Diaphorina citri psyllid: psy4294

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MSVASQNSVIQNFKIDIGGRIVGGRDVNPGEVPYIVSLSLYGNLYCGGSLISLQWFLSARHCFVTENLVWNQFNPLIIAGSIYRNYKEQKRQPQLNEIALIYWHSDADLAMVKLKEPFRQTTFVKPLDYYTARETNYINDVLSKTDRSEMSIVSGFGVTFQRDKDGIVSWGIGCALGYPGIVSWGIGCALGYPGVYVRVDHYDPWIQSVKNNGDNAGVLISALHMTYRAVLIPILEVL
ccCCccccccccccccccccCEccccccccccccEEEEEEccEEEEEEEEEcccEEEEcccccccccccccccccEEEccEEEEccccEEECcCEEEEEEEcccccccEEEEEccccccccccccccccccccccccccccEEEEcccccEEEEcccccccccccccccccccccCEEEEEEEcccccccccccEEEEccccHHHHHHHHccccccccEEccccccccEEEccEEccc
********VIQNFKIDIGGRIVGGRDVNPGEVPYIVSLSLYGNLYCGGSLISLQWFLSARHCFVTENLVWNQFNPLIIAGSIYRNYKEQKRQPQLNEIALIYWHSDADLAMVKLKEPFRQTTFVKPLDYYTARETNYINDVLSKTDRSEMSIVSGFGVTFQRDKDGIVSWGIGCALGYPGIVSWGIGCALGYPGVYVRVDHYDPWIQSVKNN************MTYRAVLIPILEVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVASQNSVIQNFKIDIGGRIVGGRDVNPGEVPYIVSLSLYGNLYCGGSLISLQWFLSARHCFVTENLVWNQFNPLIIAGSIYRNYKEQKRQPQLNEIALIYWHSDADLAMVKLKEPFRQTTFVKPLDYYTARETNYINDVLSKTDRSEMSIVSGFGVTFQRDKDGIVSWGIGCALGYPGIVSWGIGCALGYPGVYVRVDHYDPWIQSVKNNGDNAGVLISALHMTYRAVLIPILEVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0030193 [BP]regulation of blood coagulationprobableGO:0032101, GO:0080134, GO:0048583, GO:1900046, GO:0061041, GO:0065007, GO:0051239, GO:0008150, GO:0050818, GO:0050789
GO:0008152 [BP]metabolic processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B9L, chain A
Confidence level:very confident
Coverage over the Query: 18-214
View the alignment between query and template
View the model in PyMOL
Template: 1DAN, chain H
Confidence level:probable
Coverage over the Query: 30-222
View the alignment between query and template
View the model in PyMOL