Diaphorina citri psyllid: psy431


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MKKEKEEEEEEEDEKKGEEEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGEFEFDAPYWDDISDSAKDFIRHLMCVDPERRFTCKQALAHEWICGNAASEKNIHGTVSEQLKKNFAKSRWKQAYHATTVIRQMQKMALTSAQTGASTSNLLGGAQESNKSAAIK
cccccccccHHccccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccc
************DEKKGEEEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGEFEFDAPYWDDISDSAKDFIRHLMCVDPERRFTCKQALAHEWICGNAASEKNIHGTVSEQLKKNFAKSRWKQAYHATTVIRQ********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGEFEFDAPYWDDISDSAKDFIRHLMCVDPERRFTCKQALAHEWICGNAASEKNIHGTVSEQLKKNFAKSRWKQAYHATTVIRQMQKMALTSAQTGASTSNLLGGAQESNKSAAIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcium/calmodulin-dependent protein kinase type 1 Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, regulates transcription activators activity, cell cycle, hormone production, cell differentiation, actin filament organization and neurite outgrowth. Recognizes the substrate consensus sequence [MVLIF]-x-R-x(2)-[ST]-x(3)-[MVLIF]. Regulates axonal extension and growth cone motility in hippocampal and cerebellar nerve cells. Upon NMDA receptor-mediated Ca(2+) elevation, promotes dendritic growth in hippocampal neurons and is essential in synapses for full long-term potentiation (LTP) and ERK2-dependent translational activation. Downstream of NMDA receptors, promotes the formation of spines and synapses in hippocampal neurons by phopshorylating ARHGEF7/BETAPIX on 'Ser-673', which results in the enhancement of ARHGEF7 activity and activation of RAC1. Promotes neuronal differentiation and neurite outgrowth by activation and phosphorylation of MARK2 on 'Ser-91', 'Ser-92', 'Ser-93' and 'Ser-294'. Promotes nuclear export of HDAC5 and binding to 14-3-3 by phosphorylation of 'Ser-259' and 'Ser-498' in the regulation of muscle cell differentiation. Regulates NUMB-mediated endocytosis by phosphorylation of NUMB on 'Ser-276' and 'Ser-295'. Involved in the regulation of basal and estrogen-stimulated migration of medulloblastoma cells through ARHGEF7/BETAPIX phosphorylation. Is required for proper activation of cyclin-D1/CDK4 complex during G1 progression in diploid fibroblasts. Plays a role in K(+) and ANG2-mediated regulation of the aldosterone synthase (CYP11B2) to produce aldosterone in the adrenal cortex. Phosphorylates EIF4G3/eIF4GII. In vitro phosphorylates CREB1, ATF1, CFTR, MYL9, SYN1/synapsin I and SYNII/synapsin II.confidentQ91YS8
Calcium/calmodulin-dependent protein kinase type 1 Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK1 signaling cascade and, upon calcium influx, regulates transcription activators activity, cell cycle, hormone production, cell differentiation, actin filament organization and neurite outgrowth. Recognizes the substrate consensus sequence [MVLIF]-x-R-x(2)-[ST]-x(3)-[MVLIF]. Regulates axonal extension and growth cone motility in hippocampal and cerebellar nerve cells. Upon NMDA receptor-mediated Ca(2+) elevation, promotes dendritic growth in hippocampal neurons and is essential in synapses for full long-term potentiation (LTP) and ERK2-dependent translational activation. Downstream of NMDA receptors, promotes the formation of spines and synapses in hippocampal neurons by phopshorylating ARHGEF7/BETAPIX on 'Ser-694', which results in the enhancement of ARHGEF7 activity and activation of RAC1. Promotes neuronal differentiation and neurite outgrowth by activation and phosphorylation of MARK2 on 'Ser-91', 'Ser-92', 'Ser-93' and 'Ser-294'. Promotes nuclear export of HDAC5 and binding to 14-3-3 by phosphorylation of 'Ser-259' and 'Ser-498' in the regulation of muscle cell differentiation. Regulates NUMB-mediated endocytosis by phosphorylation of NUMB on 'Ser-276' and 'Ser-295'. Involved in the regulation of basal and estrogen-stimulated migration of medulloblastoma cells through ARHGEF7/BETAPIX phosphorylation (By similarity). Is required for proper activation of cyclin-D1/CDK4 complex during G1 progression in diploid fibroblasts. Plays a role in K(+) and ANG2-mediated regulation of the aldosterone synthase (CYP11B2) to produce aldosterone in the adrenal cortex. Phosphorylates EIF4G3/eIF4GII. In vitro phosphorylates CREB1, ATF1, CFTR, MYL9, SYN1/synapsin I and SYNII/synapsin II.confidentQ14012
Calcium/calmodulin-dependent protein kinase type 1 Calcium/calmodulin-dependent protein kinase belonging to a calcium-triggered signaling cascade which results in transcriptional activation, at least in part through phosphorylation of crh-1. Regulates gene expression, sensory morphology, and function of the AFD thermosensory neurons.confidentQ9TXJ0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050794 [BP]regulation of cellular processconfidentGO:0008150, GO:0065007, GO:0050789
GO:0009987 [BP]cellular processconfidentGO:0008150
GO:0005954 [CC]calcium- and calmodulin-dependent protein kinase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0032793 [BP]positive regulation of CREB transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044093, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0051091, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0071902 [BP]positive regulation of protein serine/threonine kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0045860, GO:0071900, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0046827 [BP]positive regulation of protein export from nucleusprobableGO:0033157, GO:0070201, GO:0032879, GO:0032388, GO:0060341, GO:0051050, GO:0051049, GO:0032386, GO:0090316, GO:0050794, GO:0008150, GO:0046824, GO:0046825, GO:0046822, GO:0048518, GO:0065007, GO:0051222, GO:0051223, GO:0050789, GO:0032880
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0010976 [BP]positive regulation of neuron projection developmentprobableGO:0032502, GO:0010975, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0031346, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0065007, GO:0048518, GO:0051130, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731, GO:0048522
GO:0043393 [BP]regulation of protein bindingprobableGO:0008150, GO:0065009, GO:0051098, GO:0065007
GO:0004683 [MF]calmodulin-dependent protein kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0060999 [BP]positive regulation of dendritic spine developmentprobableGO:0044707, GO:0010975, GO:0030154, GO:0051128, GO:0031344, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0050789, GO:0045664, GO:0060998, GO:0065007, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0050773, GO:0051094, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007049 [BP]cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0045202 [CC]synapseprobableGO:0005575
GO:0051149 [BP]positive regulation of muscle cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0051147, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0040040 [BP]thermosensory behaviorprobableGO:0009628, GO:0044702, GO:0044704, GO:0019098, GO:0044708, GO:0050896, GO:0007610, GO:0022414, GO:0008150, GO:0009266, GO:0044699, GO:0000003
GO:0048584 [BP]positive regulation of response to stimulusprobableGO:0048518, GO:0065007, GO:0048583, GO:0050789, GO:0008150
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0030334 [BP]regulation of cell migrationprobableGO:0051270, GO:0050794, GO:0008150, GO:0040012, GO:2000145, GO:0065007, GO:0032879, GO:0050789
GO:0006913 [BP]nucleocytoplasmic transportprobableGO:0051169, GO:0009987, GO:0046907, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0051835 [BP]positive regulation of synapse structural plasticityprobableGO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0051128, GO:0023052, GO:0050789, GO:0044699, GO:0065007, GO:0048518, GO:0065008, GO:0051130, GO:0032501, GO:0050877, GO:0009987, GO:0050794, GO:0008150, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0044763, GO:0051823, GO:0048522
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JAM, chain A
Confidence level:very confident
Coverage over the Query: 9-133
View the alignment between query and template
View the model in PyMOL