consensus        77 IicLEDGkkf---KSLKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKF---KSLKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcch---HHHHHHHhcccCCCH
Confidence            6777788887   458889888777543


No 130
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=48.28  E-value=37  Score=19.45  Aligned_cols=39  Identities=23%  Similarity=0.579  Sum_probs=22.0

Q ss_pred             CCCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCcc
Q psy4268           8 APSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSY   51 (86)
Q Consensus         8 ~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   51 (86)
                      .|..-....|..|++.|.....+.   .......|  .|+.|+.
T Consensus       113 lHG~~~~~~C~~C~~~~~~~~~~~---~~~~~~~p--~Cp~Cgg  151 (244)
T PRK14138        113 LHGNVEEYYCVRCGKRYTVEDVIE---KLEKSDVP--RCDDCSG  151 (244)
T ss_pred             ccCCcCeeEECCCCCcccHHHHHH---HHhcCCCC--CCCCCCC
Confidence            354445678888988776543332   11122334  6888874


No 131
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=48.15  E-value=6.7  Score=16.75  Aligned_cols=43  Identities=30%  Similarity=0.684  Sum_probs=21.8

Q ss_pred             Cceeccc-ccccccChHHHHHHHHHhhCCCCCccCCC----CccccCCh
Q psy4268          13 KRYLCDS-CDRTYSNRSSLKRHMNYECGKLPAFPCTL----CSYATKRK   56 (86)
Q Consensus        13 ~~~~c~~-c~~~~~~~~~l~~h~~~~~~~~~~~~c~~----c~~~f~~~   56 (86)
                      .+..|.. |+..-.....|..|....-.... ..|..    |...+...
T Consensus         8 ~~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~-v~C~~~~~GC~~~~~~~   55 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIPRKELDDHLENECPKRP-VPCPYSPYGCKERVPRE   55 (60)
T ss_dssp             SEEE-TT--S-BEEECCCHHHHHHTTSTTSE-EE-SS----S--EEEHH
T ss_pred             CEeeCCCCCcccceeHHHHHHHHHccCCCCc-EECCCCCCCCCCccchh
Confidence            4566766 33333335677888875555555 67777    76655443


No 132
>KOG2231|consensus
Probab=47.63  E-value=20  Score=23.93  Aligned_cols=19  Identities=26%  Similarity=0.747  Sum_probs=7.8

Q ss_pred             cccccccccChHHHHHHHH
Q psy4268          17 CDSCDRTYSNRSSLKRHMN   35 (86)
Q Consensus        17 c~~c~~~~~~~~~l~~h~~   35 (86)
                      |..|...|.....+..|++
T Consensus       185 C~~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  185 CKFCHERFLDDDELYRHLR  203 (669)
T ss_pred             chhhhhhhccHHHHHHhhc
Confidence            3334444444444444433


No 133
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=47.05  E-value=9.4  Score=15.40  Aligned_cols=14  Identities=14%  Similarity=0.710  Sum_probs=8.7

Q ss_pred             CceecccccccccC
Q psy4268          13 KRYLCDSCDRTYSN   26 (86)
Q Consensus        13 ~~~~c~~c~~~~~~   26 (86)
                      -++.|..|+..|..
T Consensus        12 ~~~~C~~C~~~FC~   25 (43)
T PF01428_consen   12 LPFKCKHCGKSFCL   25 (43)
T ss_dssp             SHEE-TTTS-EE-T
T ss_pred             CCeECCCCCcccCc
Confidence            47888888888865


No 134
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=46.99  E-value=17  Score=18.95  Aligned_cols=19  Identities=11%  Similarity=0.200  Sum_probs=14.5

Q ss_pred             ccCCCCccccCChhHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASH   62 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h   62 (86)
                      +.|..|++.|..-+...+-
T Consensus       125 ~~C~~C~kiyW~GsH~~~~  143 (147)
T PF01927_consen  125 WRCPGCGKIYWEGSHWRRM  143 (147)
T ss_pred             EECCCCCCEecccccHHHH
Confidence            5799999999877665543


No 135
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=46.86  E-value=17  Score=22.79  Aligned_cols=30  Identities=20%  Similarity=0.603  Sum_probs=20.3

Q ss_pred             ecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChh
Q psy4268          16 LCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKT   57 (86)
Q Consensus        16 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~   57 (86)
                      .|..||...          .+ .|..- |.|..||..+....
T Consensus       352 ~Cp~Cg~~m----------~S-~G~~g-~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRM----------KS-AGRNG-FRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCch----------hh-cCCCC-cccccccccCCccc
Confidence            788888653          22 24435 99999998776654


No 136
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=46.64  E-value=5.9  Score=24.96  Aligned_cols=17  Identities=24%  Similarity=0.493  Sum_probs=13.3

Q ss_pred             CCCceecccccccccCh
Q psy4268          11 GEKRYLCDSCDRTYSNR   27 (86)
Q Consensus        11 ~~~~~~c~~c~~~~~~~   27 (86)
                      ..+.|.|..|++.|...
T Consensus       422 ~~~~~~c~~c~~~yd~~  438 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPA  438 (479)
T ss_pred             CCCeEEECCCCeEECCC
Confidence            45679999999877654


No 137
>KOG1842|consensus
Probab=46.57  E-value=14  Score=23.36  Aligned_cols=23  Identities=30%  Similarity=0.611  Sum_probs=15.8

Q ss_pred             ceecccccccccChHHHHHHHHH
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNY   36 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~   36 (86)
                      -+.|.+|...|.....|..|...
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~   37 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDV   37 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhh
Confidence            46777777777777777766654


No 138
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=46.31  E-value=8  Score=16.41  Aligned_cols=13  Identities=23%  Similarity=0.475  Sum_probs=6.9

Q ss_pred             ccCCCCccccCCh
Q psy4268          44 FPCTLCSYATKRK   56 (86)
Q Consensus        44 ~~c~~c~~~f~~~   56 (86)
                      -.|+.|++.|...
T Consensus        21 ~~CPlC~r~l~~e   33 (54)
T PF04423_consen   21 GCCPLCGRPLDEE   33 (54)
T ss_dssp             EE-TTT--EE-HH
T ss_pred             CcCCCCCCCCCHH
Confidence            3899999998754


No 139
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=45.82  E-value=12  Score=18.89  Aligned_cols=11  Identities=18%  Similarity=0.842  Sum_probs=7.2

Q ss_pred             ceecccccccc
Q psy4268          14 RYLCDSCDRTY   24 (86)
Q Consensus        14 ~~~c~~c~~~~   24 (86)
                      ...|..|+..|
T Consensus        71 ~~~C~~Cg~~~   81 (117)
T PRK00564         71 ELECKDCSHVF   81 (117)
T ss_pred             EEEhhhCCCcc
Confidence            46777777555


No 140
>PF14353 CpXC:  CpXC protein
Probab=45.68  E-value=10  Score=19.14  Aligned_cols=21  Identities=24%  Similarity=0.406  Sum_probs=13.6

Q ss_pred             hhCCCCCccCCCCccccCChh
Q psy4268          37 ECGKLPAFPCTLCSYATKRKT   57 (86)
Q Consensus        37 ~~~~~~~~~c~~c~~~f~~~~   57 (86)
                      -.|.--.+.|+.||..|.-..
T Consensus        32 l~g~l~~~~CP~Cg~~~~~~~   52 (128)
T PF14353_consen   32 LDGSLFSFTCPSCGHKFRLEY   52 (128)
T ss_pred             HcCCcCEEECCCCCCceecCC
Confidence            345433388999998875443


No 141
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=45.57  E-value=5.9  Score=20.66  Aligned_cols=20  Identities=25%  Similarity=0.547  Sum_probs=10.9

Q ss_pred             ccCCCCCCceecccccccccC
Q psy4268           6 FSAPSGEKRYLCDSCDRTYSN   26 (86)
Q Consensus         6 ~~~h~~~~~~~c~~c~~~~~~   26 (86)
                      +..+.| ++..|..||..|..
T Consensus       105 ~~l~~g-~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  105 FWLHKG-KPQRCPECGQVFKL  124 (136)
T ss_dssp             EEEETT-SEEEETTTEEEEEE
T ss_pred             EEEeCC-CccCCCCCCeEEEE
Confidence            333444 36677667765543


No 142
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=44.99  E-value=23  Score=20.87  Aligned_cols=10  Identities=20%  Similarity=0.840  Sum_probs=4.5

Q ss_pred             eecccccccc
Q psy4268          15 YLCDSCDRTY   24 (86)
Q Consensus        15 ~~c~~c~~~~   24 (86)
                      |.|++|...|
T Consensus       256 yvCs~Clsi~  265 (279)
T TIGR00627       256 FVCSVCLSVL  265 (279)
T ss_pred             EECCCccCCc
Confidence            4444444333


No 143
>KOG0782|consensus
Probab=44.88  E-value=7  Score=25.59  Aligned_cols=12  Identities=17%  Similarity=0.445  Sum_probs=5.7

Q ss_pred             ccCCCCccccCC
Q psy4268          44 FPCTLCSYATKR   55 (86)
Q Consensus        44 ~~c~~c~~~f~~   55 (86)
                      -+|..|++.|.+
T Consensus       254 GkC~~CgKgFQQ  265 (1004)
T KOG0782|consen  254 GKCNTCGKGFQQ  265 (1004)
T ss_pred             cccchhhhhhhh
Confidence            345555554443


No 144
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=44.37  E-value=11  Score=14.33  Aligned_cols=11  Identities=18%  Similarity=0.637  Sum_probs=5.6

Q ss_pred             ccCCCCccccC
Q psy4268          44 FPCTLCSYATK   54 (86)
Q Consensus        44 ~~c~~c~~~f~   54 (86)
                      |.|..|+..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            35666665544


No 145
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=44.31  E-value=24  Score=22.47  Aligned_cols=25  Identities=28%  Similarity=0.406  Sum_probs=19.0

Q ss_pred             ccCCCCccccCChhHHHHHHHHhcc
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKHV   68 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~~   68 (86)
                      +.|..|.+.|.....+..|+..-|.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhh
Confidence            4578888888888888888865443


No 146
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=44.17  E-value=12  Score=21.73  Aligned_cols=12  Identities=25%  Similarity=0.658  Sum_probs=8.6

Q ss_pred             ccCCCCccccCC
Q psy4268          44 FPCTLCSYATKR   55 (86)
Q Consensus        44 ~~c~~c~~~f~~   55 (86)
                      |.|..|+..|.-
T Consensus       156 f~C~~C~h~F~G  167 (278)
T PF15135_consen  156 FHCPKCRHNFRG  167 (278)
T ss_pred             eecccccccchh
Confidence            777778777763


No 147
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=43.96  E-value=14  Score=19.07  Aligned_cols=15  Identities=13%  Similarity=0.414  Sum_probs=11.9

Q ss_pred             CCCCccCCCCccccCC
Q psy4268          40 KLPAFPCTLCSYATKR   55 (86)
Q Consensus        40 ~~~~~~c~~c~~~f~~   55 (86)
                      ... |.|..|++.|..
T Consensus        51 ~qR-yrC~~C~~tf~~   65 (129)
T COG3677          51 HQR-YKCKSCGSTFTV   65 (129)
T ss_pred             ccc-cccCCcCcceee
Confidence            445 899999998864


No 148
>PRK11032 hypothetical protein; Provisional
Probab=43.95  E-value=19  Score=19.42  Aligned_cols=28  Identities=25%  Similarity=0.668  Sum_probs=17.8

Q ss_pred             CceecccccccccChHHHHHHHHHhhCCCCCccCCCCcc
Q psy4268          13 KRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSY   51 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   51 (86)
                      ..+.|..|+....         ..+.+..+  .|+.|+.
T Consensus       123 G~LvC~~Cg~~~~---------~~~p~~i~--pCp~C~~  150 (160)
T PRK11032        123 GNLVCEKCHHHLA---------FYTPEVLP--LCPKCGH  150 (160)
T ss_pred             ceEEecCCCCEEE---------ecCCCcCC--CCCCCCC
Confidence            4588888886431         13455555  7888875


No 149
>KOG2636|consensus
Probab=43.81  E-value=23  Score=22.49  Aligned_cols=28  Identities=29%  Similarity=0.649  Sum_probs=18.4

Q ss_pred             CCCCCCceeccccc-ccccChHHHHHHHH
Q psy4268           8 APSGEKRYLCDSCD-RTYSNRSSLKRHMN   35 (86)
Q Consensus         8 ~h~~~~~~~c~~c~-~~~~~~~~l~~h~~   35 (86)
                      .|.-.+.|.|.+|| +++.-...+.+|-.
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHhH
Confidence            34445667777777 66666666776654


No 150
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=43.73  E-value=9.1  Score=14.40  Aligned_cols=9  Identities=22%  Similarity=0.693  Sum_probs=6.2

Q ss_pred             ccCCCCccc
Q psy4268          44 FPCTLCSYA   52 (86)
Q Consensus        44 ~~c~~c~~~   52 (86)
                      +.|..|+..
T Consensus        20 ~vCp~C~~e   28 (30)
T PF08274_consen   20 LVCPECGHE   28 (30)
T ss_dssp             EEETTTTEE
T ss_pred             EeCCccccc
Confidence            777777643


No 151
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=43.60  E-value=11  Score=22.00  Aligned_cols=31  Identities=29%  Similarity=0.654  Sum_probs=19.7

Q ss_pred             CCceecccccccccChHHHHHHHHHhhCCCCCccCCCCc
Q psy4268          12 EKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCS   50 (86)
Q Consensus        12 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~   50 (86)
                      +..-.|..||..+.....+  |..     -. |+|..|.
T Consensus       218 e~~r~CP~Cg~~W~L~~pl--h~i-----Fd-FKCD~CR  248 (258)
T PF10071_consen  218 EQARKCPSCGGDWRLKEPL--HDI-----FD-FKCDPCR  248 (258)
T ss_pred             hhCCCCCCCCCccccCCch--hhc-----ee-ccCCcce
Confidence            4446788888877666554  222     23 8888884


No 152
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=43.51  E-value=35  Score=20.34  Aligned_cols=22  Identities=27%  Similarity=0.582  Sum_probs=18.8

Q ss_pred             ccCCCCccccCChhHHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYYR   65 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~   65 (86)
                      |.|..|.+-|.....+.+|+..
T Consensus        49 yiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         49 YICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             EEcCCCcchhCCHHHHHHHHHh
Confidence            8899999999999999998753


No 153
>KOG4727|consensus
Probab=43.47  E-value=16  Score=19.97  Aligned_cols=22  Identities=32%  Similarity=0.727  Sum_probs=19.4

Q ss_pred             ceecccccccccChHHHHHHHH
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMN   35 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~   35 (86)
                      -|-|.+|.-.+....++..|+.
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            4899999999999999988875


No 154
>PRK04351 hypothetical protein; Provisional
Probab=42.97  E-value=11  Score=20.01  Aligned_cols=32  Identities=25%  Similarity=0.516  Sum_probs=16.7

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccC
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATK   54 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~   54 (86)
                      .|.|..|+..+..      + +.+. ... |.|..|+..+.
T Consensus       112 ~Y~C~~Cg~~~~r------~-Rr~n-~~~-yrCg~C~g~L~  143 (149)
T PRK04351        112 LYECQSCGQQYLR------K-RRIN-TKR-YRCGKCRGKLK  143 (149)
T ss_pred             EEECCCCCCEeee------e-eecC-CCc-EEeCCCCcEee
Confidence            4777767754422      1 1122 233 77777775543


No 155
>KOG3362|consensus
Probab=41.82  E-value=6.8  Score=20.67  Aligned_cols=7  Identities=29%  Similarity=1.032  Sum_probs=4.3

Q ss_pred             eeccccc
Q psy4268          15 YLCDSCD   21 (86)
Q Consensus        15 ~~c~~c~   21 (86)
                      ..|.+||
T Consensus       119 ~fCaVCG  125 (156)
T KOG3362|consen  119 KFCAVCG  125 (156)
T ss_pred             hhhhhcC
Confidence            3566676


No 156
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=40.41  E-value=17  Score=14.64  Aligned_cols=11  Identities=27%  Similarity=0.839  Sum_probs=5.8

Q ss_pred             ceecccccccc
Q psy4268          14 RYLCDSCDRTY   24 (86)
Q Consensus        14 ~~~c~~c~~~~   24 (86)
                      +..|..|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            45555555443


No 157
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=40.28  E-value=9.4  Score=21.25  Aligned_cols=20  Identities=20%  Similarity=0.790  Sum_probs=0.0

Q ss_pred             ccCCCCc-cccCChhHHHHHH
Q psy4268          44 FPCTLCS-YATKRKTSLASHY   63 (86)
Q Consensus        44 ~~c~~c~-~~f~~~~~l~~h~   63 (86)
                      |.|.+|| ..+.-...+.+|.
T Consensus       102 y~CEICGN~~Y~GrkaFekHF  122 (196)
T PF11931_consen  102 YKCEICGNQSYKGRKAFEKHF  122 (196)
T ss_dssp             ---------------------
T ss_pred             eeeEeCCCcceecHHHHHHhc
Confidence            6777775 2333333444443


No 158
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=39.99  E-value=7.5  Score=17.93  Aligned_cols=41  Identities=20%  Similarity=0.255  Sum_probs=21.2

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCCCccCC--CCccccCChhH
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCT--LCSYATKRKTS   58 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~--~c~~~f~~~~~   58 (86)
                      ..|..|+..-....+-....  ..-+.- +.|.  .||..|.....
T Consensus         2 m~CP~Cg~~a~irtSr~~s~--~~~~~Y-~qC~N~eCg~tF~t~es   44 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITD--TTKERY-HQCQNVNCSATFITYES   44 (72)
T ss_pred             ccCCCCCCccEEEEChhcCh--hhheee-eecCCCCCCCEEEEEEE
Confidence            35777775432222211111  122233 6787  79999887654


No 159
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=39.88  E-value=15  Score=14.53  Aligned_cols=11  Identities=27%  Similarity=0.878  Sum_probs=5.7

Q ss_pred             Cceeccccccc
Q psy4268          13 KRYLCDSCDRT   23 (86)
Q Consensus        13 ~~~~c~~c~~~   23 (86)
                      +-|+|..||..
T Consensus         5 ~~YkC~~CGni   15 (36)
T PF06397_consen    5 EFYKCEHCGNI   15 (36)
T ss_dssp             EEEE-TTT--E
T ss_pred             cEEEccCCCCE
Confidence            45888888854


No 160
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=39.70  E-value=13  Score=15.75  Aligned_cols=15  Identities=13%  Similarity=0.434  Sum_probs=9.7

Q ss_pred             cCCCCccccCChhHH
Q psy4268          45 PCTLCSYATKRKTSL   59 (86)
Q Consensus        45 ~c~~c~~~f~~~~~l   59 (86)
                      .|+.|++.|......
T Consensus        14 ICpvCqRPFsWRkKW   28 (54)
T COG4338          14 ICPVCQRPFSWRKKW   28 (54)
T ss_pred             hhhhhcCchHHHHHH
Confidence            577777777655433


No 161
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=39.04  E-value=53  Score=18.51  Aligned_cols=38  Identities=16%  Similarity=0.337  Sum_probs=20.5

Q ss_pred             CCCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCcc
Q psy4268           8 APSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSY   51 (86)
Q Consensus         8 ~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   51 (86)
                      .|..-....|..|+..+.....    ........|  .|..|+.
T Consensus       107 lHG~l~~~~C~~C~~~~~~~~~----~~~~~~~~p--~C~~Cgg  144 (222)
T cd01413         107 LHGTLQTAYCVNCGSKYDLEEV----KYAKKHEVP--RCPKCGG  144 (222)
T ss_pred             ccCCcCcceECCCCCCcchhHH----HHhccCCCC--cCCCCCC
Confidence            3444455778888876654332    111122333  6887864


No 162
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=38.80  E-value=33  Score=14.35  Aligned_cols=13  Identities=23%  Similarity=0.370  Sum_probs=7.1

Q ss_pred             ccCCCCccccCCh
Q psy4268          44 FPCTLCSYATKRK   56 (86)
Q Consensus        44 ~~c~~c~~~f~~~   56 (86)
                      +.|..||+.|-..
T Consensus        19 ~~Cr~Cg~~~C~~   31 (57)
T cd00065          19 HHCRNCGRIFCSK   31 (57)
T ss_pred             cccCcCcCCcChH
Confidence            4556666655543


No 163
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=38.55  E-value=17  Score=14.50  Aligned_cols=11  Identities=27%  Similarity=0.712  Sum_probs=7.4

Q ss_pred             ccCCCCccccC
Q psy4268          44 FPCTLCSYATK   54 (86)
Q Consensus        44 ~~c~~c~~~f~   54 (86)
                      |.|..|+..+.
T Consensus        29 y~C~~C~~~w~   39 (40)
T smart00440       29 YVCTKCGHRWR   39 (40)
T ss_pred             EEeCCCCCEeC
Confidence            67777776553


No 164
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=37.55  E-value=42  Score=18.82  Aligned_cols=36  Identities=22%  Similarity=0.408  Sum_probs=20.2

Q ss_pred             CceecccccccccChHHHHHHHHHhh-CCCCCccCCCCccccC
Q psy4268          13 KRYLCDSCDRTYSNRSSLKRHMNYEC-GKLPAFPCTLCSYATK   54 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~~h~~~~~-~~~~~~~c~~c~~~f~   54 (86)
                      .-+.|..|+  +  ...  .|..... +..++..|..||.-+.
T Consensus         5 iy~~Cp~Cg--~--eev--~hEVik~~g~~~lvrC~eCG~V~~   41 (201)
T COG1326           5 IYIECPSCG--S--EEV--SHEVIKERGREPLVRCEECGTVHP   41 (201)
T ss_pred             EEEECCCCC--c--chh--hHHHHHhcCCceEEEccCCCcEee
Confidence            357899887  1  111  2222222 3334478999997663


No 165
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=37.27  E-value=39  Score=17.77  Aligned_cols=19  Identities=32%  Similarity=0.593  Sum_probs=12.3

Q ss_pred             CCceecccccccccChHHH
Q psy4268          12 EKRYLCDSCDRTYSNRSSL   30 (86)
Q Consensus        12 ~~~~~c~~c~~~~~~~~~l   30 (86)
                      .+-|.|.+|.........|
T Consensus        78 ~~lYeCnIC~etS~ee~FL   96 (140)
T PF05290_consen   78 PKLYECNICKETSAEERFL   96 (140)
T ss_pred             CCceeccCcccccchhhcC
Confidence            4678888887765544443


No 166
>PLN02748 tRNA dimethylallyltransferase
Probab=36.98  E-value=32  Score=21.96  Aligned_cols=24  Identities=17%  Similarity=0.574  Sum_probs=16.3

Q ss_pred             Cceecccccc-cccChHHHHHHHHH
Q psy4268          13 KRYLCDSCDR-TYSNRSSLKRHMNY   36 (86)
Q Consensus        13 ~~~~c~~c~~-~~~~~~~l~~h~~~   36 (86)
                      +.|.|.+|+. .+.....+..|.+.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            5567777876 56666667777654


No 167
>KOG0227|consensus
Probab=36.86  E-value=24  Score=19.72  Aligned_cols=27  Identities=26%  Similarity=0.453  Sum_probs=16.8

Q ss_pred             ccCCCCCCceecccccccccChHHHHHHH
Q psy4268           6 FSAPSGEKRYLCDSCDRTYSNRSSLKRHM   34 (86)
Q Consensus         6 ~~~h~~~~~~~c~~c~~~~~~~~~l~~h~   34 (86)
                      |+.|.|  .|.|..|.-......++..|.
T Consensus        47 mkNh~G--~yeCkLClT~H~ne~Syl~Ht   73 (222)
T KOG0227|consen   47 MKNHLG--KYECKLCLTLHNNEGSYLAHT   73 (222)
T ss_pred             hhccCc--ceeehhhhhhhcchhhhhhhh
Confidence            445555  578888876665655555554


No 168
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=36.65  E-value=13  Score=19.28  Aligned_cols=32  Identities=22%  Similarity=0.521  Sum_probs=16.2

Q ss_pred             ceecccccccccChHHHHHHHHHhhCCCCCccCCCCcccc
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYAT   53 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   53 (86)
                      .|.|..|+..+.      .+.+.. .... +.|..|+..+
T Consensus       112 ~y~C~~C~~~~~------~~rr~~-~~~~-y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYL------RVRRSN-NVSR-YRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCc------eEcccc-Ccce-EEcCCCCCEE
Confidence            577776765542      122211 1123 6777776554


No 169
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=36.06  E-value=11  Score=19.57  Aligned_cols=10  Identities=20%  Similarity=0.644  Sum_probs=6.1

Q ss_pred             ccCCCCcccc
Q psy4268          44 FPCTLCSYAT   53 (86)
Q Consensus        44 ~~c~~c~~~f   53 (86)
                      +.|..|+..+
T Consensus       144 ~~C~~C~~~l  153 (157)
T PF10263_consen  144 YRCGRCGGPL  153 (157)
T ss_pred             EECCCCCCEE
Confidence            5677776544


No 170
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=35.82  E-value=27  Score=17.53  Aligned_cols=11  Identities=18%  Similarity=0.782  Sum_probs=6.7

Q ss_pred             ceecccccccc
Q psy4268          14 RYLCDSCDRTY   24 (86)
Q Consensus        14 ~~~c~~c~~~~   24 (86)
                      ...|..|+..|
T Consensus        70 ~~~C~~Cg~~~   80 (114)
T PRK03681         70 ECWCETCQQYV   80 (114)
T ss_pred             EEEcccCCCee
Confidence            36677777544


No 171
>PTZ00448 hypothetical protein; Provisional
Probab=35.47  E-value=35  Score=21.13  Aligned_cols=22  Identities=18%  Similarity=0.504  Sum_probs=16.8

Q ss_pred             ccCCCCccccCChhHHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYYR   65 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~   65 (86)
                      |.|..|+-.|........|.++
T Consensus       315 ~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        315 LLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             ccccccccccCCHHHHHHHhhh
Confidence            7899999999776666666643


No 172
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=35.44  E-value=12  Score=14.77  Aligned_cols=10  Identities=20%  Similarity=0.564  Sum_probs=5.3

Q ss_pred             ccCCCCcccc
Q psy4268          44 FPCTLCSYAT   53 (86)
Q Consensus        44 ~~c~~c~~~f   53 (86)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            4555565543


No 173
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=35.17  E-value=48  Score=18.25  Aligned_cols=33  Identities=30%  Similarity=0.717  Sum_probs=19.8

Q ss_pred             CCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCcccc
Q psy4268          11 GEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYAT   53 (86)
Q Consensus        11 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   53 (86)
                      ...-|.|..|...++.-..      ...+    |.|+.||...
T Consensus       110 ~~~~y~C~~~~~r~sfdeA------~~~~----F~Cp~Cg~~L  142 (176)
T COG1675         110 ENNYYVCPNCHVKYSFDEA------MELG----FTCPKCGEDL  142 (176)
T ss_pred             cCCceeCCCCCCcccHHHH------HHhC----CCCCCCCchh
Confidence            4456888777665544322      2222    8899998643


No 174
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=34.38  E-value=86  Score=17.54  Aligned_cols=40  Identities=18%  Similarity=0.449  Sum_probs=20.4

Q ss_pred             CCCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccc
Q psy4268           8 APSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYA   52 (86)
Q Consensus         8 ~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   52 (86)
                      .|..-....|..|++.+..... .  ........|  .|..|+..
T Consensus       103 lHG~~~~~~C~~C~~~~~~~~~-~--~~~~~~~~p--~C~~Cg~~  142 (218)
T cd01407         103 LHGSLFRVRCTKCGKEYPRDEL-Q--ADIDREEVP--RCPKCGGL  142 (218)
T ss_pred             CcCCcCcceeCCCcCCCcHHHH-h--HhhccCCCC--cCCCCCCc
Confidence            3444455778888876643321 1  111122233  68888653


No 175
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=33.92  E-value=27  Score=20.37  Aligned_cols=14  Identities=29%  Similarity=0.911  Sum_probs=10.8

Q ss_pred             ccCCCCccccCChh
Q psy4268          44 FPCTLCSYATKRKT   57 (86)
Q Consensus        44 ~~c~~c~~~f~~~~   57 (86)
                      +.|..||..+....
T Consensus       323 ~~C~~cg~~~~rD~  336 (364)
T COG0675         323 FKCPRCGFVHDRDV  336 (364)
T ss_pred             EECCCCCCeehhhH
Confidence            89999998766543


No 177
>KOG2857|consensus
Probab=33.61  E-value=22  Score=18.84  Aligned_cols=23  Identities=26%  Similarity=0.619  Sum_probs=19.7

Q ss_pred             CceecccccccccChHHHHHHHH
Q psy4268          13 KRYLCDSCDRTYSNRSSLKRHMN   35 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~~h~~   35 (86)
                      ..|+|..|...|.+...+..|..
T Consensus        16 ~KYKCpkC~vPYCSl~CfKiHk~   38 (157)
T KOG2857|consen   16 IKYKCPKCSVPYCSLPCFKIHKS   38 (157)
T ss_pred             hhccCCCCCCccccchhhhhccC
Confidence            36999999999999999988865


No 178
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=33.50  E-value=46  Score=19.69  Aligned_cols=13  Identities=31%  Similarity=0.887  Sum_probs=8.1

Q ss_pred             CCCCceecccccc
Q psy4268          10 SGEKRYLCDSCDR   22 (86)
Q Consensus        10 ~~~~~~~c~~c~~   22 (86)
                      .|.+-|.|..|..
T Consensus       138 hGGrif~CsfC~~  150 (314)
T PF06524_consen  138 HGGRIFKCSFCDN  150 (314)
T ss_pred             CCCeEEEeecCCC
Confidence            4556677777654


No 179
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=32.68  E-value=35  Score=21.10  Aligned_cols=28  Identities=21%  Similarity=0.551  Sum_probs=19.8

Q ss_pred             CCCCCCceeccccc-ccccChHHHHHHHH
Q psy4268           8 APSGEKRYLCDSCD-RTYSNRSSLKRHMN   35 (86)
Q Consensus         8 ~h~~~~~~~c~~c~-~~~~~~~~l~~h~~   35 (86)
                      .|.-.+.|.|.+|| +.+.-...+.+|-.
T Consensus       368 lhgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         368 LHGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             hcCCCcceeeeecccccccchHHHHhhhh
Confidence            35556778999998 66666666666653


No 180
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=32.41  E-value=23  Score=15.33  Aligned_cols=12  Identities=25%  Similarity=0.617  Sum_probs=8.3

Q ss_pred             ccCCCCccccCC
Q psy4268          44 FPCTLCSYATKR   55 (86)
Q Consensus        44 ~~c~~c~~~f~~   55 (86)
                      |.|+.||..+.-
T Consensus         3 ~~CP~CG~~iev   14 (54)
T TIGR01206         3 FECPDCGAEIEL   14 (54)
T ss_pred             cCCCCCCCEEec
Confidence            678888876543


No 181
>PRK10220 hypothetical protein; Provisional
Probab=32.14  E-value=31  Score=17.37  Aligned_cols=13  Identities=15%  Similarity=0.470  Sum_probs=8.8

Q ss_pred             ccCCCCccccCCh
Q psy4268          44 FPCTLCSYATKRK   56 (86)
Q Consensus        44 ~~c~~c~~~f~~~   56 (86)
                      |.|+.|+..+...
T Consensus        21 ~vCpeC~hEW~~~   33 (111)
T PRK10220         21 YICPECAHEWNDA   33 (111)
T ss_pred             EECCcccCcCCcc
Confidence            7788887666543


No 182
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=32.05  E-value=23  Score=18.86  Aligned_cols=13  Identities=15%  Similarity=0.158  Sum_probs=10.6

Q ss_pred             ccCCCCccccCCh
Q psy4268          44 FPCTLCSYATKRK   56 (86)
Q Consensus        44 ~~c~~c~~~f~~~   56 (86)
                      -.|..|++.|++-
T Consensus        29 ReC~~C~~RFTTy   41 (147)
T TIGR00244        29 RECLECHERFTTF   41 (147)
T ss_pred             ccCCccCCcccee
Confidence            4699999999864


No 183
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=31.91  E-value=41  Score=13.17  Aligned_cols=11  Identities=55%  Similarity=1.361  Sum_probs=5.6

Q ss_pred             CCCCceecccc
Q psy4268          10 SGEKRYLCDSC   20 (86)
Q Consensus        10 ~~~~~~~c~~c   20 (86)
                      .|...|.|..|
T Consensus        25 ~G~qryrC~~C   35 (36)
T PF03811_consen   25 SGHQRYRCKDC   35 (36)
T ss_pred             CCCEeEecCcC
Confidence            34455555544


No 184
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=31.87  E-value=27  Score=17.53  Aligned_cols=13  Identities=23%  Similarity=0.631  Sum_probs=8.3

Q ss_pred             ccCCCCccccCCh
Q psy4268          44 FPCTLCSYATKRK   56 (86)
Q Consensus        44 ~~c~~c~~~f~~~   56 (86)
                      |.|+.|+..+...
T Consensus        20 ~iCpeC~~EW~~~   32 (109)
T TIGR00686        20 LICPSCLYEWNEN   32 (109)
T ss_pred             eECcccccccccc
Confidence            6777777665543


No 185
>PHA02998 RNA polymerase subunit; Provisional
Probab=31.74  E-value=4.6  Score=22.08  Aligned_cols=13  Identities=23%  Similarity=0.404  Sum_probs=9.1

Q ss_pred             ccCCCCccccCCh
Q psy4268          44 FPCTLCSYATKRK   56 (86)
Q Consensus        44 ~~c~~c~~~f~~~   56 (86)
                      |.|..||..|.-.
T Consensus       172 YkC~~CG~~wkpp  184 (195)
T PHA02998        172 HACRDCKKHFKPP  184 (195)
T ss_pred             EEcCCCCCccCCc
Confidence            6788888776543


No 186
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=30.93  E-value=53  Score=13.86  Aligned_cols=12  Identities=25%  Similarity=0.592  Sum_probs=5.9

Q ss_pred             ccCCCCccccCC
Q psy4268          44 FPCTLCSYATKR   55 (86)
Q Consensus        44 ~~c~~c~~~f~~   55 (86)
                      ++|..|+..|..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            445555544443


No 187
>PTZ00064 histone acetyltransferase; Provisional
Probab=30.91  E-value=50  Score=21.52  Aligned_cols=22  Identities=23%  Similarity=0.256  Sum_probs=18.9

Q ss_pred             ccCCCCccccCChhHHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYYR   65 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~   65 (86)
                      |.|..|.+-|.....+.+|+..
T Consensus       281 YICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        281 HFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             EEccchhhhhCCHHHHHHHHhc
Confidence            7899999999999999998743


No 188
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=30.82  E-value=43  Score=19.49  Aligned_cols=38  Identities=29%  Similarity=0.619  Sum_probs=20.9

Q ss_pred             CCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCcc
Q psy4268           9 PSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSY   51 (86)
Q Consensus         9 h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   51 (86)
                      |..=....|..|+..+....... .  ...+..|  .|..|+.
T Consensus       117 HGsl~~~~C~~C~~~~~~~~~~~-~--~~~~~~p--~C~~Cg~  154 (250)
T COG0846         117 HGSLKRVRCSKCGNQYYDEDVIK-F--IEDGLIP--RCPKCGG  154 (250)
T ss_pred             ccceeeeEeCCCcCccchhhhhh-h--cccCCCC--cCccCCC
Confidence            44445678888887665433111 1  1122334  6888887


No 189
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=29.93  E-value=44  Score=16.92  Aligned_cols=49  Identities=10%  Similarity=0.192  Sum_probs=31.0

Q ss_pred             ecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHHhc
Q psy4268          16 LCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYRKH   67 (86)
Q Consensus        16 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~   67 (86)
                      .|-.|...|........-.  -..... |.|..|...|-.....-.|...|.
T Consensus        57 ~C~~C~~~f~~~~~~~~~~--~~~~~~-y~C~~C~~~FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        57 FCFGCQGPFPKPPVSPFDE--LKDSHR-YVCAVCKNVFCVDCDVFVHESLHC  105 (112)
T ss_pred             cccCcCCCCCCcccccccc--cccccc-eeCCCCCCccccccchhhhhhccC
Confidence            4777888886543211111  122334 999999999988877777765554


No 190
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=29.78  E-value=46  Score=21.25  Aligned_cols=21  Identities=33%  Similarity=0.597  Sum_probs=18.8

Q ss_pred             ccCCCCccccCChhHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYY   64 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~   64 (86)
                      |.|..|.+-|.....+..|+.
T Consensus       199 yiCe~Cl~y~~~~~~~~~H~~  219 (450)
T PLN00104        199 YFCEFCLKFMKRKEQLQRHMK  219 (450)
T ss_pred             EEchhhhhhhcCHHHHHHHHh
Confidence            889999999999999999974


No 191
>KOG1280|consensus
Probab=29.77  E-value=65  Score=19.93  Aligned_cols=39  Identities=15%  Similarity=0.347  Sum_probs=23.8

Q ss_pred             CCceecccccccccChHHHHHHHHH-hhCCCCCccCCCCc
Q psy4268          12 EKRYLCDSCDRTYSNRSSLKRHMNY-ECGKLPAFPCTLCS   50 (86)
Q Consensus        12 ~~~~~c~~c~~~~~~~~~l~~h~~~-~~~~~~~~~c~~c~   50 (86)
                      ...|.|..|+..-.....|..|... |........|..|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3468888888866667777777654 33222224566664


No 192
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=29.41  E-value=8  Score=16.55  Aligned_cols=23  Identities=22%  Similarity=0.527  Sum_probs=11.2

Q ss_pred             CCceecccccccccChHHHHHHH
Q psy4268          12 EKRYLCDSCDRTYSNRSSLKRHM   34 (86)
Q Consensus        12 ~~~~~c~~c~~~~~~~~~l~~h~   34 (86)
                      ...|.|..|...|...=++-.|.
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE   41 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHE   41 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTT
T ss_pred             CCeEECCCCCCccccCcChhhhc
Confidence            35699999988887665544443


No 193
>PRK05978 hypothetical protein; Provisional
Probab=28.41  E-value=24  Score=18.78  Aligned_cols=10  Identities=20%  Similarity=0.554  Sum_probs=6.0

Q ss_pred             cCCCCccccC
Q psy4268          45 PCTLCSYATK   54 (86)
Q Consensus        45 ~c~~c~~~f~   54 (86)
                      .|..||..|.
T Consensus        54 ~C~~CG~~~~   63 (148)
T PRK05978         54 HCAACGEDFT   63 (148)
T ss_pred             CccccCCccc
Confidence            5666665554


No 194
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=28.38  E-value=83  Score=17.96  Aligned_cols=35  Identities=26%  Similarity=0.449  Sum_probs=19.8

Q ss_pred             CCCCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCcc
Q psy4268           8 APSGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSY   51 (86)
Q Consensus         8 ~h~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~   51 (86)
                      .|..-....|..|++.+.....+       ....+  .|..|+.
T Consensus       116 lHG~~~~~~C~~C~~~~~~~~~~-------~~~~p--~C~~Cgg  150 (242)
T PRK00481        116 LHGSLLRARCTKCGQTYDLDEYL-------KPEPP--RCPKCGG  150 (242)
T ss_pred             ccCCcCceeeCCCCCCcChhhhc-------cCCCC--CCCCCCC
Confidence            45555567888888766543321       12233  5888864


No 195
>KOG1984|consensus
Probab=27.78  E-value=19  Score=24.94  Aligned_cols=54  Identities=19%  Similarity=0.356  Sum_probs=29.7

Q ss_pred             CCCCceecccccccccChHHHHHHHHHhhCCCCCccCCCCccccCChhHHHHHHHHhccCCC
Q psy4268          10 SGEKRYLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYATKRKTSLASHYYRKHVGED   71 (86)
Q Consensus        10 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f~~~~~l~~h~~~~~~~~~   71 (86)
                      ....|..|..|. +|....     ++.--+.+. |.|..|+..-.-....-.|+ .+.|++.
T Consensus       334 g~sgPvRC~RCk-aYinPF-----mqF~~~gr~-f~Cn~C~~~n~vp~~yf~~L-~~~grr~  387 (1007)
T KOG1984|consen  334 GESGPVRCNRCK-AYINPF-----MQFIDGGRK-FICNFCGSKNQVPDDYFNHL-GPTGRRV  387 (1007)
T ss_pred             CCCCCcchhhhh-hhcCcc-----eEEecCCce-EEecCCCccccCChhhcccC-CCccccc
Confidence            334578888884 332221     223234445 89999987665555555554 4444443


No 196
>KOG3014|consensus
Probab=27.61  E-value=74  Score=18.68  Aligned_cols=25  Identities=16%  Similarity=0.335  Sum_probs=18.5

Q ss_pred             ceecccccc--cccChHHHHHHHHHhh
Q psy4268          14 RYLCDSCDR--TYSNRSSLKRHMNYEC   38 (86)
Q Consensus        14 ~~~c~~c~~--~~~~~~~l~~h~~~~~   38 (86)
                      .-.|..|+-  +-...+.-..|.+.|.
T Consensus        37 ~~~C~~Cgm~Yt~~s~EDe~~H~~fH~   63 (257)
T KOG3014|consen   37 AVKCKECGMKYTVTSPEDEALHEKFHN   63 (257)
T ss_pred             ceehhhcCceecCCCHHHHHHHHHHHH
Confidence            348888984  5555677888988887


No 197
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=27.54  E-value=30  Score=13.64  Aligned_cols=11  Identities=27%  Similarity=0.920  Sum_probs=7.6

Q ss_pred             eeccccccccc
Q psy4268          15 YLCDSCDRTYS   25 (86)
Q Consensus        15 ~~c~~c~~~~~   25 (86)
                      +.|..||..+.
T Consensus        33 ~~C~~CGE~~~   43 (46)
T TIGR03831        33 LVCPQCGEEYL   43 (46)
T ss_pred             cccccCCCEee
Confidence            56888887653


No 198
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=27.24  E-value=26  Score=21.21  Aligned_cols=24  Identities=17%  Similarity=0.325  Sum_probs=19.2

Q ss_pred             ccCCCCccccCChhHHHHHHHHhc
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKH   67 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~   67 (86)
                      |.|..|...|......-.|...|-
T Consensus       389 Y~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         389 YQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             eechhhhhhhhhhhHHHHHHHHhh
Confidence            899999999998888777765553


No 199
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=26.71  E-value=28  Score=17.77  Aligned_cols=12  Identities=17%  Similarity=0.310  Sum_probs=8.0

Q ss_pred             ceecccccccccC
Q psy4268          14 RYLCDSCDRTYSN   26 (86)
Q Consensus        14 ~~~c~~c~~~~~~   26 (86)
                      ...| .|+..|..
T Consensus        70 ~~~C-~Cg~~~~~   81 (124)
T PRK00762         70 EIEC-ECGYEGVV   81 (124)
T ss_pred             eEEe-eCcCcccc
Confidence            4678 78866644


No 200
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=26.68  E-value=33  Score=12.92  Aligned_cols=10  Identities=20%  Similarity=0.946  Sum_probs=6.8

Q ss_pred             ccCCCCcccc
Q psy4268          44 FPCTLCSYAT   53 (86)
Q Consensus        44 ~~c~~c~~~f   53 (86)
                      |+|..||-..
T Consensus         5 ykC~~CGniv   14 (34)
T cd00974           5 YKCEICGNIV   14 (34)
T ss_pred             EEcCCCCcEE
Confidence            7788777543


No 201
>COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification]
Probab=26.49  E-value=66  Score=17.95  Aligned_cols=28  Identities=21%  Similarity=0.444  Sum_probs=18.5

Q ss_pred             ccCCCCCCceecccccccccChHHHHHHHH
Q psy4268           6 FSAPSGEKRYLCDSCDRTYSNRSSLKRHMN   35 (86)
Q Consensus         6 ~~~h~~~~~~~c~~c~~~~~~~~~l~~h~~   35 (86)
                      ++.|+|  .|.|..|.-......++..|..
T Consensus        47 ~knh~G--k~vC~LC~T~H~~e~Sy~~H~~   74 (222)
T COG5246          47 SKNHTG--KYVCLLCKTKHLTEMSYVKHRE   74 (222)
T ss_pred             hhcCCC--cEEeeeeccccccHHHHHHhhc
Confidence            345555  5888888877666666666643


No 202
>PF14369 zf-RING_3:  zinc-finger
Probab=26.42  E-value=36  Score=13.16  Aligned_cols=10  Identities=20%  Similarity=0.454  Sum_probs=7.6

Q ss_pred             cCCCCccccC
Q psy4268          45 PCTLCSYATK   54 (86)
Q Consensus        45 ~c~~c~~~f~   54 (86)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4888887775


No 203
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]
Probab=26.16  E-value=40  Score=20.84  Aligned_cols=25  Identities=24%  Similarity=0.421  Sum_probs=20.7

Q ss_pred             ccCCCCccccCChhHHHHHHHHhcc
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKHV   68 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~~   68 (86)
                      |.|.-|.+-+.....+.+|+..-..
T Consensus       159 yICefClkY~~s~~~~~rH~~kC~~  183 (395)
T COG5027         159 YICEFCLKYYGSQTSLVRHRKKCSL  183 (395)
T ss_pred             EEhhhhHHHhcchhHHHHHHhcCcC
Confidence            8899999999999999999755443


No 204
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=26.15  E-value=32  Score=18.47  Aligned_cols=13  Identities=15%  Similarity=0.174  Sum_probs=10.6

Q ss_pred             ccCCCCccccCCh
Q psy4268          44 FPCTLCSYATKRK   56 (86)
Q Consensus        44 ~~c~~c~~~f~~~   56 (86)
                      -.|..|+..|++-
T Consensus        29 ReC~~C~~RFTTf   41 (156)
T COG1327          29 RECLECGERFTTF   41 (156)
T ss_pred             hcccccccccchh
Confidence            4799999998864


No 205
>PRK12722 transcriptional activator FlhC; Provisional
Probab=25.90  E-value=51  Score=18.34  Aligned_cols=7  Identities=57%  Similarity=1.488  Sum_probs=3.7

Q ss_pred             ccCCCCc
Q psy4268          44 FPCTLCS   50 (86)
Q Consensus        44 ~~c~~c~   50 (86)
                      |.|..|.
T Consensus       155 f~CplC~  161 (187)
T PRK12722        155 FVCGLCQ  161 (187)
T ss_pred             CcCCCCC
Confidence            5555553


No 206
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=25.83  E-value=40  Score=19.47  Aligned_cols=16  Identities=25%  Similarity=0.561  Sum_probs=12.4

Q ss_pred             CCceecccccccccCh
Q psy4268          12 EKRYLCDSCDRTYSNR   27 (86)
Q Consensus        12 ~~~~~c~~c~~~~~~~   27 (86)
                      .++..|..||..|...
T Consensus       179 GkpqRCpECGqVFKLV  194 (268)
T PTZ00043        179 GFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCccCCCCCcEEEEE
Confidence            4588999999887653


No 207
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=25.76  E-value=60  Score=17.73  Aligned_cols=18  Identities=17%  Similarity=0.357  Sum_probs=14.1

Q ss_pred             ccCCCCccccCChhHHHH
Q psy4268          44 FPCTLCSYATKRKTSLAS   61 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~   61 (86)
                      +.|..||+.|.....+..
T Consensus       115 ~~C~~Cg~~f~~~k~i~~  132 (181)
T PRK08222        115 QRCSRCERPFAPQKTVAL  132 (181)
T ss_pred             CcCcccCCccCcHhHHHH
Confidence            789999999987655543


No 208
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=25.12  E-value=47  Score=12.11  Aligned_cols=8  Identities=25%  Similarity=0.725  Sum_probs=3.8

Q ss_pred             cCCCCccc
Q psy4268          45 PCTLCSYA   52 (86)
Q Consensus        45 ~c~~c~~~   52 (86)
                      .|..|++.
T Consensus         2 ~C~~C~~~    9 (30)
T PF03107_consen    2 WCDVCRRK    9 (30)
T ss_pred             CCCCCCCC
Confidence            45555443


No 209
>KOG2747|consensus
Probab=24.90  E-value=48  Score=20.79  Aligned_cols=25  Identities=28%  Similarity=0.542  Sum_probs=20.3

Q ss_pred             ccCCCCccccCChhHHHHHHHHhcc
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKHV   68 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~~   68 (86)
                      |.|.-|.+-+.....|++|+..-.-
T Consensus       159 YiCEfCLkY~~s~~~l~rH~~kC~~  183 (396)
T KOG2747|consen  159 YICEFCLKYMKSRTSLQRHLKKCKL  183 (396)
T ss_pred             EEehHHHhHhchHHHHHHHHHhcCC
Confidence            7889999999999999999755443


No 210
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=24.63  E-value=35  Score=11.74  Aligned_cols=6  Identities=33%  Similarity=1.032  Sum_probs=2.8

Q ss_pred             CCCCcc
Q psy4268          46 CTLCSY   51 (86)
Q Consensus        46 c~~c~~   51 (86)
                      |..||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            444443


No 211
>KOG1994|consensus
Probab=24.60  E-value=55  Score=18.95  Aligned_cols=21  Identities=29%  Similarity=0.643  Sum_probs=17.1

Q ss_pred             ceecccccccccChHHHHHHH
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHM   34 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~   34 (86)
                      -|-|-.||-.|.....|..|.
T Consensus       239 h~YC~fCG~~y~~~edl~ehC  259 (268)
T KOG1994|consen  239 HYYCFFCGIKYKDEEDLYEHC  259 (268)
T ss_pred             ceEEEEeccccCCHHHHHHhC
Confidence            378888999999988887764


No 212
>PRK00420 hypothetical protein; Validated
Probab=24.60  E-value=40  Score=17.05  Aligned_cols=27  Identities=15%  Similarity=0.303  Sum_probs=15.2

Q ss_pred             eecccccccccChHHHHHHHHHhhCCCCCccCCCCcccc
Q psy4268          15 YLCDSCDRTYSNRSSLKRHMNYECGKLPAFPCTLCSYAT   53 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~f   53 (86)
                      -.|+.||..+..         ...|  . ..|+.||...
T Consensus        24 ~~CP~Cg~pLf~---------lk~g--~-~~Cp~Cg~~~   50 (112)
T PRK00420         24 KHCPVCGLPLFE---------LKDG--E-VVCPVHGKVY   50 (112)
T ss_pred             CCCCCCCCccee---------cCCC--c-eECCCCCCee
Confidence            467778754421         1223  2 5688887644


No 213
>cd00296 SIR2 SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer. Also included in this superfamily is a group of uncharacterized Sir2-like proteins which lack certain key catalytic
Probab=24.40  E-value=1.2e+02  Score=16.79  Aligned_cols=19  Identities=26%  Similarity=0.597  Sum_probs=11.6

Q ss_pred             CCCCCCceecccccccccC
Q psy4268           8 APSGEKRYLCDSCDRTYSN   26 (86)
Q Consensus         8 ~h~~~~~~~c~~c~~~~~~   26 (86)
                      .|..-....|..|+..+..
T Consensus       107 lHG~~~~~~C~~C~~~~~~  125 (222)
T cd00296         107 LHGSLDRVRCTSCGKEYPR  125 (222)
T ss_pred             ecCCCCccEECCCCCCcch
Confidence            4555555677778765544


No 214
>PRK12860 transcriptional activator FlhC; Provisional
Probab=24.39  E-value=53  Score=18.32  Aligned_cols=9  Identities=22%  Similarity=0.803  Sum_probs=4.1

Q ss_pred             ecccccccc
Q psy4268          16 LCDSCDRTY   24 (86)
Q Consensus        16 ~c~~c~~~~   24 (86)
                      .|..|+..|
T Consensus       136 ~C~~Cgg~f  144 (189)
T PRK12860        136 RCCRCGGKF  144 (189)
T ss_pred             cCCCCCCCe
Confidence            444444444


No 215
>PLN03239 histone acetyltransferase; Provisional
Probab=24.39  E-value=54  Score=20.22  Aligned_cols=21  Identities=19%  Similarity=0.213  Sum_probs=18.5

Q ss_pred             ccCCCCccccCChhHHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHYY   64 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~   64 (86)
                      |.|..|.+-|.+...+.+|+.
T Consensus       107 YiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        107 YVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             EEeccchhhhcCHHHHHHHHH
Confidence            899999999999999988863


No 216
>KOG2932|consensus
Probab=24.33  E-value=1.5e+02  Score=18.29  Aligned_cols=25  Identities=24%  Similarity=0.482  Sum_probs=20.0

Q ss_pred             ccCCC---CccccCChhHHHHHHHHhcc
Q psy4268          44 FPCTL---CSYATKRKTSLASHYYRKHV   68 (86)
Q Consensus        44 ~~c~~---c~~~f~~~~~l~~h~~~~~~   68 (86)
                      |.|..   |.++|.....|+.|+.-.|+
T Consensus       145 FmC~~~~GC~RTyLsqrDlqAHInhrH~  172 (389)
T KOG2932|consen  145 FMCAAPHGCLRTYLSQRDLQAHINHRHG  172 (389)
T ss_pred             EEeecchhHHHHHhhHHHHHHHhhhhhc
Confidence            77754   88999999999999855555


No 217
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=24.31  E-value=25  Score=17.47  Aligned_cols=10  Identities=30%  Similarity=0.796  Sum_probs=6.6

Q ss_pred             Cceecccccc
Q psy4268          13 KRYLCDSCDR   22 (86)
Q Consensus        13 ~~~~c~~c~~   22 (86)
                      ||..|..|+.
T Consensus         1 ~p~~CpYCg~   10 (102)
T PF11672_consen    1 KPIICPYCGG   10 (102)
T ss_pred             CCcccCCCCC
Confidence            4567777774


No 218
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=24.03  E-value=44  Score=13.21  Aligned_cols=14  Identities=14%  Similarity=0.370  Sum_probs=8.6

Q ss_pred             cCCCCccccCChhH
Q psy4268          45 PCTLCSYATKRKTS   58 (86)
Q Consensus        45 ~c~~c~~~f~~~~~   58 (86)
                      .|.-|++.|-..+.
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            57788888876544


No 219
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=23.84  E-value=45  Score=12.50  Aligned_cols=12  Identities=25%  Similarity=0.794  Sum_probs=8.3

Q ss_pred             Cceecccccccc
Q psy4268          13 KRYLCDSCDRTY   24 (86)
Q Consensus        13 ~~~~c~~c~~~~   24 (86)
                      +-|+|..|+...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            468888887544


No 220
>PRK01343 zinc-binding protein; Provisional
Probab=23.79  E-value=52  Score=14.49  Aligned_cols=11  Identities=27%  Similarity=0.754  Sum_probs=7.9

Q ss_pred             ccCCCCccccC
Q psy4268          44 FPCTLCSYATK   54 (86)
Q Consensus        44 ~~c~~c~~~f~   54 (86)
                      ..|..|++.+.
T Consensus        10 ~~CP~C~k~~~   20 (57)
T PRK01343         10 RPCPECGKPST   20 (57)
T ss_pred             CcCCCCCCcCc
Confidence            56888887654


No 221
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=23.68  E-value=96  Score=15.36  Aligned_cols=22  Identities=18%  Similarity=0.483  Sum_probs=16.0

Q ss_pred             ceecccccccccChHHHHHHHH
Q psy4268          14 RYLCDSCDRTYSNRSSLKRHMN   35 (86)
Q Consensus        14 ~~~c~~c~~~~~~~~~l~~h~~   35 (86)
                      -+.|..||..+..........+
T Consensus        31 ~~~C~~CGe~~~~~e~~~~~~~   52 (127)
T TIGR03830        31 GWYCPACGEELLDPEESKRNSA   52 (127)
T ss_pred             eeECCCCCCEEEcHHHHHHHHH
Confidence            4789999988887776654443


No 222
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=23.47  E-value=41  Score=12.31  Aligned_cols=10  Identities=30%  Similarity=0.869  Sum_probs=6.7

Q ss_pred             ccCCCCcccc
Q psy4268          44 FPCTLCSYAT   53 (86)
Q Consensus        44 ~~c~~c~~~f   53 (86)
                      |.|..|+..+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            6777777654


No 223
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=23.45  E-value=61  Score=14.05  Aligned_cols=11  Identities=9%  Similarity=0.359  Sum_probs=3.9

Q ss_pred             CCCccccCChh
Q psy4268          47 TLCSYATKRKT   57 (86)
Q Consensus        47 ~~c~~~f~~~~   57 (86)
                      ..|+..|...+
T Consensus        28 ~~C~H~fek~a   38 (57)
T PF11789_consen   28 KKCGHTFEKEA   38 (57)
T ss_dssp             SSS--EEEHHH
T ss_pred             CCCCCeecHHH
Confidence            34444444443


No 224
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=23.33  E-value=24  Score=19.59  Aligned_cols=14  Identities=29%  Similarity=0.636  Sum_probs=9.8

Q ss_pred             CceecccccccccC
Q psy4268          13 KRYLCDSCDRTYSN   26 (86)
Q Consensus        13 ~~~~c~~c~~~~~~   26 (86)
                      ++-.|.+|+..|..
T Consensus         5 k~rKCKvCg~~F~P   18 (189)
T PF05766_consen    5 KRRKCKVCGEWFVP   18 (189)
T ss_pred             CCCcCcccCCcccc
Confidence            45678888877754


No 225
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=22.38  E-value=41  Score=16.51  Aligned_cols=12  Identities=33%  Similarity=0.769  Sum_probs=8.6

Q ss_pred             CCCceecccccc
Q psy4268          11 GEKRYLCDSCDR   22 (86)
Q Consensus        11 ~~~~~~c~~c~~   22 (86)
                      |-+.|.|.+|+.
T Consensus         3 ~lkewkC~VCg~   14 (103)
T COG4847           3 GLKEWKCYVCGG   14 (103)
T ss_pred             ccceeeEeeeCC
Confidence            345688888875


No 226
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=22.36  E-value=48  Score=13.19  Aligned_cols=7  Identities=29%  Similarity=0.856  Sum_probs=3.7

Q ss_pred             cCCCCcc
Q psy4268          45 PCTLCSY   51 (86)
Q Consensus        45 ~c~~c~~   51 (86)
                      .|+.|+.
T Consensus         2 ~Cp~Cg~    8 (43)
T PF08271_consen    2 KCPNCGS    8 (43)
T ss_dssp             SBTTTSS
T ss_pred             CCcCCcC
Confidence            4555554


No 227
>KOG4118|consensus
Probab=22.27  E-value=53  Score=14.93  Aligned_cols=24  Identities=25%  Similarity=0.599  Sum_probs=14.4

Q ss_pred             ccCCCCccccCChhHHHHHHHHhc
Q psy4268          44 FPCTLCSYATKRKTSLASHYYRKH   67 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~~~~~   67 (86)
                      +.|..|.........+..|...-|
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kH   62 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKH   62 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcC
Confidence            567777666666666666654443


No 228
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=22.24  E-value=41  Score=12.84  Aligned_cols=11  Identities=18%  Similarity=0.470  Sum_probs=7.4

Q ss_pred             ccCCCCccccC
Q psy4268          44 FPCTLCSYATK   54 (86)
Q Consensus        44 ~~c~~c~~~f~   54 (86)
                      +.|..|+..|.
T Consensus        22 ~~C~~Cg~~~~   32 (33)
T PF08792_consen   22 EVCIFCGSSFP   32 (33)
T ss_pred             EEcccCCcEee
Confidence            56777876653


No 229
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=21.62  E-value=74  Score=17.25  Aligned_cols=19  Identities=16%  Similarity=0.520  Sum_probs=14.2

Q ss_pred             CceecccccccccChHHHH
Q psy4268          13 KRYLCDSCDRTYSNRSSLK   31 (86)
Q Consensus        13 ~~~~c~~c~~~~~~~~~l~   31 (86)
                      ....|..||+.|.....+.
T Consensus       113 ~~~~C~~CG~~f~~~~~i~  131 (180)
T PRK12387        113 ALCNCRVCGRPFAVQKEID  131 (180)
T ss_pred             CcccchhhCCccccHHHHH
Confidence            4578999999988765544


No 230
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=21.06  E-value=36  Score=11.97  Aligned_cols=6  Identities=33%  Similarity=1.016  Sum_probs=3.2

Q ss_pred             CCCCcc
Q psy4268          46 CTLCSY   51 (86)
Q Consensus        46 c~~c~~   51 (86)
                      |..||.
T Consensus        19 C~~CG~   24 (26)
T PF13248_consen   19 CPNCGA   24 (26)
T ss_pred             ChhhCC
Confidence            555554


No 231
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=21.02  E-value=63  Score=13.97  Aligned_cols=18  Identities=28%  Similarity=0.654  Sum_probs=13.8

Q ss_pred             eecccccccccChHHHHH
Q psy4268          15 YLCDSCDRTYSNRSSLKR   32 (86)
Q Consensus        15 ~~c~~c~~~~~~~~~l~~   32 (86)
                      +-|-.||..|.....|..
T Consensus        28 ~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   28 NYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             ceeeeeCCccCCHHHHHh
Confidence            678889988888777654


No 232
>PRK06260 threonine synthase; Validated
Probab=20.93  E-value=80  Score=19.53  Aligned_cols=10  Identities=30%  Similarity=0.926  Sum_probs=6.3

Q ss_pred             eecccccccc
Q psy4268          15 YLCDSCDRTY   24 (86)
Q Consensus        15 ~~c~~c~~~~   24 (86)
                      +.|..|+..|
T Consensus         4 ~~C~~cg~~~   13 (397)
T PRK06260          4 LKCIECGKEY   13 (397)
T ss_pred             EEECCCCCCC
Confidence            5666676655


No 233
>PF06353 DUF1062:  Protein of unknown function (DUF1062);  InterPro: IPR009412 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=20.49  E-value=51  Score=17.43  Aligned_cols=10  Identities=50%  Similarity=1.361  Sum_probs=8.1

Q ss_pred             eecccccccc
Q psy4268          15 YLCDSCDRTY   24 (86)
Q Consensus        15 ~~c~~c~~~~   24 (86)
                      |.|..|+.++
T Consensus        14 YrC~~C~~Tw   23 (142)
T PF06353_consen   14 YRCEKCDYTW   23 (142)
T ss_pred             EEcccCcCcc
Confidence            8899998765


No 234
>KOG0801|consensus
Probab=20.44  E-value=63  Score=17.67  Aligned_cols=17  Identities=24%  Similarity=0.507  Sum_probs=9.7

Q ss_pred             ccccCCCCCCceeccccccc
Q psy4268           4 YYFSAPSGEKRYLCDSCDRT   23 (86)
Q Consensus         4 ~h~~~h~~~~~~~c~~c~~~   23 (86)
                      .|+..|+|   ++|.+|.+.
T Consensus       131 ~hi~~~~g---~KCPvC~K~  147 (205)
T KOG0801|consen  131 VHIMDHSG---MKCPVCHKV  147 (205)
T ss_pred             eeeeccCC---ccCCccccc
Confidence            34444554   567777653


No 235
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=20.05  E-value=1.3e+02  Score=16.47  Aligned_cols=20  Identities=10%  Similarity=0.273  Sum_probs=15.0

Q ss_pred             ccCCCCccccCChhHHHHHH
Q psy4268          44 FPCTLCSYATKRKTSLASHY   63 (86)
Q Consensus        44 ~~c~~c~~~f~~~~~l~~h~   63 (86)
                      +.|..||+.|..-+....-.
T Consensus       131 ~~C~~CgkiYW~GsHw~~m~  150 (165)
T COG1656         131 YRCPKCGKIYWKGSHWRRMV  150 (165)
T ss_pred             eECCCCcccccCchHHHHHH
Confidence            45999999998777665443


Done!