Diaphorina citri psyllid: psy4347

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810------

TSKEEQQHLVSYRQLLGYKAHRKTSTNLVRDNSGTMRSMSLSRFSQVHLNRYLHTSSAAYVGNKQGDKPSPSTLIKTQKRTQSNRCLTTTQKRNCFHPGASTLTTTNEIETAKEEVTSQEMIKAMLTHIWPKDEPQIRNRVKVAMGLLYAVDELNTGIVSDGALLELTNATDALIASATSIILGYGIARICSSGFNELRNAVFASVAQRSIRKIAKNVFLHLHNLDLAFHLNRQTGALSKIIDRGSRGINFVLSAMVFNIVPTIFELALISSILSYKCGSEFSLLAVSCVGIYTAYTLSITQWRTQFRVNMNKAENEAGNKAIDSLINYETVKYFNNEKFEADRYEGVLKKYEQAALKTSTSLATLNFGKAQYEQAALKTSTSLATLNFGQSAIFSTAMTLSMIFAAREIAHGNLTVGDLVMVNGLLFQLSMPLGFLGSVYREVRQAFIDMQTMFTLMLKEPTIKNKANALPLVLTTSNASIEFRDVNFSYIDKHTKRIFSNLNFTIPAGKSVAIVGGSGSGKSTIIRLLYRFFEPNAGAIYIDGKNINDVDLDSLRRHIAIVPQDPVLFHDTILYNINYGDKSKSYEETIEAAKLADLHNSIIKWPNHYETQVGERGLKLSGGEKQRVAIARAILKNTPILVFDEATSSLDSITENNILSSLKTASRNKTTICIAHRLSTIKHLLGYKAHRKTSTNLVRGNSSAMRSMSLSRFSQVHLNRYLHTSSAAYVGNKQGDKPSPSTLIKTQKRNCFHPGASTLTTTNEIETAKEEVTSQEMIKAMLTHIWPKDEPQIRNRVKVAMGLLVSAKLKLRSIL

ccHHHHHHHHHHHHHHccccccccHHHHHHcccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEECcccccccccccccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHccccccccccccccHHHHHHHcccccccHHHHHHHHHHcccHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHccccEEEEccccccccccccEEEEccccHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccc

**********SYRQLLGYKAHRKTSTNLVRD**GTMRSMSLSRFSQVHLNRYLH*****************************************************************EMIKAMLTHIWPKDEPQIRNRVKVAMGLLYAVDELNTGIVSDGALLELTNATDALIASATSIILGYGIARICSSGFNELRNAVFASVAQRSIRKIAKNVFLHLHNLDLAFHLNRQTGALSKIIDRGSRGINFVLSAMVFNIVPTIFELALISSILSYKCGSEFSLLAVSCVGIYTAYTLSITQWRTQFRVNMNKAENEAGNKAIDSLINYETVKYFNNEKFEADRYEGVLKKYEQAALKTSTSLATLNFGKAQYEQAALKTSTSLATLNFGQSAIFSTAMTLSMIFAAREIAHGNLTVGDLVMVNGLLFQLSMPLGFLGSVYREVRQAFIDMQTMFTLMLKEPTIKNKANALPLVLTTSNASIEFRDVNFSYIDKHTKRIFSNLNFTIPAGKSVAIVGGSGSGKSTIIRLLYRFFEPNAGAIYIDGKNINDVDLDSLRRHIAIVPQDPVLFHDTILYNINYGDKSKSYEETIEAAKLADLHNSIIKWPNHYETQVGERGLKLSGGEKQRVAIARAILKNTPILVFDEATSSLDSITENNILSSLKTASRNKTTICIAHRLSTIKHLLGYKAHRKTSTNLVRGNSSAMRSMS*******************************************************************MIKAMLTHIWPKDEPQIRNRVKVAMGLLVSAKLKLRSIL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ATP-binding cassette sub-family B member 7, mitochondrial	Could be involved in the transport of heme from the mitochondria to the cytosol. Plays a central role in the maturation of cytosolic iron-sulfur (Fe/S) cluster-containing proteins.	confident	O75027
ATP-binding cassette sub-family B member 7, mitochondrial	Could be involved in the transport of heme from the mitochondria to the cytosol. Plays a central role in the maturation of cytosolic iron-sulfur (Fe/S) cluster-containing proteins.	confident	Q61102
ATP-binding cassette sub-family B member 7, mitochondrial	Could be involved in the transport of heme from the mitochondria to the cytosol. Plays a central role in the maturation of cytosolic iron-sulfur (Fe/S) cluster-containing proteins.	confident	Q704E8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0065007 [BP]	biological regulation	probable	GO:0008150
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0022857 [MF]	transmembrane transporter activity	probable	GO:0005215, GO:0003674
GO:0031966 [CC]	mitochondrial membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0031967, GO:0031975, GO:0044446, GO:0005740, GO:0005739, GO:0044429, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 481-546,558-694
View the alignment between query and template
View the model in PyMOL

Template: 3G5U, chain A
Confidence level:very confident
Coverage over the Query: 184-359,381-707
View the alignment between query and template
View the model in PyMOL

Template: 2HYD, chain A
Confidence level:confident
Coverage over the Query: 149-684
View the alignment between query and template
View the model in PyMOL

Template: 4FWI, chain B
Confidence level:probable
Coverage over the Query: 482-755
View the alignment between query and template
View the model in PyMOL