Diaphorina citri psyllid: psy4283


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MTMGEESPVTSLILPVLFRPILSQLEKRDVQASQTLRAALSRTETANPGFAYDFVVGIMRQGELSVNMNESILRLQGAASDVDAVEYKLNRSEDAFQELNKKSCALKKILSRIPDEITDRKTFLETIKEIASAIKKLLDAVNEVSGFIPGPSNKQALEQRKREFVKFSKRFSNTLKDYFKEGQANSVYVSALYLIHQTNMIMVTVKSKCE
cccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcc
*********TSLILPVLFRPILSQLEKRDVQASQTLRAALSRTETANPGFAYDFVVGIMRQGELSVNMNESILRLQGAASDVDAVEYKLNRSEDAFQELNKKSCALKKILSRIPDEITDRKTFLETIKEIASAIKKLLDAVNEVSGFIPG**********KREFVKFSKRFSNTLKDYFKEGQANSVYVSALYLIHQTNMIMVTVKSKC*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTMGEESPVTSLILPVLFRPILSQLEKRDVQASQTLRAALSRTETANPGFAYDFVVGIMRQGELSVNMNESILRLQGAASDxxxxxxxxxxxxxxxxxxxxxSCALKKILSRIPDEITDRKTFLETIKEIASAIKKLLDAVNEVSGFIPGPSNKQALEQRKREFVKFSKRFSNTLKDYFKEGQANSVYVSALYLIHQTNMIMVTVKSKCE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Programmed cell death protein 10 Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and MST4 activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development.very confidentQ9BUL8
Programmed cell death protein 10 Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development.very confidentQ6DF07
Programmed cell death protein 10 Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and MST4 activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development.confidentQ6NX65

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043406 [BP]positive regulation of MAP kinase activityconfidentGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0023056, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0001932, GO:0031401, GO:0051338, GO:0045860, GO:0001934, GO:0048522
GO:0005829 [CC]cytosolconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008284 [BP]positive regulation of cell proliferationconfidentGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0043066 [BP]negative regulation of apoptotic processconfidentGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0047485 [MF]protein N-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0003007 [BP]heart morphogenesisprobableGO:0032502, GO:0007507, GO:0009887, GO:0032501, GO:0044707, GO:0048513, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0010171 [BP]body morphogenesisprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0001525 [BP]angiogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AJM, chain A
Confidence level:very confident
Coverage over the Query: 6-208
View the alignment between query and template
View the model in PyMOL